Collagen alpha-1(XXVIII) chain

Overview
NameCollagen alpha-1(XXVIII) chain
Smed IDSMED30029471
Length (bp)1586
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Collagen alpha-1(XXVIII) chain (SMED30029471) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Collagen alpha-1(XXVIII) chain (SMED30029471) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029471

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30029471SMESG000033673.1 SmedASXL_017382SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30029471SMESG000033673.1 dd_1071dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
pharynxSMED30029471SMESG000033673.1 dd_Smed_v4_1071_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30029471SMESG000033673.1 dd_Smed_v4_1071_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029471SMESG000033673.1 dd_Smed_v4_1071_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30029471SMESG000033673.1 dd_Smed_v4_1071_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30029471SMESG000033673.1 dd_Smed_v4_1071_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30029471SMESG000033673.1 dd_Smed_v4_1071_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30029471SMESG000033673.1 dd_Smed_v6_1071_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30029471SMESG000033673.1 OX_Smed_1.0.09131ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
head regionSMED30029471SMESG000033673.1 OX_Smed_1.0.14492ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30029471SMESG000033673.1 dd_Smed_v6_1071_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx progenitor cellSMED30029471SMESG000033673.1 dd_Smed_v6_1071_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30029471SMESG000033673.1 dd_Smed_v4_1071_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Human
Match: VIT (vitrin [Source:HGNC Symbol;Acc:HGNC:12697])

HSP 1 Score: 88.1965 bits (217), Expect = 2.331e-18
Identity = 51/186 (27.42%), Postives = 92/186 (49.46%), Query Frame = 1
Query:  154 KKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAISDKKNFYLIKDFDSLPKIVSTIVQKTCTGF 711
            K C+ +A ++ F++DGS+SVG  NF     F T +     I +  TR+  + Y    +L F  DKY++  D+   I +  +  G T  G A+N  L  +  K++ +  K++ILI+DG+    +    +A  LK +    I +    + +   +     + + + + +FD+L + V  I+Q  CT F
Sbjct:  157 KTCLNSA-DIGFVIDGSSSVGTGNFRTVLQFVTNLTKEFEISDTDTRIGAVQYTYEQRLEFGFDKYSSKPDILNAIKRVGYWSGGTSTGAAINFALEQLFKKSKPNKRKLMILITDGRSYDDVRIPAMAAHLKGVITYAIGVAWAAQEELEVIATHPARDHSFFVDEFDNLHQYVPRIIQNICTEF 341          
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Human
Match: VIT (vitrin [Source:HGNC Symbol;Acc:HGNC:12697])

HSP 1 Score: 88.1965 bits (217), Expect = 1.019e-17
Identity = 51/187 (27.27%), Postives = 93/187 (49.73%), Query Frame = 1
Query:  154 KKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAISDKKNFYLIKDFDSLPKIVSTIVQKTCTGFH 714
            K C+ +A ++ F++DGS+SVG  NF     F T +     I +  TR+  + Y    +L F  DKY++  D+   I +  +  G T  G A+N  L  +  K++ +  K++ILI+DG+    +    +A  LK +    I +    + +   +     + + + + +FD+L + V  I+Q  CT F+
Sbjct:  440 KTCLNSA-DIGFVIDGSSSVGTGNFRTVLQFVTNLTKEFEISDTDTRIGAVQYTYEQRLEFGFDKYSSKPDILNAIKRVGYWSGGTSTGAAINFALEQLFKKSKPNKRKLMILITDGRSYDDVRIPAMAAHLKGVITYAIGVAWAAQEELEVIATHPARDHSFFVDEFDNLHQYVPRIIQNICTEFN 625          

HSP 2 Score: 57.3806 bits (137), Expect = 4.575e-8
Identity = 48/208 (23.08%), Postives = 91/208 (43.75%), Query Frame = 1
Query:  115 LEFQILKELTQEDKKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKT---RRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMI-------AISDKKNFY--LIKDFDSLPKIVSTIVQKTC 702
            L  Q L+ ++  D  C     ++ F++DGSTS+G   F  +K     +   L IG     + ++ Y   P   FN+  + NS+D+   I K     G++ VG A++ V  +  SK    R     V++++ DG     ++      +   ++   ITI    E ++  ++       A+     FY   ++ +  L K +  +V++ C
Sbjct:  227 LSTQSLEPVSLGDPNCKI---DLSFLIDGSTSIGKRRFRIQKQLLADVAQALDIGPAGPLMGVVQYGDNPATHFNLKTHTNSRDLKTAIEKITQRGGLSNVGRAISFVTKNFFSKANGNRSGAPNVVVVMVDGWPTDKVEEASRLARESGINIFFITIEGAAENEKQYVVEPNFANKAVCRTNGFYSLHVQSWFGLHKTLQPLVKRVC 431          
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Human
Match: VIT (vitrin [Source:HGNC Symbol;Acc:HGNC:12697])

HSP 1 Score: 87.8113 bits (216), Expect = 1.102e-17
Identity = 51/186 (27.42%), Postives = 92/186 (49.46%), Query Frame = 1
Query:  154 KKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAISDKKNFYLIKDFDSLPKIVSTIVQKTCTGF 711
            K C+ +A ++ F++DGS+SVG  NF     F T +     I +  TR+  + Y    +L F  DKY++  D+   I +  +  G T  G A+N  L  +  K++ +  K++ILI+DG+    +    +A  LK +    I +    + +   +     + + + + +FD+L + V  I+Q  CT F
Sbjct:  466 KTCLNSA-DIGFVIDGSSSVGTGNFRTVLQFVTNLTKEFEISDTDTRIGAVQYTYEQRLEFGFDKYSSKPDILNAIKRVGYWSGGTSTGAAINFALEQLFKKSKPNKRKLMILITDGRSYDDVRIPAMAAHLKGVITYAIGVAWAAQEELEVIATHPARDHSFFVDEFDNLHQYVPRIIQNICTEF 650          

HSP 2 Score: 57.3806 bits (137), Expect = 4.590e-8
Identity = 48/208 (23.08%), Postives = 91/208 (43.75%), Query Frame = 1
Query:  115 LEFQILKELTQEDKKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKT---RRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMI-------AISDKKNFY--LIKDFDSLPKIVSTIVQKTC 702
            L  Q L+ ++  D  C     ++ F++DGSTS+G   F  +K     +   L IG     + ++ Y   P   FN+  + NS+D+   I K     G++ VG A++ V  +  SK    R     V++++ DG     ++      +   ++   ITI    E ++  ++       A+     FY   ++ +  L K +  +V++ C
Sbjct:  253 LSTQSLEPVSLGDPNC---KIDLSFLIDGSTSIGKRRFRIQKQLLADVAQALDIGPAGPLMGVVQYGDNPATHFNLKTHTNSRDLKTAIEKITQRGGLSNVGRAISFVTKNFFSKANGNRSGAPNVVVVMVDGWPTDKVEEASRLARESGINIFFITIEGAAENEKQYVVEPNFANKAVCRTNGFYSLHVQSWFGLHKTLQPLVKRVC 457          
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Human
Match: VIT (vitrin [Source:HGNC Symbol;Acc:HGNC:12697])

HSP 1 Score: 87.8113 bits (216), Expect = 1.205e-17
Identity = 51/186 (27.42%), Postives = 92/186 (49.46%), Query Frame = 1
Query:  154 KKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAISDKKNFYLIKDFDSLPKIVSTIVQKTCTGF 711
            K C+ +A ++ F++DGS+SVG  NF     F T +     I +  TR+  + Y    +L F  DKY++  D+   I +  +  G T  G A+N  L  +  K++ +  K++ILI+DG+    +    +A  LK +    I +    + +   +     + + + + +FD+L + V  I+Q  CT F
Sbjct:  467 KTCLNSA-DIGFVIDGSSSVGTGNFRTVLQFVTNLTKEFEISDTDTRIGAVQYTYEQRLEFGFDKYSSKPDILNAIKRVGYWSGGTSTGAAINFALEQLFKKSKPNKRKLMILITDGRSYDDVRIPAMAAHLKGVITYAIGVAWAAQEELEVIATHPARDHSFFVDEFDNLHQYVPRIIQNICTEF 651          

HSP 2 Score: 56.9954 bits (136), Expect = 7.207e-8
Identity = 43/187 (22.99%), Postives = 83/187 (44.39%), Query Frame = 1
Query:  178 EVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKT---RRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMI-------AISDKKNFY--LIKDFDSLPKIVSTIVQKTC 702
            ++ F++DGSTS+G   F  +K     +   L IG     + ++ Y   P   FN+  + NS+D+   I K     G++ VG A++ V  +  SK    R     V++++ DG     ++      +   ++   ITI    E ++  ++       A+     FY   ++ +  L K +  +V++ C
Sbjct:  272 DLSFLIDGSTSIGKRRFRIQKQLLADVAQALDIGPAGPLMGVVQYGDNPATHFNLKTHTNSRDLKTAIEKITQRGGLSNVGRAISFVTKNFFSKANGNRSGAPNVVVVMVDGWPTDKVEEASRLARESGINIFFITIEGAAENEKQYVVEPNFANKAVCRTNGFYSLHVQSWFGLHKTLQPLVKRVC 458          
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Human
Match: VIT (vitrin [Source:HGNC Symbol;Acc:HGNC:12697])

HSP 1 Score: 87.8113 bits (216), Expect = 1.254e-17
Identity = 51/187 (27.27%), Postives = 93/187 (49.73%), Query Frame = 1
Query:  154 KKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAISDKKNFYLIKDFDSLPKIVSTIVQKTCTGFH 714
            K C+ +A ++ F++DGS+SVG  NF     F T +     I +  TR+  + Y    +L F  DKY++  D+   I +  +  G T  G A+N  L  +  K++ +  K++ILI+DG+    +    +A  LK +    I +    + +   +     + + + + +FD+L + V  I+Q  CT F+
Sbjct:  488 KTCLNSA-DIGFVIDGSSSVGTGNFRTVLQFVTNLTKEFEISDTDTRIGAVQYTYEQRLEFGFDKYSSKPDILNAIKRVGYWSGGTSTGAAINFALEQLFKKSKPNKRKLMILITDGRSYDDVRIPAMAAHLKGVITYAIGVAWAAQEELEVIATHPARDHSFFVDEFDNLHQYVPRIIQNICTEFN 673          

HSP 2 Score: 57.3806 bits (137), Expect = 5.403e-8
Identity = 48/208 (23.08%), Postives = 91/208 (43.75%), Query Frame = 1
Query:  115 LEFQILKELTQEDKKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKT---RRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMI-------AISDKKNFY--LIKDFDSLPKIVSTIVQKTC 702
            L  Q L+ ++  D  C     ++ F++DGSTS+G   F  +K     +   L IG     + ++ Y   P   FN+  + NS+D+   I K     G++ VG A++ V  +  SK    R     V++++ DG     ++      +   ++   ITI    E ++  ++       A+     FY   ++ +  L K +  +V++ C
Sbjct:  275 LSTQSLEPVSLGDPNC---KIDLSFLIDGSTSIGKRRFRIQKQLLADVAQALDIGPAGPLMGVVQYGDNPATHFNLKTHTNSRDLKTAIEKITQRGGLSNVGRAISFVTKNFFSKANGNRSGAPNVVVVMVDGWPTDKVEEASRLARESGINIFFITIEGAAENEKQYVVEPNFANKAVCRTNGFYSLHVQSWFGLHKTLQPLVKRVC 479          
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Celegans
Match: cut-6 (CUTiclin [Source:UniProtKB/TrEMBL;Acc:Q21540])

HSP 1 Score: 78.5666 bits (192), Expect = 3.304e-15
Identity = 40/112 (35.71%), Postives = 61/112 (54.46%), Query Frame = 1
Query:  172 AGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGK 507
            A EVI +LD S S+G D F K+  FA  + +RL I  + + +ALI Y   P+L F++ ++N+   +   I + E+  G T  G AL + L       R    KV I+I+DG+
Sbjct:   45 AVEVILLLDASGSIGDDTFKKQLSFAMHLASRLNISEDGSHMALIQYAETPKLEFSLGQFNHPTQLEWAIQRIEYQSGATNTGQALRLTLEKGLQGARPGIPKVAIVITDGQ 156          
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Celegans
Match: cut-6 (CUTiclin [Source:UniProtKB/TrEMBL;Acc:Q21540])

HSP 1 Score: 78.5666 bits (192), Expect = 3.304e-15
Identity = 40/112 (35.71%), Postives = 61/112 (54.46%), Query Frame = 1
Query:  172 AGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGK 507
            A EVI +LD S S+G D F K+  FA  + +RL I  + + +ALI Y   P+L F++ ++N+   +   I + E+  G T  G AL + L       R    KV I+I+DG+
Sbjct:   45 AVEVILLLDASGSIGDDTFKKQLSFAMHLASRLNISEDGSHMALIQYAETPKLEFSLGQFNHPTQLEWAIQRIEYQSGATNTGQALRLTLEKGLQGARPGIPKVAIVITDGQ 156          
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Celegans
Match: mua-3 (Transmembrane cell adhesion receptor mua-3 [Source:UniProtKB/Swiss-Prot;Acc:P34576])

HSP 1 Score: 68.9366 bits (167), Expect = 7.209e-12
Identity = 53/207 (25.60%), Postives = 97/207 (46.86%), Query Frame = 1
Query:  160 CIKTAGEVIFILDGSTSVGPDNFNKEK-DFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRST------GKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKE--TDENSMIAISDKKNFYLIKDFDSLPKIVSTIVQKTCTGFHISKCSAPIVKKGP 753
            C K   +++F++DGS S+G   F  E   F  + V    IG + TRV LI Y+   +  F++D+Y +   + + I + ++  G+T  G A+  ++ +  S+ R +        +V I+++DG+    +     A   + LS     IG+       E   IA S  + FY+ K F  L   + +++QK       + C +P  ++ P
Sbjct: 1224 CPKQKTDLVFLIDGSGSIGSYVFKNEVLRFVREFVELFEIGRSKTRVGLIQYSDQIRHEFDLDQYGDRDSLLKGISETQYLTGLTRTGAAIQHMVQEGFSERRGARPQQSDIARVAIILTDGRSQDNV--TGPADSARKLSINTFAIGVTDHVLASELESIAGSPNRWFYVDK-FKDLDTRLRSMIQK-------AACPSPTKQETP 1420          
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Celegans
Match: mua-3 (Transmembrane cell adhesion receptor mua-3 [Source:UniProtKB/Swiss-Prot;Acc:P34576])

HSP 1 Score: 68.5514 bits (166), Expect = 9.445e-12
Identity = 53/207 (25.60%), Postives = 97/207 (46.86%), Query Frame = 1
Query:  160 CIKTAGEVIFILDGSTSVGPDNFNKEK-DFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRST------GKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKE--TDENSMIAISDKKNFYLIKDFDSLPKIVSTIVQKTCTGFHISKCSAPIVKKGP 753
            C K   +++F++DGS S+G   F  E   F  + V    IG + TRV LI Y+   +  F++D+Y +   + + I + ++  G+T  G A+  ++ +  S+ R +        +V I+++DG+    +     A   + LS     IG+       E   IA S  + FY+ K F  L   + +++QK       + C +P  ++ P
Sbjct:  640 CPKQKTDLVFLIDGSGSIGSYVFKNEVLRFVREFVELFEIGRSKTRVGLIQYSDQIRHEFDLDQYGDRDSLLKGISETQYLTGLTRTGAAIQHMVQEGFSERRGARPQQSDIARVAIILTDGRSQDNV--TGPADSARKLSINTFAIGVTDHVLASELESIAGSPNRWFYVDK-FKDLDTRLRSMIQK-------AACPSPTKQETP 836          
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Celegans
Match: F31F7.2 (pep chromosome:WBcel235:V:6272671:6274911:1 gene:WBGene00017965.1 transcript:F31F7.2b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F31F7.2)

HSP 1 Score: 63.929 bits (154), Expect = 1.258e-10
Identity = 28/84 (33.33%), Postives = 55/84 (65.48%), Query Frame = 1
Query:  178 EVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDAL 429
            +++F++D S+S+G +NF+ +K+F  +I+  + I    +R+A+I Y+  P +VF  D+Y + + V R +M+  +T G T++  AL
Sbjct:  254 DLMFLVDTSSSIGINNFDIQKNFICEILKDVDIAPGRSRIAMIQYSQDPSVVFGFDQYYSYESVRRGVMRLSYTGGATMLSKAL 337          
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Zebrafish
Match: col28a2b (collagen, type XXVIII, alpha 2b [Source:ZFIN;Acc:ZDB-GENE-130530-762])

HSP 1 Score: 95.5153 bits (236), Expect = 4.221e-20
Identity = 60/194 (30.93%), Postives = 103/194 (53.09%), Query Frame = 1
Query:  157 KCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMDPI---LVAKQLKALSYMLITIGL--------DKETDENSMIAI-SDKKNFYLIKDFDSLPKIVSTIVQKTC 702
            KC +   E++F++D S S+GP+NF   KDF   +V+RL IG N TRV L+ Y+   QL FN+ +Y   +D+   I +  +    T  G A++    +     R    KV I+I+DG+ +   +P+   +  ++  A +  +  +G+        ++   E S+IA   D ++ Y IKDF++LP + S +V + C
Sbjct:  754 KCKERPMELVFVVDSSESIGPENFEIIKDFVAALVDRLTIGRNATRVGLVLYSLEVQLEFNLARYTTKQDIKEAIRRVHYIGEGTYTGSAIHNATHEAFYSARTGVKKVAIVITDGQTD-KREPVKLEIAVREAHAANIEMYALGIMNISNPTQNEFLQELSLIASHPDSEHMYYIKDFNTLPALESKLVNQLC 946          
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Zebrafish
Match: col28a2a (collagen, type XXVIII, alpha 2a [Source:ZFIN;Acc:ZDB-GENE-030131-4444])

HSP 1 Score: 85.8853 bits (211), Expect = 4.824e-17
Identity = 52/194 (26.80%), Postives = 99/194 (51.03%), Query Frame = 1
Query:  157 KCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMDPI---LVAKQLKALSYMLITIGLDKETDE---------NSMIAISDKKNFYLIKDFDSLPKIVSTIVQKTC 702
            KC +   E++F++D S SVGP+NF   KDF   +V+R+ +G N TR+ L+ Y+    L FN+ +Y   +DV + +    +    T  G A+     +     R    KV I+I+DG+ +   +P+   +  ++ +  +  +  +G+   +D          N + +  D ++ +LI D+++LP + S +V + C
Sbjct:  809 KCKERPMELVFVIDSSESVGPENFEIIKDFVIALVDRVTVGRNATRIGLLLYSLEVHLEFNLARYMTKQDVKKAVRNMPYMGEGTYTGTAIRKATQEAFFSARNGVRKVAIVITDGQTD-KREPVKLDIAVREAQVANIEMYALGIVNTSDPTQAEFLRELNLIASDPDSEHMFLIDDYNTLPALESKLVSQFC 1001          
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Zebrafish
Match: col28a2a (collagen, type XXVIII, alpha 2a [Source:ZFIN;Acc:ZDB-GENE-030131-4444])

HSP 1 Score: 85.5001 bits (210), Expect = 6.132e-17
Identity = 52/194 (26.80%), Postives = 99/194 (51.03%), Query Frame = 1
Query:  157 KCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMDPI---LVAKQLKALSYMLITIGLDKETDE---------NSMIAISDKKNFYLIKDFDSLPKIVSTIVQKTC 702
            KC +   E++F++D S SVGP+NF   KDF   +V+R+ +G N TR+ L+ Y+    L FN+ +Y   +DV + +    +    T  G A+     +     R    KV I+I+DG+ +   +P+   +  ++ +  +  +  +G+   +D          N + +  D ++ +LI D+++LP + S +V + C
Sbjct:  793 KCKERPMELVFVIDSSESVGPENFEIIKDFVIALVDRVTVGRNATRIGLLLYSLEVHLEFNLARYMTKQDVKKAVRNMPYMGEGTYTGTAIRKATQEAFFSARNGVRKVAIVITDGQTD-KREPVKLDIAVREAQVANIEMYALGIVNTSDPTQAEFLRELNLIASDPDSEHMFLIDDYNTLPALESKLVSQFC 985          
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Zebrafish
Match: CR352283.1 (von Willebrand factor A domain containing 2 [Source:NCBI gene;Acc:567428])

HSP 1 Score: 82.8037 bits (203), Expect = 3.432e-16
Identity = 58/213 (27.23%), Postives = 106/213 (49.77%), Query Frame = 1
Query:  148 EDKKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTD---IESKTRRSTGKVIILISDGKRNGGMDPILVAKQLK--ALSYMLITIGLDKETDENSMIAISDKKNFYL-IKDFDSLPKIVSTIVQKTCTGFH--ISKCSA-PIVKKGPCV 759
            +++ C+  A +++F+LD S+ VG +NF   +DF      +  I  ++ +V L+ Y   P  VF++DKYN+   V R +  A F  G   VG AL  VL+    +    R    K +++++DG   G  D  + A++++   +S  LI +G   +  +  ++ IS  ++  + +  +D L      +VQ  C+     ++ CS  P +  G CV
Sbjct:  508 DNQGCLGQALDLVFVLDASSGVGKENFIHFQDFVRSTSVQFDINRDVAQVGLVVYGRRPVTVFDLDKYNSGSAVLRAVGDAAFLGGKASVGSALLHVLSQSLTVGKGARPGVNKAVVVLTDG--TGVEDAAVPAQKIRDSGVSIFLIGVG---DIQQELLLRISGSEDHMITVPSYDDLKYSEDVLVQMVCSDVKKPVNLCSPNPCMNDGICV 715          

HSP 2 Score: 67.781 bits (164), Expect = 1.748e-11
Identity = 55/203 (27.09%), Postives = 101/203 (49.75%), Query Frame = 1
Query:  169 TAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRST-GKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLD-KETDENSMIA--ISDKKNFYLIKDFDSLPKIVSTIVQKTCTGFHISKCSAPIVKKGPCVNK 765
             A +++F++D S SVG   F + + +  ++   L +  +  RV ++ + S P+L  ++D Y   +++ +++ K  +  G T  G AL  VL    S  R S+  +V++L+SDGK  G +   L A +LK    +L  +G+     DE   +A   SD   F+     D++  + +++   T +   +S  S   V+  PCV K
Sbjct:   34 AAMDILFVMDSSYSVGKGGFERSRHYMLKLCEALDVRQDKVRVGVVQFGSTPKLEVSLDSYKTKEELKKKLKKIHYRGGSTQTGLALKFVLRKGFSGGRNSSVPRVVVLLSDGKSQGAVQ--LPASELKLSGVLLFAVGIRYPRWDELRELASGPSDSHVFFAEHFSDAVNGLFTSL---TTSSVCMSIPSGCKVESYPCVQK 231          
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Zebrafish
Match: vwa2 (von Willebrand factor A domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-100302-1])

HSP 1 Score: 82.8037 bits (203), Expect = 3.442e-16
Identity = 58/213 (27.23%), Postives = 106/213 (49.77%), Query Frame = 1
Query:  148 EDKKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTD---IESKTRRSTGKVIILISDGKRNGGMDPILVAKQLK--ALSYMLITIGLDKETDENSMIAISDKKNFYL-IKDFDSLPKIVSTIVQKTCTGFH--ISKCSA-PIVKKGPCV 759
            +++ C+  A +++F+LD S+ VG +NF   +DF      +  I  ++ +V L+ Y   P  VF++DKYN+   V R +  A F  G   VG AL  VL+    +    R    K +++++DG   G  D  + A++++   +S  LI +G   +  +  ++ IS  ++  + +  +D L      +VQ  C+     ++ CS  P +  G CV
Sbjct:  522 DNQGCLGQALDLVFVLDASSGVGKENFIHFQDFVRSTSVQFDINRDVAQVGLVVYGRRPVTVFDLDKYNSGSAVLRAVGDAAFLGGKASVGSALLHVLSQSLTVGKGARPGVNKAVVVLTDG--TGVEDAAVPAQKIRDSGVSIFLIGVG---DIQQELLLRISGSEDHMITVPSYDDLKYSEDVLVQMVCSDVKKPVNLCSPNPCMNDGICV 729          

HSP 2 Score: 67.781 bits (164), Expect = 1.940e-11
Identity = 55/203 (27.09%), Postives = 101/203 (49.75%), Query Frame = 1
Query:  169 TAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRST-GKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLD-KETDENSMIA--ISDKKNFYLIKDFDSLPKIVSTIVQKTCTGFHISKCSAPIVKKGPCVNK 765
             A +++F++D S SVG   F + + +  ++   L +  +  RV ++ + S P+L  ++D Y   +++ +++ K  +  G T  G AL  VL    S  R S+  +V++L+SDGK  G +   L A +LK    +L  +G+     DE   +A   SD   F+     D++  + +++   T +   +S  S   V+  PCV K
Sbjct:   48 AAMDILFVMDSSYSVGKGGFERSRHYMLKLCEALDVRQDKVRVGVVQFGSTPKLEVSLDSYKTKEELKKKLKKIHYRGGSTQTGLALKFVLRKGFSGGRNSSVPRVVVLLSDGKSQGAVQ--LPASELKLSGVLLFAVGIRYPRWDELRELASGPSDSHVFFAEHFSDAVNGLFTSL---TTSSVCMSIPSGCKVESYPCVQK 245          
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Xenopus
Match: VWA2 (von Willebrand factor A domain containing 2 [Source:NCBI gene;Acc:101733495])

HSP 1 Score: 94.7449 bits (234), Expect = 8.430e-20
Identity = 60/226 (26.55%), Postives = 118/226 (52.21%), Query Frame = 1
Query:  124 QILKELTQEDKK--------CIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDAL----NMVLTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAISDKKNFYL-IKDFDSLPKIVSTIVQKTCTGFHISKCSAPIVKKGPCVN 762
            Q+  +L Q  K+        C     ++ F+LD S +VG + FN+ K+F T +  +  I  ++T++ L+TY+S PQ VF +D +++   + + I +A +  G   +G+AL    N V+T ++   R    K +++ISDG+  G  D  + A++L+    M+  IG+      ++++ ++  + F + +  ++SL     ++VQ+ C     +K    + K  PC+N
Sbjct:  471 QLFNQLPQLQKRICSIDVQGCQAQPLDLAFVLDASAAVGQEKFNRLKNFVTMVSLQFDINRDVTQIGLVTYSSRPQTVFGLDTHDSGSGLLQGIGRASYIGGSASIGNALLHVYNEVMT-VQKGARPGVNKAVVVISDGR--GAEDAAVPAQKLRDNGIMVYVIGIG-SILRSALLRLAGTEKFLITVPSYESLGHYEDSVVQRVCED---AKSPVNLCKPNPCMN 689          

HSP 2 Score: 78.1814 bits (191), Expect = 1.570e-14
Identity = 43/137 (31.39%), Postives = 74/137 (54.01%), Query Frame = 1
Query:  178 EVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALN-MVLTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGL 585
            +++ +LDGS S+G  +F + K FA+++ + L IG++L RV  + Y+  PQ+ F++D   +  D+  +I    F  G T  G AL  +V             K++I++SDGK  G +   L A Q+K     + T+G+
Sbjct:   15 DILILLDGSNSIGRGSFERSKHFASKLCDALDIGSDLVRVGAMQYSGTPQVEFHLDSSFSKADIKEKIKSIVFKGGPTETGLALKYIVWKGFPGARPPPVPKILIIVSDGKSQGNIK--LPAAQIKGEDIEVFTVGV 149          
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Xenopus
Match: VWA2 (von Willebrand factor A domain containing 2 [Source:NCBI gene;Acc:101733495])

HSP 1 Score: 94.7449 bits (234), Expect = 8.439e-20
Identity = 60/226 (26.55%), Postives = 118/226 (52.21%), Query Frame = 1
Query:  124 QILKELTQEDKK--------CIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDAL----NMVLTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAISDKKNFYL-IKDFDSLPKIVSTIVQKTCTGFHISKCSAPIVKKGPCVN 762
            Q+  +L Q  K+        C     ++ F+LD S +VG + FN+ K+F T +  +  I  ++T++ L+TY+S PQ VF +D +++   + + I +A +  G   +G+AL    N V+T ++   R    K +++ISDG+  G  D  + A++L+    M+  IG+      ++++ ++  + F + +  ++SL     ++VQ+ C     +K    + K  PC+N
Sbjct:  506 QLFNQLPQLQKRICSIDVQGCQAQPLDLAFVLDASAAVGQEKFNRLKNFVTMVSLQFDINRDVTQIGLVTYSSRPQTVFGLDTHDSGSGLLQGIGRASYIGGSASIGNALLHVYNEVMT-VQKGARPGVNKAVVVISDGR--GAEDAAVPAQKLRDNGIMVYVIGIG-SILRSALLRLAGTEKFLITVPSYESLGHYEDSVVQRVCED---AKSPVNLCKPNPCMN 724          

HSP 2 Score: 77.7962 bits (190), Expect = 1.794e-14
Identity = 43/137 (31.39%), Postives = 74/137 (54.01%), Query Frame = 1
Query:  178 EVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALN-MVLTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGL 585
            +++ +LDGS S+G  +F + K FA+++ + L IG++L RV  + Y+  PQ+ F++D   +  D+  +I    F  G T  G AL  +V             K++I++SDGK  G +   L A Q+K     + T+G+
Sbjct:   50 DILILLDGSNSIGRGSFERSKHFASKLCDALDIGSDLVRVGAMQYSGTPQVEFHLDSSFSKADIKEKIKSIVFKGGPTETGLALKYIVWKGFPGARPPPVPKILIIVSDGKSQGNIK--LPAAQIKGEDIEVFTVGV 184          
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Xenopus
Match: VWA2 (von Willebrand factor A domain containing 2 [Source:NCBI gene;Acc:101733495])

HSP 1 Score: 94.7449 bits (234), Expect = 9.309e-20
Identity = 60/226 (26.55%), Postives = 118/226 (52.21%), Query Frame = 1
Query:  124 QILKELTQEDKK--------CIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDAL----NMVLTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAISDKKNFYL-IKDFDSLPKIVSTIVQKTCTGFHISKCSAPIVKKGPCVN 762
            Q+  +L Q  K+        C     ++ F+LD S +VG + FN+ K+F T +  +  I  ++T++ L+TY+S PQ VF +D +++   + + I +A +  G   +G+AL    N V+T ++   R    K +++ISDG+  G  D  + A++L+    M+  IG+      ++++ ++  + F + +  ++SL     ++VQ+ C     +K    + K  PC+N
Sbjct:  498 QLFNQLPQLQKRICSIDVQGCQAQPLDLAFVLDASAAVGQEKFNRLKNFVTMVSLQFDINRDVTQIGLVTYSSRPQTVFGLDTHDSGSGLLQGIGRASYIGGSASIGNALLHVYNEVMT-VQKGARPGVNKAVVVISDGR--GAEDAAVPAQKLRDNGIMVYVIGIG-SILRSALLRLAGTEKFLITVPSYESLGHYEDSVVQRVCED---AKSPVNLCKPNPCMN 716          

HSP 2 Score: 77.7962 bits (190), Expect = 1.722e-14
Identity = 43/137 (31.39%), Postives = 74/137 (54.01%), Query Frame = 1
Query:  178 EVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALN-MVLTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGL 585
            +++ +LDGS S+G  +F + K FA+++ + L IG++L RV  + Y+  PQ+ F++D   +  D+  +I    F  G T  G AL  +V             K++I++SDGK  G +   L A Q+K     + T+G+
Sbjct:   42 DILILLDGSNSIGRGSFERSKHFASKLCDALDIGSDLVRVGAMQYSGTPQVEFHLDSSFSKADIKEKIKSIVFKGGPTETGLALKYIVWKGFPGARPPPVPKILIIVSDGKSQGNIK--LPAAQIKGEDIEVFTVGV 176          
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Xenopus
Match: VWA2 (von Willebrand factor A domain containing 2 [Source:NCBI gene;Acc:101733495])

HSP 1 Score: 94.3597 bits (233), Expect = 1.061e-19
Identity = 60/226 (26.55%), Postives = 118/226 (52.21%), Query Frame = 1
Query:  124 QILKELTQEDKK--------CIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDAL----NMVLTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAISDKKNFYL-IKDFDSLPKIVSTIVQKTCTGFHISKCSAPIVKKGPCVN 762
            Q+  +L Q  K+        C     ++ F+LD S +VG + FN+ K+F T +  +  I  ++T++ L+TY+S PQ VF +D +++   + + I +A +  G   +G+AL    N V+T ++   R    K +++ISDG+  G  D  + A++L+    M+  IG+      ++++ ++  + F + +  ++SL     ++VQ+ C     +K    + K  PC+N
Sbjct:  514 QLFNQLPQLQKRICSIDVQGCQAQPLDLAFVLDASAAVGQEKFNRLKNFVTMVSLQFDINRDVTQIGLVTYSSRPQTVFGLDTHDSGSGLLQGIGRASYIGGSASIGNALLHVYNEVMT-VQKGARPGVNKAVVVISDGR--GAEDAAVPAQKLRDNGIMVYVIGIG-SILRSALLRLAGTEKFLITVPSYESLGHYEDSVVQRVCED---AKSPVNLCKPNPCMN 732          

HSP 2 Score: 78.1814 bits (191), Expect = 1.698e-14
Identity = 43/137 (31.39%), Postives = 74/137 (54.01%), Query Frame = 1
Query:  178 EVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALN-MVLTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGL 585
            +++ +LDGS S+G  +F + K FA+++ + L IG++L RV  + Y+  PQ+ F++D   +  D+  +I    F  G T  G AL  +V             K++I++SDGK  G +   L A Q+K     + T+G+
Sbjct:   58 DILILLDGSNSIGRGSFERSKHFASKLCDALDIGSDLVRVGAMQYSGTPQVEFHLDSSFSKADIKEKIKSIVFKGGPTETGLALKYIVWKGFPGARPPPVPKILIIVSDGKSQGNIK--LPAAQIKGEDIEVFTVGV 192          
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Xenopus
Match: ENSXETT00000017138.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:5:88440174:88463406:-1 gene:ENSXETG00000008974.1 transcript:ENSXETT00000017138.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.8189 bits (229), Expect = 1.523e-19
Identity = 51/185 (27.57%), Postives = 100/185 (54.05%), Query Frame = 1
Query:  157 KCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAISDKKN---FYLIKDFDSLPKIVSTIVQKTC 702
            +C     +++FILDGS SVGP+NF   K +   I +   IG   T+V ++ Y+  P L   +  Y +S D++R +   ++  G T  G+A+   + ++ +++ R   K+ ++++DGK    +    VA++ +     L  IG+  E +E+ + AI++K +    + ++D+ ++ KI   + QK C
Sbjct:   31 RCRTAPNDLVFILDGSWSVGPENFEILKKWVVNITSNFNIGPKFTQVGVVQYSDYPILEIPLGSYESSDDLSRRMQSIQYLGGNTQTGNAIRFAIDNLFARSLRPLTKIAVVLTDGKSQDEVKH--VAEEARKNKITLFAIGVGSEIEESELRAIANKPSSTYVFYVEDYIAISKIREIMKQKLC 213          
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Mouse
Match: Vit (vitrin [Source:MGI Symbol;Acc:MGI:1921449])

HSP 1 Score: 90.1225 bits (222), Expect = 1.624e-18
Identity = 56/188 (29.79%), Postives = 93/188 (49.47%), Query Frame = 1
Query:  154 KKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMD-PILVAKQLKALSYMLITIGLDKETDENSMIAISDKKNFYLIKDFDSLPKIVSTIVQKTCTGFH 714
            K C+ +A ++ F++DGS+S+G  NF     F   +     I +  TRV  + Y    +L F  DKYN+  D+   I +  +  G T  G A+   L  +  K++ +  KV+I+I+DG+    +  P + A Q   ++Y  I I    + +   M     K + + + DFD+L KI   I+Q  CT F+
Sbjct:  460 KTCLNSA-DIGFVIDGSSSMGTSNFRTVLQFVANLSKEFEISDTDTRVGAVQYTYEQRLEFGFDKYNSKADILSAIRRVGYWSGGTSTGAAIQYALEQLFKKSKPNKRKVMIIITDGRSYDDVRIPAMAAYQKGVITYA-IGIAWAAQDELEVMATHPAKDHSFFVDDFDNLYKIAPRIIQNICTEFN 645          

HSP 2 Score: 63.5438 bits (153), Expect = 4.097e-10
Identity = 53/208 (25.48%), Postives = 91/208 (43.75%), Query Frame = 1
Query:  115 LEFQILKELTQEDKKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKT---RRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMI-------AISDKKNFYL--IKDFDSLPKIVSTIVQKTC 702
            L  Q  + + Q D  C     ++ F++DGSTS+G   F  +K F   +V  L IG     V ++ Y   P   FN+  + NS+D+   I K     G++ VG A++ V     SK    R     V +++ DG     ++ +    +   ++   IT+    E D   ++       A+     FY   ++ + SL K V  +V++ C
Sbjct:  247 LSTQSSEPVPQGDPNCKI---DLSFLIDGSTSIGKRRFRIQKQFLADVVQALDIGPAGPLVGVVQYGDNPATQFNLKTHMNSQDLKTAIEKITQRGGLSNVGRAISFVTKTFFSKANGNRGGAPNVAVVMVDGWPTDKVEEVSRVARESGINVFFITVEGAAERDIQHVVEPGFASKAVCRTNGFYSFNVQSWLSLHKTVQPLVKRVC 451          
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Mouse
Match: Vit (vitrin [Source:MGI Symbol;Acc:MGI:1921449])

HSP 1 Score: 90.1225 bits (222), Expect = 1.648e-18
Identity = 56/188 (29.79%), Postives = 93/188 (49.47%), Query Frame = 1
Query:  154 KKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMD-PILVAKQLKALSYMLITIGLDKETDENSMIAISDKKNFYLIKDFDSLPKIVSTIVQKTCTGFH 714
            K C+ +A ++ F++DGS+S+G  NF     F   +     I +  TRV  + Y    +L F  DKYN+  D+   I +  +  G T  G A+   L  +  K++ +  KV+I+I+DG+    +  P + A Q   ++Y  I I    + +   M     K + + + DFD+L KI   I+Q  CT F+
Sbjct:  438 KTCLNSA-DIGFVIDGSSSMGTSNFRTVLQFVANLSKEFEISDTDTRVGAVQYTYEQRLEFGFDKYNSKADILSAIRRVGYWSGGTSTGAAIQYALEQLFKKSKPNKRKVMIIITDGRSYDDVRIPAMAAYQKGVITYA-IGIAWAAQDELEVMATHPAKDHSFFVDDFDNLYKIAPRIIQNICTEFN 623          

HSP 2 Score: 63.1586 bits (152), Expect = 4.857e-10
Identity = 53/208 (25.48%), Postives = 91/208 (43.75%), Query Frame = 1
Query:  115 LEFQILKELTQEDKKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKT---RRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMI-------AISDKKNFYL--IKDFDSLPKIVSTIVQKTC 702
            L  Q  + + Q D  C     ++ F++DGSTS+G   F  +K F   +V  L IG     V ++ Y   P   FN+  + NS+D+   I K     G++ VG A++ V     SK    R     V +++ DG     ++ +    +   ++   IT+    E D   ++       A+     FY   ++ + SL K V  +V++ C
Sbjct:  225 LSTQSSEPVPQGDPNCKI---DLSFLIDGSTSIGKRRFRIQKQFLADVVQALDIGPAGPLVGVVQYGDNPATQFNLKTHMNSQDLKTAIEKITQRGGLSNVGRAISFVTKTFFSKANGNRGGAPNVAVVMVDGWPTDKVEEVSRVARESGINVFFITVEGAAERDIQHVVEPGFASKAVCRTNGFYSFNVQSWLSLHKTVQPLVKRVC 429          
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Mouse
Match: Col6a4 (collagen, type VI, alpha 4 [Source:MGI Symbol;Acc:MGI:1915803])

HSP 1 Score: 89.7373 bits (221), Expect = 3.864e-18
Identity = 56/205 (27.32%), Postives = 103/205 (50.24%), Query Frame = 1
Query:  118 EFQILKELTQE-------DKKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKT--RRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAISDKKNFYLIKDFDSLPKIVSTIVQKTCT 705
            EF  LK + QE        + C     ++IF++DGS S+ P +F K KDF  ++VN+  IG +  ++ L+ ++S PQ  F +++Y++  D+ R I+  +     T  G ALN  L   +S    R    + +I+I+DG     + P   AK L+  + ++  IG+        +   +D+   +  ++F+SL  +   I+ + C+
Sbjct: 1003 EFDSLKSIHQEVIRDICSSENCKSQKADIIFLIDGSESIAPKDFEKMKDFMERMVNQSNIGADEIQIGLLQFSSNPQEEFRLNRYSSKVDMCRAILSVQQMSDGTHTGKALNFTLPFFDSSRGGRPRVHQYLIVITDGVSQDNVAP--PAKALRDRNIIIFAIGVGNVQRAQLLEITNDQDKVFQEENFESLQSLEKEILSEVCS 1205          

HSP 2 Score: 75.0998 bits (183), Expect = 1.440e-13
Identity = 51/204 (25.00%), Postives = 105/204 (51.47%), Query Frame = 1
Query:  133 KELTQEDKKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQ-LKALSYMLITIGLDKETDENSMIAISDKKNFYLIKDFDSLPKIVSTIVQKTCTGFHISKCSAPIV 741
            ++ TQE  + ++ A ++ F++DGS S+ P++F + KDF  +++    IG +  R  ++ Y+      F + +Y +   ++  I   +   G T  G AL+ ++   ++  R    + +I+I+DG+     DP+  A Q L+ +   +  IG+ ++ +   +  I+ KK F+ I +FDSL  I   +++  C+  +     A I+
Sbjct:  835 RQSTQEGCESVEKA-DIYFLIDGSGSIKPNDFIEMKDFMKEVIKMFHIGPDRVRFGVVQYSDKIISQFFLTQYASMAGLSAAIDNIQQVGGGTTTGKALSKMVPVFQNTARIDVARYLIVITDGQST---DPVAEAAQGLRDIGVNIYAIGV-RDANTTELEEIASKKMFF-IYEFDSLKSIHQEVIRDICSSENCKSQKADII 1032          

HSP 3 Score: 60.8474 bits (146), Expect = 3.517e-9
Identity = 47/195 (24.10%), Postives = 97/195 (49.74%), Query Frame = 1
Query:  145 QEDKKCIKTA-GEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMV----LTDIE-SKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLD-KETDENSMIAISDKKNF-YLIKDFDSLPKIVSTIVQKTCT 705
            +E   C + +  +++F++D STS+G  NF K K F   +V+ L + ++  +V L+ Y+      F + + +    V   I    ++ G T  G AL  +    LT++  S+ +    ++++L++DG+ +  +    VA QLK     +  +G++ ++  E   IA    + F +  ++F  L  +  T++Q  C+
Sbjct:  223 RESPACSEASPADIVFLVDSSTSIGLQNFQKVKHFLHSVVSGLDVRSDQVQVGLVQYSDNIYPAFPLKQSSLKSAVLDRIRNLPYSMGGTSTGSALEFIRANSLTEMSGSRAKDGVPQIVVLVTDGESSDEVQD--VADQLKRDGVFVFVVGINIQDVQELQKIANEPFEEFLFTTENFSILQALSGTLLQALCS 415          
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Mouse
Match: Col14a1 (collagen, type XIV, alpha 1 [Source:MGI Symbol;Acc:MGI:1341272])

HSP 1 Score: 87.8113 bits (216), Expect = 1.297e-17
Identity = 57/203 (28.08%), Postives = 104/203 (51.23%), Query Frame = 1
Query:  160 CIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRL-VIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMV---LTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAISDK---KNFYLIKDFDSLPKIVSTIVQKTCTGFHISKCSAPIVKK 747
            C     +++F++DGS S+G DNFNK  +F    V  L  IG + T+VA++ +   P+  F +D Y   + +   I    +  G T  G A+  V   L   +S TRR   KVI++I+DG+    ++ I  +++++A  + +  IG+  + D + ++ I  K   ++ + + DFD+  KI   ++   C     +  + P+V K
Sbjct: 1024 CKAAKADLVFMVDGSWSIGDDNFNKIINFLYSTVGALDKIGADGTQVAMVQFTDDPRTEFKLDSYKTKETLLDAIRHISYKGGNTKTGKAIKHVRDTLFTSDSGTRRGIPKVIVVITDGRSQDDVNKI--SREMQADGFNIFAIGV-ADADYSELVQIGSKPSSRHVFFVDDFDAFKKIEDELITFVC---ETASATCPMVHK 1220          

HSP 2 Score: 75.0998 bits (183), Expect = 1.545e-13
Identity = 47/183 (25.68%), Postives = 93/183 (50.82%), Query Frame = 1
Query:  175 GEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDI---ESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAIS---DKKNFYLIKDFDSLPKIVSTIVQKTCT 705
             +++ ++DGS S+G  NF   ++F   +V    +G+  TR+ L  Y+  P++ ++++ +N   +V   +    +  G T+ G ALN +  +    E+ +R    K+ ILI+DGK     D I  ++ L+     L  IG+ K  D + +  I+   D  + Y + +FD +  +V ++ +  C+
Sbjct:  158 ADIVILVDGSWSIGRFNFRLVRNFLENLVTAFNVGSEKTRIGLAQYSGDPRIEWHLNAFNTKDEVIDAVRSLPYKGGNTLTGLALNFIFENSFKPEAGSRSGVSKIGILITDGKSQD--DIIPPSRNLRESGVELFAIGV-KNADLSELQEIASEPDSTHVYNVAEFDLMHTVVESLTRTVCS 337          
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Mouse
Match: Col14a1 (collagen, type XIV, alpha 1 [Source:MGI Symbol;Acc:MGI:1341272])

HSP 1 Score: 87.8113 bits (216), Expect = 1.297e-17
Identity = 57/203 (28.08%), Postives = 104/203 (51.23%), Query Frame = 1
Query:  160 CIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRL-VIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMV---LTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAISDK---KNFYLIKDFDSLPKIVSTIVQKTCTGFHISKCSAPIVKK 747
            C     +++F++DGS S+G DNFNK  +F    V  L  IG + T+VA++ +   P+  F +D Y   + +   I    +  G T  G A+  V   L   +S TRR   KVI++I+DG+    ++ I  +++++A  + +  IG+  + D + ++ I  K   ++ + + DFD+  KI   ++   C     +  + P+V K
Sbjct: 1027 CKAAKADLVFMVDGSWSIGDDNFNKIINFLYSTVGALDKIGADGTQVAMVQFTDDPRTEFKLDSYKTKETLLDAIRHISYKGGNTKTGKAIKHVRDTLFTSDSGTRRGIPKVIVVITDGRSQDDVNKI--SREMQADGFNIFAIGV-ADADYSELVQIGSKPSSRHVFFVDDFDAFKKIEDELITFVC---ETASATCPMVHK 1223          

HSP 2 Score: 75.0998 bits (183), Expect = 1.546e-13
Identity = 47/183 (25.68%), Postives = 93/183 (50.82%), Query Frame = 1
Query:  175 GEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDI---ESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAIS---DKKNFYLIKDFDSLPKIVSTIVQKTCT 705
             +++ ++DGS S+G  NF   ++F   +V    +G+  TR+ L  Y+  P++ ++++ +N   +V   +    +  G T+ G ALN +  +    E+ +R    K+ ILI+DGK     D I  ++ L+     L  IG+ K  D + +  I+   D  + Y + +FD +  +V ++ +  C+
Sbjct:  158 ADIVILVDGSWSIGRFNFRLVRNFLENLVTAFNVGSEKTRIGLAQYSGDPRIEWHLNAFNTKDEVIDAVRSLPYKGGNTLTGLALNFIFENSFKPEAGSRSGVSKIGILITDGKSQD--DIIPPSRNLRESGVELFAIGV-KNADLSELQEIASEPDSTHVYNVAEFDLMHTVVESLTRTVCS 337          
BLAST of Collagen alpha-1(XXVIII) chain vs. UniProt/SwissProt
Match: sp|Q6DCQ6|VWA2_XENLA (von Willebrand factor A domain-containing protein 2 OS=Xenopus laevis OX=8355 GN=vwa2 PE=2 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 6.368e-20
Identity = 60/225 (26.67%), Postives = 115/225 (51.11%), Query Frame = 1
Query:  124 QILKELTQEDKK--------CIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTD---IESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAISDKKNFYL-IKDFDSLPKIVSTIVQKTCTGFHISKCSAPIVKKGPCVN 762
            Q+  +L Q  K+        C     ++ F+LD ST+VG + FN+ K+F T +  +  I  ++T++ L+TY+S P+ VF +D +++   + + I +A +  G    G AL  V  D   ++   R    K +++I+DG+  G  D  + A++L+    M+  IG+      NS++ ++  + F + +  ++SL     ++VQ+ C     +K    + K  PC+N
Sbjct:  506 QLFNQLPQLQKRICSIDVQGCQAQPLDLAFVLDASTAVGQEKFNRLKNFVTMVSLQFDINRDVTQIGLVTYSSRPETVFGLDTHDSGSSLLQGIGRASYMGGSASTGSALLRVYNDVMTVQKGARPGVNKAVVVITDGR--GAEDAAVPAQKLRDNGIMVYVIGIGN-IQRNSLLRLAGSEKFLISVPSYESLGHYEDSVVQRVCED---AKSPVNLCKPNPCMN 724          

HSP 2 Score: 75.8702 bits (185), Expect = 4.153e-13
Identity = 43/137 (31.39%), Postives = 73/137 (53.28%), Query Frame = 1
Query:  178 EVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALN-MVLTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGL 585
            +++ +LDGS S+G  +F + K FA+++ + L IG++L RV  + Y+  PQ+ F +D   +   +  +I    F  G T  G AL  +V          S  K++I++SDGK  G +   L A Q+K     + T+G+
Sbjct:   50 DILILLDGSNSIGRGSFERSKHFASKLCDALDIGSDLIRVGAMQYSGAPQVEFRLDSSFSKAAIKEKIKSIVFKGGPTETGLALKYIVWKGFPGGRPASVPKILIIVSDGKSQGNIK--LPAAQIKGEDIEVFTVGV 184          
BLAST of Collagen alpha-1(XXVIII) chain vs. UniProt/SwissProt
Match: sp|Q8VHI5|VITRN_MOUSE (Vitrin OS=Mus musculus OX=10090 GN=Vit PE=1 SV=2)

HSP 1 Score: 90.1225 bits (222), Expect = 1.136e-17
Identity = 56/188 (29.79%), Postives = 93/188 (49.47%), Query Frame = 1
Query:  154 KKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMD-PILVAKQLKALSYMLITIGLDKETDENSMIAISDKKNFYLIKDFDSLPKIVSTIVQKTCTGFH 714
            K C+ +A ++ F++DGS+S+G  NF     F   +     I +  TRV  + Y    +L F  DKYN+  D+   I +  +  G T  G A+   L  +  K++ +  KV+I+I+DG+    +  P + A Q   ++Y  I I    + +   M     K + + + DFD+L KI   I+Q  CT F+
Sbjct:  460 KTCLNSA-DIGFVIDGSSSMGTSNFRTVLQFVANLSKEFEISDTDTRVGAVQYTYEQRLEFGFDKYNSKADILSAIRRVGYWSGGTSTGAAIQYALEQLFKKSKPNKRKVMIIITDGRSYDDVRIPAMAAYQKGVITYA-IGIAWAAQDELEVMATHPAKDHSFFVDDFDNLYKIAPRIIQNICTEFN 645          

HSP 2 Score: 63.5438 bits (153), Expect = 2.866e-9
Identity = 53/208 (25.48%), Postives = 91/208 (43.75%), Query Frame = 1
Query:  115 LEFQILKELTQEDKKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKT---RRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMI-------AISDKKNFYL--IKDFDSLPKIVSTIVQKTC 702
            L  Q  + + Q D  C     ++ F++DGSTS+G   F  +K F   +V  L IG     V ++ Y   P   FN+  + NS+D+   I K     G++ VG A++ V     SK    R     V +++ DG     ++ +    +   ++   IT+    E D   ++       A+     FY   ++ + SL K V  +V++ C
Sbjct:  247 LSTQSSEPVPQGDPNCKI---DLSFLIDGSTSIGKRRFRIQKQFLADVVQALDIGPAGPLVGVVQYGDNPATQFNLKTHMNSQDLKTAIEKITQRGGLSNVGRAISFVTKTFFSKANGNRGGAPNVAVVMVDGWPTDKVEEVSRVARESGINVFFITVEGAAERDIQHVVEPGFASKAVCRTNGFYSFNVQSWLSLHKTVQPLVKRVC 451          
BLAST of Collagen alpha-1(XXVIII) chain vs. UniProt/SwissProt
Match: sp|A2AX52|CO6A4_MOUSE (Collagen alpha-4(VI) chain OS=Mus musculus OX=10090 GN=Col6a4 PE=1 SV=2)

HSP 1 Score: 89.7373 bits (221), Expect = 2.703e-17
Identity = 56/205 (27.32%), Postives = 103/205 (50.24%), Query Frame = 1
Query:  118 EFQILKELTQE-------DKKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKT--RRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAISDKKNFYLIKDFDSLPKIVSTIVQKTCT 705
            EF  LK + QE        + C     ++IF++DGS S+ P +F K KDF  ++VN+  IG +  ++ L+ ++S PQ  F +++Y++  D+ R I+  +     T  G ALN  L   +S    R    + +I+I+DG     + P   AK L+  + ++  IG+        +   +D+   +  ++F+SL  +   I+ + C+
Sbjct: 1003 EFDSLKSIHQEVIRDICSSENCKSQKADIIFLIDGSESIAPKDFEKMKDFMERMVNQSNIGADEIQIGLLQFSSNPQEEFRLNRYSSKVDMCRAILSVQQMSDGTHTGKALNFTLPFFDSSRGGRPRVHQYLIVITDGVSQDNVAP--PAKALRDRNIIIFAIGVGNVQRAQLLEITNDQDKVFQEENFESLQSLEKEILSEVCS 1205          

HSP 2 Score: 75.0998 bits (183), Expect = 1.007e-12
Identity = 51/204 (25.00%), Postives = 105/204 (51.47%), Query Frame = 1
Query:  133 KELTQEDKKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQ-LKALSYMLITIGLDKETDENSMIAISDKKNFYLIKDFDSLPKIVSTIVQKTCTGFHISKCSAPIV 741
            ++ TQE  + ++ A ++ F++DGS S+ P++F + KDF  +++    IG +  R  ++ Y+      F + +Y +   ++  I   +   G T  G AL+ ++   ++  R    + +I+I+DG+     DP+  A Q L+ +   +  IG+ ++ +   +  I+ KK F+ I +FDSL  I   +++  C+  +     A I+
Sbjct:  835 RQSTQEGCESVEKA-DIYFLIDGSGSIKPNDFIEMKDFMKEVIKMFHIGPDRVRFGVVQYSDKIISQFFLTQYASMAGLSAAIDNIQQVGGGTTTGKALSKMVPVFQNTARIDVARYLIVITDGQST---DPVAEAAQGLRDIGVNIYAIGV-RDANTTELEEIASKKMFF-IYEFDSLKSIHQEVIRDICSSENCKSQKADII 1032          

HSP 3 Score: 60.8474 bits (146), Expect = 2.460e-8
Identity = 47/195 (24.10%), Postives = 97/195 (49.74%), Query Frame = 1
Query:  145 QEDKKCIKTA-GEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMV----LTDIE-SKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLD-KETDENSMIAISDKKNF-YLIKDFDSLPKIVSTIVQKTCT 705
            +E   C + +  +++F++D STS+G  NF K K F   +V+ L + ++  +V L+ Y+      F + + +    V   I    ++ G T  G AL  +    LT++  S+ +    ++++L++DG+ +  +    VA QLK     +  +G++ ++  E   IA    + F +  ++F  L  +  T++Q  C+
Sbjct:  223 RESPACSEASPADIVFLVDSSTSIGLQNFQKVKHFLHSVVSGLDVRSDQVQVGLVQYSDNIYPAFPLKQSSLKSAVLDRIRNLPYSMGGTSTGSALEFIRANSLTEMSGSRAKDGVPQIVVLVTDGESSDEVQD--VADQLKRDGVFVFVVGINIQDVQELQKIANEPFEEFLFTTENFSILQALSGTLLQALCS 415          
BLAST of Collagen alpha-1(XXVIII) chain vs. UniProt/SwissProt
Match: sp|Q6UXI7|VITRN_HUMAN (Vitrin OS=Homo sapiens OX=9606 GN=VIT PE=2 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 6.022e-17
Identity = 51/187 (27.27%), Postives = 93/187 (49.73%), Query Frame = 1
Query:  154 KKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAISDKKNFYLIKDFDSLPKIVSTIVQKTCTGFH 714
            K C+ +A ++ F++DGS+SVG  NF     F T +     I +  TR+  + Y    +L F  DKY++  D+   I +  +  G T  G A+N  L  +  K++ +  K++ILI+DG+    +    +A  LK +    I +    + +   +     + + + + +FD+L + V  I+Q  CT F+
Sbjct:  488 KTCLNSA-DIGFVIDGSSSVGTGNFRTVLQFVTNLTKEFEISDTDTRIGAVQYTYEQRLEFGFDKYSSKPDILNAIKRVGYWSGGTSTGAAINFALEQLFKKSKPNKRKLMILITDGRSYDDVRIPAMAAHLKGVITYAIGVAWAAQEELEVIATHPARDHSFFVDEFDNLHQYVPRIIQNICTEFN 673          

HSP 2 Score: 57.3806 bits (137), Expect = 2.595e-7
Identity = 48/208 (23.08%), Postives = 91/208 (43.75%), Query Frame = 1
Query:  115 LEFQILKELTQEDKKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKT---RRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMI-------AISDKKNFY--LIKDFDSLPKIVSTIVQKTC 702
            L  Q L+ ++  D  C     ++ F++DGSTS+G   F  +K     +   L IG     + ++ Y   P   FN+  + NS+D+   I K     G++ VG A++ V  +  SK    R     V++++ DG     ++      +   ++   ITI    E ++  ++       A+     FY   ++ +  L K +  +V++ C
Sbjct:  275 LSTQSLEPVSLGDPNC---KIDLSFLIDGSTSIGKRRFRIQKQLLADVAQALDIGPAGPLMGVVQYGDNPATHFNLKTHTNSRDLKTAIEKITQRGGLSNVGRAISFVTKNFFSKANGNRSGAPNVVVVMVDGWPTDKVEEASRLARESGINIFFITIEGAAENEKQYVVEPNFANKAVCRTNGFYSLHVQSWFGLHKTLQPLVKRVC 479          
BLAST of Collagen alpha-1(XXVIII) chain vs. UniProt/SwissProt
Match: sp|Q80X19|COEA1_MOUSE (Collagen alpha-1(XIV) chain OS=Mus musculus OX=10090 GN=Col14a1 PE=1 SV=2)

HSP 1 Score: 87.8113 bits (216), Expect = 9.073e-17
Identity = 57/203 (28.08%), Postives = 104/203 (51.23%), Query Frame = 1
Query:  160 CIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRL-VIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMV---LTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAISDK---KNFYLIKDFDSLPKIVSTIVQKTCTGFHISKCSAPIVKK 747
            C     +++F++DGS S+G DNFNK  +F    V  L  IG + T+VA++ +   P+  F +D Y   + +   I    +  G T  G A+  V   L   +S TRR   KVI++I+DG+    ++ I  +++++A  + +  IG+  + D + ++ I  K   ++ + + DFD+  KI   ++   C     +  + P+V K
Sbjct: 1027 CKAAKADLVFMVDGSWSIGDDNFNKIINFLYSTVGALDKIGADGTQVAMVQFTDDPRTEFKLDSYKTKETLLDAIRHISYKGGNTKTGKAIKHVRDTLFTSDSGTRRGIPKVIVVITDGRSQDDVNKI--SREMQADGFNIFAIGV-ADADYSELVQIGSKPSSRHVFFVDDFDAFKKIEDELITFVC---ETASATCPMVHK 1223          

HSP 2 Score: 75.0998 bits (183), Expect = 1.081e-12
Identity = 47/183 (25.68%), Postives = 93/183 (50.82%), Query Frame = 1
Query:  175 GEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDI---ESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAIS---DKKNFYLIKDFDSLPKIVSTIVQKTCT 705
             +++ ++DGS S+G  NF   ++F   +V    +G+  TR+ L  Y+  P++ ++++ +N   +V   +    +  G T+ G ALN +  +    E+ +R    K+ ILI+DGK     D I  ++ L+     L  IG+ K  D + +  I+   D  + Y + +FD +  +V ++ +  C+
Sbjct:  158 ADIVILVDGSWSIGRFNFRLVRNFLENLVTAFNVGSEKTRIGLAQYSGDPRIEWHLNAFNTKDEVIDAVRSLPYKGGNTLTGLALNFIFENSFKPEAGSRSGVSKIGILITDGKSQD--DIIPPSRNLRESGVELFAIGV-KNADLSELQEIASEPDSTHVYNVAEFDLMHTVVESLTRTVCS 337          
BLAST of Collagen alpha-1(XXVIII) chain vs. TrEMBL
Match: A0A267H7R9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000187g2 PE=4 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 1.486e-28
Identity = 125/531 (23.54%), Postives = 229/531 (43.13%), Query Frame = 1
Query:  151 DKKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGL-------DKETDENSMIAISDKKNFYLIKDFDSLPKIVSTIVQKTCTGFHISKCSAPIVK--KGPCVNKEQINV--------------------------ITTFYYYNG-KCVSENRKLT--VKCLGPKDCPDPYYQKTSCGSANYSFILFHNF--SRVN------DLCRTETVNLKKYSCGCSKPEESVLKVVYGKECENGYKKRMLLYYEFSQFK-CSETYLNLEPVKCDTLCNGTTLVTSPCVNGKRNN----------TIYTKVFTNNKCSLKIVKTTES------FCDTICPKSLIIESKECVNNIKDVFHITFQNVNGKCIKQTKKIKSNNCTKIQECPQPKFISSDCVEGKKILMKLSYRLVGG-KCQEINERIGNENC 1551
             + C K A +++F+LD STS+   +F KE  F   IV R+ +     RVA++TY++ P+LVFN+DKY     V   + K    EGIT+   A+++V +DI  K R     ++++I+DGK   G DP+  AK LK      +++G+         + +   +  IS K  F+   +F+ L  IVS++V++ CT    SK  +   +  K  CV K +I+                               Y +NG KCV ++RK+   ++C  P+ CP     +  C       +  H F  SRV         C    +   K S    K  +      +  +C    + R+++  ++++ K   + +   +   C   C  T ++  PC  GK ++          T+        KC+ K V+   S         T C    +++  +  +  K +  + ++ + G+C+   +  K       + CP+ +  +S+C +G K  +      +G   C + + ++ +++C
Sbjct:  930 SRTCSKVA-DLVFVLDSSTSIHDADFAKESRFVQHIVRRMGVSPTGVRVAVVTYSTRPKLVFNLDKYKTKSQVLAAMSKLPRDEGITMTYAAIDLVNSDIYPKRRAGVPFIVVVITDGKSTMG-DPVASAKVLKKKGARFVSVGIYNPDPSVTDKINPAELKGISSKGRFWRAGNFNKLDSIVSSVVREVCTDMGKSKSKSGGKRVCKIICVKKRKISAKKICRKDCSSRTLIRHCKKHRAYRVFTRVTYRWNGKKCVPKSRKVIKKIRC-PPRTCPKAKIIRKECKPGRAKSVTTHIFYTSRVKCTMSLPPRCTQHCIKKVKRSAVPCKKIKCKKDKDHVTKCGGSRRYRVVVTIKYTEVKGICKKHKTTKRYPCPIKCPKTQVIRKPCSKGKSHSLFEVKSIISYTVRRSCVHKGKCTAKCVRHMVSKKKPCPPVPTPCKVKAVLKRCKKHSAYKYLIEVYYKRIRGRCVPLKRITKKRIPCPPRRCPKSRTTTSNCTKGAKHKVTTKVFYIGKIICHKRSPKVCHQHC 1457          

HSP 2 Score: 89.3521 bits (220), Expect = 1.002e-14
Identity = 44/119 (36.97%), Postives = 71/119 (59.66%), Query Frame = 1
Query:  151 DKKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGK 507
             + C K A +++F+LD STS+   +F KE  F   IV R+ +     RVA++TY++ P+LVFN+DKY     V   + K    EGIT+   A+++V +DI  K R     ++++I+DG+
Sbjct: 2252 SRTCSKVA-DLVFVLDSSTSIHDADFAKESRFVQHIVRRMGVSPTGVRVAVVTYSTRPKLVFNLDKYKTKSQVLAAMSKLPRDEGITMTYAAIDLVNSDIYPKRRAGVPFIVVVITDGR 2369          
BLAST of Collagen alpha-1(XXVIII) chain vs. TrEMBL
Match: A0A267FE72 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015594g1 PE=4 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 9.029e-27
Identity = 124/505 (24.55%), Postives = 218/505 (43.17%), Query Frame = 1
Query:  151 DKKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGL-------DKETDENSMIAISDKKNFYLIKDFDSLPKIVSTIVQKTCTGFHISKCSAPIVK--KGPCVNKEQIN-------------------------VITTF-YYYNG-KCVSENRKLT--VKCLGPKDCPDPYYQKTSCGSANYSFILFHNF--SRVN------DLCRTETVNLKKYSCGCSKPEESVLKVVYGKECENGYKKRMLLYYEFSQFK-CSETYLNLEPVKCDTLCNGTTLVTSPCVNGKRNN----------TIYTKVFTNNKCSLKIVK---TTESFCDTICPKSLIIESK----ECVNNIKDVFHIT--FQNVNGKCIKQTKKIKSNNCTKIQECPQPKFISSDCVEG 1467
             + C K A +++F+LD STS+   +F KE  F   IV R+ +     RVA++TY++ P+LVFN+DKY     V   + K    EGIT+   A+++V +DI  K R     ++++I+DGK   G DP+  AK LK      +++G+         + +   +  IS K  F+   +F+ L  IVS++V++ CT    SK  +   +  K  CV K +I+                         V T   Y +NG KCV ++RK+   ++C  P+ CP     +  C       +  H F  SRV         C    +   K S    K  +      +  +C    + R+++  ++++ K   + +   +   C   C  T ++  PC  GK ++          T+        KC++K V+    +   C T  P     +      +C  +    + I   ++NV G C+   ++  +      ++CP+ +   + C +G
Sbjct:  647 SRTCSKVA-DLVFVLDSSTSIHDADFAKESRFVQHIVRRMGVSPTGVRVAVVTYSTRPKLVFNLDKYKTKSQVLAAMSKLPRDEGITMTYAAIDLVNSDIYPKRRAGVPFIVVVITDGKSTMG-DPVASAKVLKKKGARFVSVGIYNPDPSVTDKINPAELKGISSKGRFWRAGNFNKLDSIVSSVVREVCTDMGKSKSKSGGKRVCKIICVKKRKISAKKICRKDCSSRTLIRHCKKHRAYRVFTRVTYRWNGKKCVPKSRKVIKKIRC-PPRTCPKAKIIRKECKPGRAKSVTTHIFYTSRVKCTMSLPPRCTQHCIKKVKRSAVPCKKIKCKKDKDHVTKCGGSRRYRVVVTIKYTEVKGICKKHKTTKRYPCPIKCPKTQVIRKPCSKGKSHSLFEVKSIISYTVRRSCVHKGKCTVKCVRRVLRSRKRCKTRPPDRRCKQPPPFWTKCRKHSAYKYQIKALYRNVRGTCVIYKRETIARLLCPPRKCPKTRVTKTKCTKG 1148          
BLAST of Collagen alpha-1(XXVIII) chain vs. TrEMBL
Match: A0A1I8JHM6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 8.479e-26
Identity = 122/510 (23.92%), Postives = 212/510 (41.57%), Query Frame = 1
Query:  151 DKKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGL-------DKETDENSMIAISDKKNFYLIKDFDSLPKIVSTIVQKTCTGFHISKCSAPIVK--KGPCVNKEQINV--------------------------ITTFYYYNG-KCVSENRKLT--VKCLGPKDCPDPYYQKTSCGSANYSFILFHNF------------SRVNDLC----RTETVNLKKYSCGCSKPEESVLKVVYGKECENGYKKRMLLYYEFSQFK-CSETYLNLEPVKCDTLCNGTTLVTSPCVNGKR-------NNTIYTKVFTNNKCSLKIVK---TTESFCDTICPKSLIIESK----ECVNNIKDVFHIT--FQNVNGKCIKQTKKIKSNNCTKIQECPQPKFISSDCVEG 1467
             + C K A +++F+LD STS+   +F KE  F   IV R+ +     RVA++TY++ P+LVFN+DKY     V   + K    EGIT+   A+++V +DI  K R     ++++I+DGK   G DP+  AK LK      +++G+         + +   +  IS K  F+   +F+ L  IVS++V++ CT    SK  +   +  K  CV K +I+                               Y +NG KCV ++RK+   ++C  P+ CP     +  C       +  H F             R    C    +   V  KK  C   K   +        +C    + R+++  ++ Q K   +     +   C   C  T  +  PC  G++       + T+        KC++K V+    +   C T  P     +      +C  +    + I   ++NV G C+   ++  +      ++CP+ +   + C +G
Sbjct:  971 SRTCSKVA-DLVFVLDSSTSIHDADFAKESRFVQHIVRRMGVSPTGVRVAVVTYSTRPKLVFNLDKYKTKSQVLAAMSKLPRDEGITMTYAAIDLVNSDIYPKRRAGVPFIVVVITDGKSTMG-DPVASAKVLKKKGARFVSVGIYNPDPSVTDKINPAELKGISSKGRFWRAGNFNKLDSIVSSVVREVCTDMGKSKSKSGGKRVCKIICVKKRKISAKKICRKDCSSRTLIRHCKKHRAYRVFTRVTYRWNGKKCVPKSRKVIKKIRC-PPRTCPKAKIIRKECKPGRAKSVTTHIFYTSRVKCTMSLPPRCTQHCIKKVKRSAVPCKKIKCKGDKDHVT--------KCGGSRRYRVVVTIKYIQVKGVCKRRKTTKRYPCPVKCPKTQTIIRPCKKGRKFSVKSIISYTVRRACVHKGKCTVKCVRRVLRSRKRCKTRPPDRRCKQPPPFWTKCRKHSAYKYQIKALYRNVRGTCVIYKRETIARLLCPPRKCPKTRVTKTKCTKG 1469          

HSP 2 Score: 120.553 bits (301), Expect = 1.162e-24
Identity = 90/305 (29.51%), Postives = 144/305 (47.21%), Query Frame = 1
Query:  151 DKKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGL-------DKETDENSMIAISDKKNFYLIKDFDSLPKIVSTIVQKTCTGFHISKCSAPIVK--KGPCVNKEQINV--------------------------ITTFYYYNG-KCVSENRKLT--VKCLGPKDCPDPYYQKTSCGSANYSFILFHNF--SRVN 945
             + C K A +++F+LD STS+   +F KE  F   IV R+ +     RVA++TY++ P+LVFN+DKY     V   + K    EGIT+   A+++V +DI  K R     ++++I+DGK   G DP+  AK LK      +++G+         + +   +  IS K  F+   +F+ L  IVS++V++ CT    SK  +   +  K  CV K +I+                               Y +NG KCV ++RK+   ++C  P+ CP     +  C       +  H F  SRV 
Sbjct: 2293 SRTCSKVA-DLVFVLDSSTSIHDADFAKESRFVQHIVRRMGVSPTGVRVAVVTYSTRPKLVFNLDKYKTKSQVLAAMSKLPRDEGITMTYAAIDLVNSDIYPKRRAGVPFIVVVITDGKSTMG-DPVASAKVLKKKGARFVSVGIYNPDPSVTDKINPAELKGISSKGRFWRAGNFNKLDSIVSSVVREVCTDMGKSKSKSGGKRVCKIICVKKRKISAKKICRKDCSSRTLIRHCKKHRAYRVFTRVTYRWNGKKCVPKSRKVIKKIRC-PPRTCPKAKIIRKECKPGRAKSVTTHIFYTSRVK 2594          
BLAST of Collagen alpha-1(XXVIII) chain vs. TrEMBL
Match: A0A1I8JI62 (VWFA domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 1.024e-25
Identity = 119/502 (23.71%), Postives = 208/502 (41.43%), Query Frame = 1
Query:  175 GEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGL-------DKETDENSMIAISDKKNFYLIKDFDSLPKIVSTIVQKTCTGFHISKCSAPIVK--KGPCVNKEQINV--------------------------ITTFYYYNG-KCVSENRKL--TVKCLGPKDCPDPYYQKTSCGSANYSFILFHNF------------SRVNDLC----RTETVNLKKYSCGCSKPEESVLKVVYGKECENGYKKRMLLYYEFSQFK-CSETYLNLEPVKCDTLCNGTTLVTSPCVNGKR-------NNTIYTKVFTNNKCSLKIVK---TTESFCDTICPKSLIIESK----ECVNNIKDVFHIT--FQNVNGKCIKQTKKIKSNNCTKIQECPQPKFISSDCVEG 1467
             +++F+LD STS+   +F KE  F   IV R+ +     RVA++TY++ P+LVFN+DKY     V   + K    EGIT+   A+++V +DI  K R     ++++I+DGK   G DP+  AK LK      +++G+         + +   +  IS K  F+   +F+ L  IVS++V++ CT    SK  +   +  K  CV K +I+                               Y +NG KCV ++RK+   ++C  P+ CP     +  C       +  H F             R    C    +   V  KK  C   K   +        +C    + R+++  ++ Q K   +     +   C   C  T  +  PC  G++       + T+        KC++K V+    +   C T  P     +      +C  +    + I   ++NV G C+   ++  +      ++CP+ +   + C +G
Sbjct:  276 ADLVFVLDSSTSIHDADFAKESRFVQHIVRRMGVSPTGVRVAVVTYSTRPKLVFNLDKYKTKSQVLAAMSKLPRDEGITMTYAAIDLVNSDIYPKRRAGVPFIVVVITDGKSTMG-DPVASAKVLKKKGARFVSVGIYNPDPSVTDKINPAELKGISSKGRFWRAGNFNKLDSIVSSVVREVCTDMGKSKSKSGGKRVCKIICVKKRKISAKKICRKDCSSRTLIRHCKKHRAYRVFTRVTYRWNGKKCVPKSRKVIKKIRC-PPRTCPKAKIIRKECKPGRAKSVTTHIFYTSRVKCTMSLPPRCTQHCIKKVKRSAVPCKKIKCKGDKDHVT--------KCGGSRRYRVVVTIKYIQVKGVCKRRKTTKRYPCPVKCPKTQTIIRPCKKGRKFSVKSIISYTVRRACVHKGKCTVKCVRRVLRSRKRCKTRPPDRRCKQPPPFWTKCRKHSAYKYQIKALYRNVRGTCVIYKRETIARLLCPPRKCPKTRVTKTKCTKG 767          
BLAST of Collagen alpha-1(XXVIII) chain vs. TrEMBL
Match: A0A1I8JH98 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 1.135e-25
Identity = 122/510 (23.92%), Postives = 212/510 (41.57%), Query Frame = 1
Query:  151 DKKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGL-------DKETDENSMIAISDKKNFYLIKDFDSLPKIVSTIVQKTCTGFHISKCSAPIVK--KGPCVNKEQINV--------------------------ITTFYYYNG-KCVSENRKLT--VKCLGPKDCPDPYYQKTSCGSANYSFILFHNF------------SRVNDLC----RTETVNLKKYSCGCSKPEESVLKVVYGKECENGYKKRMLLYYEFSQFK-CSETYLNLEPVKCDTLCNGTTLVTSPCVNGKR-------NNTIYTKVFTNNKCSLKIVK---TTESFCDTICPKSLIIESK----ECVNNIKDVFHIT--FQNVNGKCIKQTKKIKSNNCTKIQECPQPKFISSDCVEG 1467
             + C K A +++F+LD STS+   +F KE  F   IV R+ +     RVA++TY++ P+LVFN+DKY     V   + K    EGIT+   A+++V +DI  K R     ++++I+DGK   G DP+  AK LK      +++G+         + +   +  IS K  F+   +F+ L  IVS++V++ CT    SK  +   +  K  CV K +I+                               Y +NG KCV ++RK+   ++C  P+ CP     +  C       +  H F             R    C    +   V  KK  C   K   +        +C    + R+++  ++ Q K   +     +   C   C  T  +  PC  G++       + T+        KC++K V+    +   C T  P     +      +C  +    + I   ++NV G C+   ++  +      ++CP+ +   + C +G
Sbjct:  971 SRTCSKVA-DLVFVLDSSTSIHDADFAKESRFVQHIVRRMGVSPTGVRVAVVTYSTRPKLVFNLDKYKTKSQVLAAMSKLPRDEGITMTYAAIDLVNSDIYPKRRAGVPFIVVVITDGKSTMG-DPVASAKVLKKKGARFVSVGIYNPDPSVTDKINPAELKGISSKGRFWRAGNFNKLDSIVSSVVREVCTDMGKSKSKSGGKRVCKIICVKKRKISAKKICRKDCSSRTLIRHCKKHRAYRVFTRVTYRWNGKKCVPKSRKVIKKIRC-PPRTCPKAKIIRKECKPGRAKSVTTHIFYTSRVKCTMSLPPRCTQHCIKKVKRSAVPCKKIKCKGDKDHVT--------KCGGSRRYRVVVTIKYIQVKGVCKRRKTTKRYPCPVKCPKTQTIIRPCKKGRKFSVKSIISYTVRRACVHKGKCTVKCVRRVLRSRKRCKTRPPDRRCKQPPPFWTKCRKHSAYKYQIKALYRNVRGTCVIYKRETIARLLCPPRKCPKTRVTKTKCTKG 1469          
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Cavefish
Match: col28a2a (collagen alpha-1(XXVIII) chain-like [Source:NCBI gene;Acc:103029985])

HSP 1 Score: 98.9821 bits (245), Expect = 3.273e-21
Identity = 60/194 (30.93%), Postives = 101/194 (52.06%), Query Frame = 1
Query:  157 KCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMDPI---LVAKQLKALSYMLITIGLDKETDE---------NSMIAISDKKNFYLIKDFDSLPKIVSTIVQKTC 702
            KC +   E++F++D S SVGP+NF   KDF T +V+R+ +G N TR+ L+ Y+    L FN+ +Y   +DV + I K  +    T  G A+     D     R    KV I+++DG+ +   +P+   +  ++  A +  +  IG+   TD          N + +  D ++ YLI DF++LP + S +V + C
Sbjct:  805 KCKERPMELVFVIDSSESVGPENFEIIKDFVTALVDRVTVGRNATRIGLVLYSLDVHLEFNLARYMTKQDVKQAIRKMPYMGEGTYTGTAIRKATQDAFYSARSGVRKVAIVLTDGQAD-KREPVKLDIAVREAHAANIEMYAIGIVNTTDPTQAEFLRELNLIASDPDTEHMYLIDDFNTLPALESKLVSQFC 997          
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Cavefish
Match: col28a2b (collagen, type XXVIII, alpha 2b [Source:ZFIN;Acc:ZDB-GENE-130530-762])

HSP 1 Score: 95.9005 bits (237), Expect = 2.964e-20
Identity = 58/194 (29.90%), Postives = 104/194 (53.61%), Query Frame = 1
Query:  157 KCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMDPI---LVAKQLKALSYMLITIGLDKETDE---------NSMIAISDKKNFYLIKDFDSLPKIVSTIVQKTC 702
            KC +   E++F++D S SVGP+NF   KDF T +V+R+ +G N TR+ L+ Y+   ++ FN+ +Y N +DV + + K  +    T  G A+     +     R    KV+I+I+DG+ +   DP+   +  ++  A +  +  +G+   +D          N + +  D ++ YLI DF++LP + S +V + C
Sbjct:  704 KCKERPMELVFVIDSSESVGPENFEIIKDFVTALVDRVTVGRNATRIGLVLYSLEARVEFNLARYTNKQDVKQAVRKMSYMGEGTYTGTAIRKATQEAFYSARSGVSKVVIVITDGQTD-KRDPVVLEIAVREAHAANIEMYALGIVNTSDPTQAEFLKELNLIASQPDSEHTYLIDDFNTLP-LESKLVSQFC 895          
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Cavefish
Match: col12a1b (collagen, type XII, alpha 1b [Source:ZFIN;Acc:ZDB-GENE-120215-116])

HSP 1 Score: 85.1149 bits (209), Expect = 8.261e-17
Identity = 55/192 (28.65%), Postives = 102/192 (53.12%), Query Frame = 1
Query:  157 KCIKTA-GEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESK---TRRSTGKVIILISDGKRNGGMDPIL-VAKQLKALSYMLITIGLDKETDEN---SMIAISDKKNFYLIKDFDSLPKIVSTIVQKTCTG 708
            KC  +A  +++F++DGS SVG +NF   + F + +     IG + +RV ++ Y+S  +  F + +Y    ++ R I    +  G T+ GDAL+ +  +I ++   TR+   KV+++I+DGK     DP+   AK+L+     + T+G+ KE DE     M +     + Y + +FD +  +  ++  + C G
Sbjct:  112 KCSTSAMADLVFLVDGSWSVGRENFKHIRSFISAVTGAFDIGEDKSRVGVVQYSSDTRTEFTLSQYLRRAELLRAISSLPYKGGDTMTGDALDYLHKNIFTETAGTRKGYPKVLVVITDGKSE---DPVENYAKKLRDSGVEIFTLGI-KEADEEELRQMASTPYNTHVYTVPNFDLIKNVQKSLTTQVCAG 299          

HSP 2 Score: 73.9442 bits (180), Expect = 3.074e-13
Identity = 49/187 (26.20%), Postives = 93/187 (49.73%), Query Frame = 1
Query:  163 IKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDI---ESKTRRSTGKVIILISDGKRNGGM-DPILVAKQLKALSYMLITIGLDKETDENSMIAISD---KKNFYLIKDFDSLPKIVSTIVQKTC 702
            +    +V+ ++DGS S+G  NF K ++F   +VN   IG N  +++L+ Y+  P   F ++ +++   V + +    +  G T  G A+  V   I       R +  +V ILI+DGK +    DP   A +L+     +  +G+ K+   + + AI++   + + Y ++DFD+  +I   + Q  C
Sbjct:  415 VDVQADVVLLVDGSYSIGLANFAKVREFLEVLVNSFDIGPNKVQISLVQYSRDPHTEFYLNTHHDHSAVVKAVRTFPYRGGSTNTGKAMTYVREKIFISNRGARTNVPRVTILITDGKSSDAFKDP---ATKLRNSDVEIFAVGV-KDAVRSELEAIANPPAETHVYTVEDFDAFQRISKELTQSIC 597          

HSP 3 Score: 62.3882 bits (150), Expect = 9.780e-10
Identity = 46/182 (25.27%), Postives = 90/182 (49.45%), Query Frame = 1
Query:  175 GEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTD---IESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAIS---DKKNFYLIKDFDSLPKIVSTIVQKTC 702
             ++I ++DGS S+G  NF   + F  ++V    IG +  ++ L  Y+  P+  ++++ +   + +   +    +  G T+ G AL+ +L +        R  + K+ +LI+DGK    +  IL ++ L++    L  +G+ K  DEN + +I+   D+ + Y + DF  L  IV  +    C
Sbjct: 1177 ADIILLVDGSWSIGRVNFKTIRSFIARMVGVFDIGPDKVQIGLAQYSGDPKTEWHLNAHPTRESLLAAVANLPYKGGNTMTGLALSYILQNNFKPNVGLRPDSRKIGVLITDGKSQDEI--ILSSQSLRSEGIELYAVGV-KNADENELRSIASDPDEIHMYNVNDFSFLLDIVDDLTVNLC 1355          

HSP 4 Score: 61.6178 bits (148), Expect = 1.623e-9
Identity = 47/201 (23.38%), Postives = 93/201 (46.27%), Query Frame = 1
Query:  160 CIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRL-VIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDI---ESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAISDK---KNFYLIKDFDSLPKIVSTIVQKTCTGFHISKCSAPIV 741
            C     +V+F++DGS S+G D+F+K   F   I+    VIG +  +V+ + Y+   +  + ++ YN+            +  G T  G AL  V   +   ++  RR+  KV++ ++DG+    +     A +L+   Y +  +G+  + D   +  I  K   ++ +++ DFD+   I   +V   C     +  S P++
Sbjct: 2272 CKGAKADVVFLIDGSWSIGEDSFHKVLKFVFSIMGAFDVIGPSGMQVSFVQYSDDAKTEYKLNTYNDKGTALAATQLINYKGGNTKTGIALKHVHEKVFASDNGMRRNVPKVVVAVTDGRSQDEVKK--NAAKLQHAGYSVFVVGV-ADVDYAELQDIGSKPSERHIFVVDDFDAFATIQENLVTFIC---ETASSSCPLI 2466          
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Cavefish
Match: col12a1a (collagen, type XII, alpha 1a [Source:ZFIN;Acc:ZDB-GENE-090728-1])

HSP 1 Score: 82.0333 bits (201), Expect = 7.697e-16
Identity = 49/184 (26.63%), Postives = 101/184 (54.89%), Query Frame = 1
Query:  175 GEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESK---TRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAISD---KKNFYLIKDFDSLPKIVSTIVQKTCTG 708
             +++F++DGS SVG +NF   + F   +     IG + TRVA++ Y++  +  FN++++    D+ R I    +  G T+ G+A+  ++ +  ++    R+S  KV ++I+DGK    +D    A++L+ +   +  +G+ K  DE  +  I+     K+ Y + DFD + ++   ++++ C+G
Sbjct:  118 ADLVFLVDGSWSVGRENFKFIRSFIGAMAGAFDIGEDKTRVAVVQYSTDTRTEFNLNQHFRRADLLRAIKNLPYKGGNTMTGEAMEYLVKNTFTEAAGARKSFPKVAMIITDGKSQDPVDE--YARRLRNIGAEIFVLGI-KGADEEELREIASTPHNKHIYSVSDFDLIKEVQQRLIREVCSG 298          

HSP 2 Score: 68.5514 bits (166), Expect = 1.175e-11
Identity = 48/187 (25.67%), Postives = 91/187 (48.66%), Query Frame = 1
Query:  163 IKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDI---ESKTRRSTGKVIILISDGKRNGGM-DPILVAKQLKALSYMLITIGLDKETDENSMIAISD---KKNFYLIKDFDSLPKIVSTIVQKTC 702
            +    +V+ ++DGS S+G  NF K + F   +VN   I  N  +++L+ Y+  P   F ++K+++   V + I    +  G T  G A+  V   I       R +  +V++LI+DGK +    DP   A  L+     +  +G+ K+   + + AI++     + + ++DFD+  +I   + Q  C
Sbjct:  414 VDVQADVVLLVDGSYSIGLANFAKVRSFLEVLVNSFDIAPNKVQLSLVQYSRDPHTEFALNKHHDIAAVVKAIRTFPYRGGSTNTGKAMTYVREKIFINSRGARDNVPRVMVLITDGKSSDSFKDP---AANLRNSDVEIFAVGV-KDAVRSELEAIANPPADNHVFEVEDFDAFARISKELTQSIC 596          

HSP 3 Score: 65.0846 bits (157), Expect = 1.474e-10
Identity = 50/191 (26.18%), Postives = 92/191 (48.17%), Query Frame = 1
Query:  151 DKKCIKTA-GEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTD---IESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAIS---DKKNFYLIKDFDSLPKIVSTIVQKTC 702
            D  C  TA  +++ ++DGS S+G  NF   + F  ++V    IG +  ++ L  Y+  P+  ++++ +     +   +    +  G T+ G ALN +L +        R ++ K+ +L++DGK     D I  ++ L+     L  IG+ K  DEN + +I+   D+ + Y + DF  L  IV  +    C
Sbjct: 1168 DVVCKTTAQADIVLLVDGSWSIGRLNFKTIRAFIARMVGVFDIGPDRVQIGLAQYSGDPKTEWHLNAHRTRDSLLEAVANLPYKGGNTLTGLALNYILQNNFKANVGMRPNSRKIGVLVTDGKSQD--DIIANSQNLRDQGIELYAIGV-KNADENELRSIASDPDEIHMYNVADFSFLLDIVDDLTDNLC 1355          

HSP 4 Score: 56.9954 bits (136), Expect = 4.311e-8
Identity = 41/188 (21.81%), Postives = 90/188 (47.87%), Query Frame = 1
Query:  160 CIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRL-VIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDI---ESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAISDK---KNFYLIKDFDSLPKIVSTIVQKTC 702
            C     +++F++DGS S+G ++F+K   F   ++    V+ +   +V+ + Y+   +  F ++ Y++       +    +  G T  G AL  V   +   +S  RR+  KV+++++DG+     D    A +L+   Y +  +G+  + D   +  I  K   ++ +++ D+D+  KI   ++   C
Sbjct: 2223 CKGAKADLVFLIDGSWSIGDESFSKVLQFVFSMIGAFDVVSHEGMQVSFVQYSDDAKTEFKLNTYHDKGMALSAVRMINYRGGNTKTGAALKHVGEKVFTSDSGMRRNVPKVLVVVTDGRAQD--DVKKSASKLQHSGYSVFVVGV-ADVDLVELRNIGSKPSERHVFIVDDYDAFAKIQDNLITFIC 2407          
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Cavefish
Match: si:ch211-62a1.3 (si:ch211-62a1.3 [Source:ZFIN;Acc:ZDB-GENE-061207-41])

HSP 1 Score: 80.8777 bits (198), Expect = 1.922e-15
Identity = 47/191 (24.61%), Postives = 102/191 (53.40%), Query Frame = 1
Query:  160 CIKTA-GEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTD--IE---SKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAISDK---KNFYLIKDFDSLPKIVSTIVQKTCT 705
            C + A  +++F++DGS S+G  NF + ++F + +V    I  N  R+ L+ Y+  P+  F+++ Y + +++   I    +  G T  G+ L  +L    +E   S+ ++   ++ ++I+DG     ++P   A++L+     +  IG+ K+ DE  +  I+ +   ++ + + DF++L  I+  + Q+ CT
Sbjct:   27 CTQEAMADIVFLVDGSASIGLTNFQQIREFLSSLVTHFDIAPNKVRIGLVQYSDTPRTEFSLNTYEDKQEILDFIKVLPYKTGGTNTGEGLKFLLQHHFVEAAGSRAKKGVPQIAVVITDGNSQDEVEP--YAEELREKGIKIYAIGI-KDADEKLLKEIATQPYDQHLFSVSDFEALQGIMLNVTQEICT 214          

HSP 2 Score: 67.3958 bits (163), Expect = 2.989e-11
Identity = 52/206 (25.24%), Postives = 109/206 (52.91%), Query Frame = 1
Query:  109 NSLEFQILKELTQEDKKCIKTA-GEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGD----ALNMVLTDIESKTRRSTGKVIILISDGKRNGGMDPILV-AKQLKALSYMLITIGL-DKETDENSMIAISDKKNFYLIKDFDSLPKIVSTIVQKTCT 705
            +S+   +LK +T + K C  TA  ++ F+LD S S+  D+F+  K F  + ++   IG +  R+ ++ +     +VF ++ Y++   V + + K  F EG     D    A+  +    E   +    +++I+I+DGK      P+ V A++L+  +  +  +G+ + +T E   ++ S K+ FY ++++D+L  I + I+++ C+
Sbjct:  798 SSVFIPLLKNITIQ-KGCKFTAEADIYFLLDESGSITYDDFDDMKAFILEFLHMFQIGPDQVRIGVVKFADRATIVFRLNTYDSKSAVEKAV-KDLFMEGGGTRTDLGLYAMIPLFKQAEQTRKEKVRELLIVITDGKSEPVGTPVKVPAEELRKQNVTIYAVGVKNADTAELEDMSGSPKRTFY-VQNYDALKLIKTKILKEICS 1000          

HSP 3 Score: 66.6254 bits (161), Expect = 4.881e-11
Identity = 45/204 (22.06%), Postives = 97/204 (47.55%), Query Frame = 1
Query:  148 EDKKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTG-----KVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAISDKKNFYLIKDFDSLPKIVSTIVQKTCTGFHISKCSAPIVK 744
            ED +  + A +V+FI+D S ++GP+NF   ++F    ++ L +G +  RVA++ Y+  P+    ++ ++N  ++ + + K  +  G    G+AL      + +K R S       ++ ++++DGK +   D    A  L+     +  +G+    +   M +    K  + + +F  L  +   + ++ C    IS    P++K
Sbjct:  608 EDCRLAEVA-DVVFIVDKSGNMGPENFQLVRNFLQNTISGLDVGTDKVRVAIVDYSDEPRADVYLNTFSNKSEILQHVKKLSYGRGKANTGEALKYAKDYVFTKERGSRSDEYVQQIAVVVTDGKSSD--DVSAPAADLRRSGVTVFAVGIKSFDNLKEMASYPQDKFVFSVGNFTKLNALSGVVTKRICR--DISSVFIPLLK 806          

HSP 4 Score: 50.8322 bits (120), Expect = 3.768e-6
Identity = 51/235 (21.70%), Postives = 105/235 (44.68%), Query Frame = 1
Query:  115 LEFQILKELTQEDKKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKT--RRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAISDKKNFYLIKDFDSLPKIVSTIVQKTCTGFHISKCSAP-------IVKKGPCVNKEQINVITTF 792
            ++ +ILKE+   +  C     +V+F++DG+ +V   +F + KD     V +L I  N  R+A++ Y++  ++ F ++++ +   + ++I+  +  +G T  G AL  V    E     R +  + +++++D       D +  A  L+  +  +  +G+   +    +      +  YL   F SL  + S +V   C     ++C  P       +V     +NKE    I  F
Sbjct:  990 IKTKILKEICSFEA-CNDLLADVVFLIDGADAVDAADFQQAKDLIDFAVEKLPIRENRVRLAVVQYSTNTKVEFALNEFYDKDRIQKQIVAIKQLKGKTYTGRALTEVWQAFEESRGGRPNVLRFLVVVTDSSSKD--DVVAPAMALREKNVNVYAVGMGHASQSELLDISGSYETAYLENPFGSLQVLGSELVFMICN----TECKRPELIDIIFLVDGAGAINKETFQDIKIF 1217          

HSP 5 Score: 50.0618 bits (118), Expect = 6.133e-6
Identity = 40/180 (22.22%), Postives = 75/180 (41.67%), Query Frame = 1
Query:  178 EVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIES----KTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETD-ENSMIAISDKKNFYLIKDFDSLPKIVSTIVQKTC 702
            ++IF++DG+ ++  + F   K F   +V +  +G    R  L+ Y    Q VF +++Y N  +V   I K     G      AL   L    +    +  +   +V+ LI++G              L A    +  +G+    + E   IA ++++ FY +  +  L  +   I Q+ C
Sbjct: 1195 DIIFLVDGAGAINKETFQDIKIFMETVVTKTEVGEKRVRFGLVIYADRAQSVFTLNQYYNKSEVLEAISKLRTIGGRRNTAQALKSTLPYFSAAYGGRRAQHVPQVLFLITEGPVADSFSLADWPANLAASEVNMFAVGVAGAREAELRRIAGNNQRAFY-VDTYSQLETLCKPITQQLC 1373          
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009635.1 (pep scaffold:Pmarinus_7.0:GL479939:22902:31906:-1 gene:ENSPMAG00000008703.1 transcript:ENSPMAT00000009635.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.1149 bits (209), Expect = 8.708e-18
Identity = 53/196 (27.04%), Postives = 104/196 (53.06%), Query Frame = 1
Query:  178 EVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNS---VPQLV--FNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGM-DPILVAKQLKALSYMLITIGLDKETDENSMIAIS---DKKNFYLIKDFDSLPKIVSTIVQKTCTGFHISKCSAPI 738
            ++  ++DGS+SVGP NF+    F  ++V++L IG +  RV ++ Y+     P++   F++ +Y + + +   I+  ++  G T  G AL   L   +S+ R   GK+++L++DG+ N  + DP   + ++K+   +L ++G+ K   +   +  S   DK  F+   DF  L  I++ +    CT    +K + P+
Sbjct:    1 DLYLLVDGSSSVGPGNFHLVLKFLAKLVDKLDIGKDKVRVGMVQYSGDMRSPKIKKEFDMGQYADKEKLKAAILGTKYMRGFTFTGAALRHTLQLFKSQGRPGVGKILVLVTDGEANDKVKDP---SDEVKSSGIVLFSVGVGKADRKELALMASPPVDKHMFHAT-DFAGLDSIITALTSTVCTVVQEAKVAVPV 192          

HSP 2 Score: 82.8037 bits (203), Expect = 5.115e-17
Identity = 57/224 (25.45%), Postives = 112/224 (50.00%), Query Frame = 1
Query:  166 KTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNS---VPQLV--FNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGM-DPILVAKQLKALSYMLITIGLDKETDENSMIAIS---DKKNFYLIKDFDSLPKIVSTIVQKTCTGFHISKCSAP------IVKKGPCVNKEQINVITTF 792
            K   ++  ++DGS+SVG  NF+    F  ++V++L IG +  RV ++ Y+     P++   FN+ +Y + K +   I++ ++  G T  G AL   L   + + R   GK+++L++DG+ N  + DP   + ++K+   +L ++G+ K   +   +  S   DK  F+   +F  L  I++T+    CT    ++  AP      +V     V +   +++  F
Sbjct:  293 KQTADLYLLVDGSSSVGRRNFHLVLRFLAKLVDKLNIGKDKVRVGMVQYSGNMRSPRIKKEFNMGQYADKKKLKAAILRTKYMRGFTFTGAALRHTLQLFKRQGRPGVGKILVLVTDGEANDKVKDP---SDEVKSSGIVLFSVGVGKADRKELALMASPPVDKHMFHAT-NFAGLDSIITTLTSTVCTVVQEAQTPAPTADLYLLVDGSSSVGRRNFHLVLRF 512          

HSP 3 Score: 72.7886 bits (177), Expect = 7.473e-14
Identity = 45/157 (28.66%), Postives = 88/157 (56.05%), Query Frame = 1
Query:  139 LTQEDKKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNS---VPQLV--FNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGM-DPILVAKQLKALSYMLITIGLDK 591
            + QE +    TA ++  ++DGS+SVG  NF+    F  ++V++L IG +  RV ++ Y+     P++   FN+ +Y + K +   I++ ++  G T  G AL   L   + + R   GK+++L++DG+ N  + DP   + ++K+   +L ++G+ K
Sbjct:  478 VVQEAQTPAPTA-DLYLLVDGSSSVGRRNFHLVLRFLAKLVDKLDIGKDKVRVGMVQYSGNMRSPRIKKEFNMGQYADKKKLKAAILRTKYMRGFTFTGAALRHTLQLFKRQGRPGVGKILVLVTDGEANDKVKDP---SDEVKSSGIVLFSVGVGK 630          
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009632.1 (pep scaffold:Pmarinus_7.0:GL479939:9900:31909:-1 gene:ENSPMAG00000008703.1 transcript:ENSPMAT00000009632.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.5741 bits (205), Expect = 4.296e-17
Identity = 56/212 (26.42%), Postives = 109/212 (51.42%), Query Frame = 1
Query:  175 GEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNS---VPQLV--FNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGM-DPILVAKQLKALSYMLITIGLDKETDENSMIAIS---DKKNFYLIKDFDSLPKIVSTIVQKTCTGFHISKCSA-PIVKKGPCVNKEQINV 780
             ++  ++DGS+SVGP NF+    F  ++V++L IG +  RV ++ Y+     P++   F++ +Y + + +   I+  ++  G T  G AL   L   +S+ R   GK+++L++DG+ N  + DP   + ++K+   +L ++G+ K   +   +  S   DK  F+   DF  L  I++ +    CT     K  A P +    C +K+  ++
Sbjct:    1 ADLYLLVDGSSSVGPGNFHLVLKFLAKLVDKLDIGKDKVRVGMVQYSGDMRSPKIKKEFDMGQYADKEKLKAAILGTKYMRGFTFTGAALRHTLQLFKSQGRPGVGKILVLVTDGEANDKVKDP---SDEVKSSGIVLFSVGVGKADRKELALMASPPVDKHMFH-ATDFAGLDSIITALTSTVCTVVQPEKTLAGPTLALTECSDKQTADL 208          

HSP 2 Score: 80.1073 bits (196), Expect = 5.750e-16
Identity = 51/189 (26.98%), Postives = 99/189 (52.38%), Query Frame = 1
Query:  166 KTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNS---VPQLV--FNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGM-DPILVAKQLKALSYMLITIGLDKETDENSMIAIS---DKKNFYLIKDFDSLPKIVSTIVQKTCT 705
            K   ++  ++DGS+SVG  NF+    F  ++V++L IG +  RV ++ Y+     P++   FN+ +Y + K +   I++ ++  G T  G AL   L   + + R   GK+++L++DG+ N  + DP   + ++K+   +L ++G+ K   +   +  S   DK  F+   +F  L  I++ +    CT
Sbjct:  599 KQTADLYLLVDGSSSVGRRNFHLVLRFLAKLVDKLDIGKDKVRVGMVQYSGNMRSPRIKKEFNMGQYADKKKLKAAILRTKYMRGFTFTGAALRHTLQLFKRQGRPGVGKILVLVTDGEANDKVKDP---SDEVKSSGIVLFSVGVGKADRKELALMASPPVDKHMFH-ATNFAGLDSIITALTSTVCT 783          

HSP 3 Score: 78.5666 bits (192), Expect = 1.575e-15
Identity = 52/200 (26.00%), Postives = 102/200 (51.00%), Query Frame = 1
Query:  166 KTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNS---VPQLV--FNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGM-DPILVAKQLKALSYMLITIGLDKETDENSMIAIS---DKKNFYLIKDFDSLPKIVSTIVQKTCTGFHISKCSAPI 738
            K   ++  ++DGS+SVG  NF+    F  ++V++L IG +  RV ++ Y+     P++   F++ +Y + K +   I   ++  G T  G AL   L   + + R   GK+++L++DG+ N  + DP   + ++K+   +L ++G+ K   +   +  S   DK  F+   +F  L  I++ +    CT    ++  AP+
Sbjct:  203 KQTADLYLLVDGSSSVGRRNFHLVLRFLAKLVDKLDIGKDKVRVGMVQYSGNMRSPRIKKEFDMGQYADKKKLKAAIQGTKYMRGFTFTGAALRHTLQLFKRQGRPGVGKILVLVTDGEANDKVKDP---SDEVKSSGIVLFSVGVGKADRKELALMASPPVDKHMFH-ATNFAGLDSIITALTSTICTVVQEAQTPAPV 398          

HSP 4 Score: 76.2554 bits (186), Expect = 9.248e-15
Identity = 52/198 (26.26%), Postives = 104/198 (52.53%), Query Frame = 1
Query:  163 IKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNS---VPQLV--FNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGM-DPILVAKQLKALSYMLITIGLDKETDENSMIAIS---DKKNFYLIKDFDSLPKIVSTIVQKTCTGFHISKCS 729
            + +  ++  ++DGS+SVG  NF+    F  ++V++L IG +  RV ++ Y+     P++   FN+ +Y + K +   I++ ++  G T  G AL   L   + + R   GK+++L++DG+ N  + DP   + ++K+   +L ++G+ K   +   +  S   DK  F+   +F  L  I+ T+   T     +++CS
Sbjct:  407 LPSKADLYLLVDGSSSVGRRNFHLVLRFLAKLVDKLNIGKDKVRVGMVQYSGNMRSPRIKKEFNMGQYADKKKLKAAILRTKYMRGFTFTGAALRHTLQLFKRQGRPGVGKILVLVTDGEANDKVKDP---SDEVKSSGIVLFSVGVGKADRKELALMASPPVDKHMFH-ATNFAGLDSIIMTLAGPT---LALTECS 597          
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004974.1 (pep scaffold:Pmarinus_7.0:GL476356:523666:534068:1 gene:ENSPMAG00000004509.1 transcript:ENSPMAT00000004974.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.4925 bits (197), Expect = 4.958e-17
Identity = 50/188 (26.60%), Postives = 92/188 (48.94%), Query Frame = 1
Query:  169 TAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDE--NSMIAISDKKNFYLIKDF-DSLPKIVSTIVQKT-CTGFHIS 720
             A +++ ++DGS S+G  +F + K FA+ + N L I  N  ++ ++ Y+S P+L F +D Y   ++    I +  F  G T  G ++  VL       R    K+++L++DGK     +  L AK  +     +  +G+     E  N M +  D  + +  + + D+L  + +T+ Q T C+  H S
Sbjct:   49 AAVDILLLMDGSYSIGKASFERSKHFASNLCNMLDINPNRVQLGIVQYSSKPRLEFALDVYPTREEAKEAIARIAFRGGGTETGRSIKYVLRKGFLGGREGIPKILVLLTDGKSQD--NATLAAKHARNSGLTVFAVGIRHPAWEELNRMASDPDDMHVFYAEHYNDALNGLYTTLTQATVCSDVHPS 234          
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009633.1 (pep scaffold:Pmarinus_7.0:GL479939:15464:32536:-1 gene:ENSPMAG00000008703.1 transcript:ENSPMAT00000009633.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.4925 bits (197), Expect = 4.106e-16
Identity = 57/209 (27.27%), Postives = 110/209 (52.63%), Query Frame = 1
Query:  133 KELTQEDKKCI-KTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNS---VPQLV--FNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGM-DPILVAKQLKALSYMLITIGLDKETDENSMIAIS---DKKNFYLIKDFDSLPKIVSTIVQKTCTGFHISKCS 729
            + +T   K+C  K   ++  ++DGS+SVG  NF+    F  ++V++L IG +  RV ++ Y+     P++   FN+ +Y + K +   I++ ++  G T  G AL   L   + + R   GK+++L++DG+ N  + DP   + ++K+   +L ++G+ K   +   +  S   DK  F+   +F  L  I++T+    CT   + +CS
Sbjct:  428 QAVTLPSKECSDKQTADLYLLVDGSSSVGRRNFHLVLRFLAKLVDKLNIGKDKVRVGMVQYSGNMRSPRIKKEFNMGQYADKKKLKAAILRTKYMRGFTFTGAALRHTLQLFKRQGRPGVGKILVLVTDGEANDKVKDP---SDEVKSSGIVLFSVGVGKADRKELALMASPPVDKHMFH-ATNFAGLDSIITTLTSTVCT---VVQCS 629          

HSP 2 Score: 78.1814 bits (191), Expect = 2.320e-15
Identity = 51/189 (26.98%), Postives = 99/189 (52.38%), Query Frame = 1
Query:  166 KTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNS---VPQLV--FNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGM-DPILVAKQLKALSYMLITIGLDKETDENSMIAIS---DKKNFYLIKDFDSLPKIVSTIVQKTCT 705
            K   ++  ++DGS+SVG  NF+    F  ++V++L IG +  RV ++ Y+     P++   FN+ +Y + K +   I++ ++  G T  G AL   L   + + R   GK+++L++DG+ N  + DP   + ++K+   +L ++G+ K   +   +  S   DK  F+   +F  L  I++ +    CT
Sbjct:  631 KQTADLYLLVDGSSSVGRRNFHLVLRFLAKLVDKLDIGKDKVRVGMVQYSGNMRSPRIKKEFNMGQYADKKKLKAAILRTKYMRGFTFTGAALRHTLQLFKRQGRPGVGKILVLVTDGEANDKVKDP---SDEVKSSGIVLFSVGVGKADRKELALMASPPVDKHMFH-ATNFAGLDSIITALTSTVCT 815          

HSP 3 Score: 77.0258 bits (188), Expect = 5.485e-15
Identity = 52/200 (26.00%), Postives = 102/200 (51.00%), Query Frame = 1
Query:  166 KTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNS---VPQLV--FNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGM-DPILVAKQLKALSYMLITIGLDKETDENSMIAIS---DKKNFYLIKDFDSLPKIVSTIVQKTCTGFHISKCSAPI 738
            K   ++  ++DGS+SVG  NF+    F  ++V++L IG +  RV ++ Y+     P++   F++ +Y + K +   I   ++  G T  G AL   L   + + R   GK+++L++DG+ N  + DP   + ++K+   +L ++G+ K   +   +  S   DK  F+   +F  L  I++ +    CT    ++  AP+
Sbjct:  228 KQTADLYLLVDGSSSVGRRNFHLVLRFLAKLVDKLDIGKDKVRVGMVQYSGNMRSPRIKKEFDMGQYADKKKLKAAIQGTKYMRGFTFTGAALRHTLQLFKRQGRPGVGKILVLVTDGEANDKVKDP---SDEVKSSGIVLFSVGVGKADRKELALMASPPVDKHMFH-ATNFAGLDSIITALTSTICTVVQEAQTPAPV 423          

HSP 4 Score: 67.3958 bits (163), Expect = 5.748e-12
Identity = 42/153 (27.45%), Postives = 84/153 (54.90%), Query Frame = 1
Query:  166 KTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNS---VPQL--VFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGK-----VIILISDGKRNGGM-DPILVAKQLKALSYMLITIGLDK 591
            K   ++  ++DGS+SVGP NF+    F  ++V++L IG +  RV ++ Y+     P++   F++ +Y + + +   I+  ++  G T  G AL   L   +S+ R   GK     +++L++DG+ N  + DP   + ++K+   +L ++G+ K
Sbjct:   22 KQTADLYLLVDGSSSVGPGNFHLVLKFLAKLVDKLDIGKDKVRVGMVQYSGDMRSPKIKKEFDMGQYADKEKLKAAILGTKYMRGFTFTGAALRHTLQLFKSQGRPGVGKPQVPFILVLVTDGEANDKVKDP---SDEVKSSGIVLFSVGVGK 171          
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Sea Lamprey
Match: col21a1 (collagen, type XXI, alpha 1 [Source:ZFIN;Acc:ZDB-GENE-110607-3])

HSP 1 Score: 77.0258 bits (188), Expect = 2.585e-15
Identity = 50/187 (26.74%), Postives = 92/187 (49.20%), Query Frame = 1
Query:  160 CIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDI-ESKTRRST--GKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAISDKKN---FYLIKDFDSLPKIVSTIVQKTC 702
            C     +++FILDGS SVG  +F+  KD+   I N   +G   T+V+++ Y+  P+L  +     ++  V  EI    +  G T  G A+   + ++  S  RR +   K  I+++DGK    +   + A++ +A    L  +G+    +E  +  I++       + ++D+DS+ KI   + QK C
Sbjct:    1 CSTVPHDLVFILDGSWSVGVSSFHTVKDWLVNITNSFEVGPRYTQVSVVQYSDSPKLEVSFSDRASADRVVSEIRSIGYLGGNTHTGKAIKFAMDEVFASSARRGSDVAKTAIVVTDGKSQDNV--TVPAQEARASRITLFAVGVGSAAEEQELRNIANHPPSTYVFSVQDYDSIFKIKEVLKQKIC 185          
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Nematostella
Match: EDO50079 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFD8])

HSP 1 Score: 94.3597 bits (233), Expect = 1.844e-22
Identity = 52/175 (29.71%), Postives = 90/175 (51.43%), Query Frame = 1
Query:  178 EVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAISDKKNFYLIKDFDSLPKIVSTIVQKTC 702
            +++F +D S+SVG  NF + K F  ++V    I    TRVA I Y+S P++ F+ ++Y +++     + +  F  G T  G AL +  + +  +  R   KV++LI+DGK +   D +  +K LK     +  +G+      N +I I+   +      F SL  IV ++ +KTC
Sbjct:    7 DLVFAIDASSSVGKVNFERVKGFIRRLVESFHISRTSTRVAAIVYSSRPRVAFDFNRYTSARRAAHAVKRLRFLRGGTSTGRALRLASSRLFRRYGRKRRKVLMLITDGKSSD--DVLKPSKALKRKGVQIFAVGVGMSVSRNELILIASHPSQVYQASFTSLSAIVKSLARKTC 179          
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Nematostella
Match: EDO26384 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TC56])

HSP 1 Score: 89.3521 bits (220), Expect = 2.963e-19
Identity = 57/184 (30.98%), Postives = 101/184 (54.89%), Query Frame = 1
Query:  166 KTAGEVIFILDGSTSVG---PDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSM-IAISDKKNFYLIK-DFDSLPKIVSTIVQKTC 702
            + A ++ F+LDGSTS+    P NF   K+F   IV    I +  T V L+ Y+   QL+FN DKY++S  + + I   ++ +G T  G+AL M  + +   + RS  KV+I+++DG+ +  ++    +K LK    ++  +G+  + D + + +  SD K+ ++ K  F  L ++V  I +K C
Sbjct:  229 RLAVDLAFVLDGSTSINNADPGNFQLLKNFMINIVKSFKISSERTHVGLVLYSFFTQLMFNFDKYSDSASIVKAINTTDYPKGGTRTGEALKMAKSQLFGASMRSVPKVLIVLTDGRSSDKVEA--PSKALKDEGVVIFAVGVGDQIDPSELNVMASDSKSDHVFKAKFKELDRLVDLIKRKAC 410          

HSP 2 Score: 50.0618 bits (118), Expect = 1.374e-6
Identity = 47/198 (23.74%), Postives = 88/198 (44.44%), Query Frame = 1
Query:  178 EVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKY------NNSKDVNRE---------IMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGM-DPILVAKQLKALSYMLITIGLDKETDENSMIAISDKKNFYLIKDFDSLPKIVSTIVQKTCTGFHISK 723
            +++F++DGS  +  D F K KDF  ++ N   +  + T V L       +++FN+ +Y      +++ D  R+         + K ++  G T  G  L MV +++          ++I+++DG+ +  + +P  V ++   + Y +      K    N M A   K N     DF  +  IV  I  K C+G  I +
Sbjct:    1 DLVFVIDGSNDLTADAFTKAKDFMKKVYNNFPVSESATHVGLALSGCTSKVMFNLIEYFTKPALDSAVDSARKPDPYEVTGAVDKIKYPGGSTFTGAGLRMVKSNVP--------HILIVMTDGESHDDVAEPSRVLREDNTIIYAVGEGYYFKLKQLNEM-ASEPKINHVFTADFGQMNTIVEDIKDKACSGKKIRR 189          
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Nematostella
Match: EDO40688 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6N8])

HSP 1 Score: 80.4925 bits (197), Expect = 5.906e-18
Identity = 51/159 (32.08%), Postives = 88/159 (55.35%), Query Frame = 1
Query:  172 AGEVIFILDGSTSVG---PDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSM-IAISDKKN 636
            A ++ F+LDGSTS+    P NF   K+F   IV    I +  T V L+ Y+S  QL FN DKY++S  + + I   ++ +G T  G+AL M  + +   + RS  KV+I+++DG+ +  ++    +K LK    ++  +G+  + D + + +  SD K+
Sbjct:    1 AVDLAFVLDGSTSINNADPGNFQLLKNFMINIVKSFKISSERTHVGLVLYSSFTQLKFNFDKYSDSASIVKAINTTDYPKGGTRTGEALKMAKSQLFGASMRSVPKVLIVLTDGRSSDKVEA--PSKALKDEGVVIFAVGVGDQIDPSELNVMASDSKS 157          
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Nematostella
Match: EDO45378 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT18])

HSP 1 Score: 79.337 bits (194), Expect = 2.284e-17
Identity = 47/179 (26.26%), Postives = 86/179 (48.04%), Query Frame = 1
Query:  178 EVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDI-ESKTRRSTGKVIILISDGKRNGGMDPILVA-KQLKALSYMLITIGLDKETDENSMIAISDKKNFYLIKDFDSLPKIVSTIVQKTCTG 708
            ++ F+LD S SV  + F    +F  ++VN   IG + TR+ ++ Y++ P  +F    Y N       + +  +T G T  G A+N     + +   RR   KV+I+++DGK     D ++ A + +K +   +  IG+ +    + +  ++  +N  L   F  L KI+  I  + C G
Sbjct:    1 DIGFVLDASGSVRANRFKMCLNFINKLVNSFHIGPHNTRIGIVRYSTRPSGIFRFTSYRNKHSTKHRVNRIRYTGGWTRTGAAINYARRYLYQHNRRRGVRKVLIVMTDGK---SQDSVVGASRSVKRMGIEVFAIGIGRGYRRSELNQMATDRNHVLTARFRDLHKIIGKIKYRACKG 176          
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Nematostella
Match: EDO32425 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SV43])

HSP 1 Score: 83.5741 bits (205), Expect = 7.548e-17
Identity = 58/195 (29.74%), Postives = 103/195 (52.82%), Query Frame = 1
Query:  136 ELTQEDKKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKT---RRSTGKVIILISDGKRNGGMDPIL-VAKQLKALSYMLITIGLDKETDENSMIAISDKKNFYLIK--DFDSLPKIVSTIVQKTC 702
            E+    K C K+  ++   LD STSVGP NFN  K F   +V R+ I  N +   LI Y+S    V +      + D+NR+I   EFT G T    AL + +TD+ + +   R +   V+I++++G+ + G  P   V K LK     +I +G+  + +E  ++ I++    ++I+  D+++L   +++I+  +C
Sbjct: 1123 EIPHLAKPCPKSL-DIGIALDRSTSVGPTNFNIAKTFLKILVERMKISTNGSHFGLIAYSSSASRVISFRFSQKAADINRQIDAIEFTGGKTRTDFALQVAITDLFTNSAGDRENVTDVLIVMTNGRTSQGSLPYKDVMKPLKEKKVDVIAVGIGPDVNEAELLEIAEGGLDHVIRVDDYEALATKLNSILALSC 1316          
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Medaka
Match: col28a2a (collagen alpha-1(XXVIII) chain [Source:NCBI gene;Acc:101157899])

HSP 1 Score: 94.7449 bits (234), Expect = 6.188e-20
Identity = 60/205 (29.27%), Postives = 107/205 (52.20%), Query Frame = 1
Query:  124 QILKELTQEDKKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMDPI---LVAKQLKALSYMLITIGLDKETDE---------NSMIAISDKKNFYLIKDFDSLPKIVSTIVQKTC 702
            +++KE+     KC +   E++F++D S SVGP+NF   KDF T++V+R  +G N TR+ L+ Y+    L FN+ +Y   ++V + I K  +    T  G A+     +     R    KV I+I+DG+ +   +P+   +  ++  A +  + TIG+   +D          N + +  D ++ YLI DF++L  + S +V + C
Sbjct:  620 RLIKEICGCGIKCKERPMELVFVIDSSESVGPENFEIIKDFVTRLVDRTTVGRNATRIGLVLYSLDVYLEFNLARYTTKEEVKQAIRKMPYMGEGTYTGTAIRKATQEAFFSARPGVNKVAIVITDGQTD-KREPVKLEMAVREAHAANIEMYTIGIVNSSDPTQTEFLRELNLIASDPDSEHMYLIDDFNTLAALESKLVSQFC 823          
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Medaka
Match: ENSORLT00000044137.1 (pep primary_assembly:ASM223467v1:2:16334979:16376346:1 gene:ENSORLG00000025630.1 transcript:ENSORLT00000044137.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 94.3597 bits (233), Expect = 7.841e-20
Identity = 57/205 (27.80%), Postives = 109/205 (53.17%), Query Frame = 1
Query:  124 QILKELTQEDKKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMDPI---LVAKQLKALSYMLITIGLDKETDE---------NSMIAISDKKNFYLIKDFDSLPKIVSTIVQKTC 702
            +++KE+     KC +   E++F+LD S SVGP+NF   K F   +V+R+ +G+  TR+ L+ Y+    LVF++ +Y+  +D+   I    +    T  G A+     +  S++R    KV I+I+DG+ +   +P+   +  ++  A +  +  +G+   +D          N + +  DK++ +LI DF++LP + S +V + C
Sbjct:  627 RMIKEICGCGIKCKERPMELVFVLDSSESVGPENFEIIKGFVMALVDRVTVGSKATRIGLVLYSLDVNLVFDLPRYSTKEDIKLAIRSIAYMGEGTYTGTAIRKATQEAFSRSREGVSKVAIVITDGQTD-KREPVKLDVAVREAHAANIEMFALGIVNTSDPTRDDFLRELNLIASDPDKEHMFLIDDFNTLPTLESKLVSQFC 830          
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Medaka
Match: ENSORLT00000045235.1 (pep primary_assembly:ASM223467v1:2:16334729:16372633:1 gene:ENSORLG00000025630.1 transcript:ENSORLT00000045235.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.1965 bits (217), Expect = 2.274e-18
Identity = 54/186 (29.03%), Postives = 99/186 (53.23%), Query Frame = 1
Query:  148 EDKKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMDPI---LVAKQLKALSYMLITIGLDKETD--------ENSMIAIS-DKKNFYLIKDFDSLP 669
            E   C +   E++F+LD S SVGP+NF   K F   +V+R+ +G+  TR+ L+ Y+    LVF++ +Y+  +D+   I    +    T  G A+     +  S++R    KV I+I+DG+ +   +P+   +  ++  A +  +  +G+   +D        E ++IA   DK++ +LI DF++LP
Sbjct:  214 ERSACKERPMELVFVLDSSESVGPENFEIIKGFVMALVDRVTVGSKATRIGLVLYSLDVNLVFDLPRYSTKEDIKLAIRSIAYMGEGTYTGTAIRKATQEAFSRSREGVSKVAIVITDGQTD-KREPVKLDVAVREAHAANIEMFALGIVNTSDPTRDDFLRELNLIASDPDKEHMFLIDDFNTLP 398          
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Medaka
Match: col28a2a (collagen alpha-1(XXVIII) chain [Source:NCBI gene;Acc:101157899])

HSP 1 Score: 88.5817 bits (218), Expect = 4.839e-18
Identity = 62/206 (30.10%), Postives = 105/206 (50.97%), Query Frame = 1
Query:  157 KCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMDPI---LVAKQLKALSYMLITIGLDKETDE---------NSMIAISDKKNFYLIKDFDSLP---KIVSTIVQKTCTGF---HIS 720
            KC +   E++F++D S SVGP+NF   KDF T++V+R  +G N TR+ L+ Y+    L FN+ +Y   ++V + I K  +    T  G A+     +     R    KV I+I+DG+ +   +P+   +  ++  A +  + TIG+   +D          N + +  D ++ YLI DF++L    K+VS   +    GF   HI+
Sbjct:  742 KCKERPMELVFVIDSSESVGPENFEIIKDFVTRLVDRTTVGRNATRIGLVLYSLDVYLEFNLARYTTKEEVKQAIRKMPYMGEGTYTGTAIRKATQEAFFSARPGVNKVAIVITDGQTD-KREPVKLEMAVREAHAANIEMYTIGIVNSSDPTQTEFLRELNLIASDPDSEHMYLIDDFNTLALESKLVSQFCEDENGGFIYSHIT 946          
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Medaka
Match: matn1 (matrilin 1, cartilage matrix protein [Source:NCBI gene;Acc:101155615])

HSP 1 Score: 84.7297 bits (208), Expect = 3.456e-17
Identity = 51/176 (28.98%), Postives = 93/176 (52.84%), Query Frame = 1
Query:  160 CIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAISDK---KNFYLIKDFDSLPKIV 678
            C   A +V+F++DGS SV P+NF   K +  QI+++L + +  T V L+ Y+S  +  F + +YNN KD+   + K  + E  T+ G ALN ++ +   ++R    KV I+ +DG+    +     AK+ K   Y +  +G+     EN +  I+ +    +++   DF ++ +I 
Sbjct:  239 CSNAATDVVFVIDGSKSVRPENFELVKKWINQIIDKLDVSDAKTHVGLVQYSSSVREEFPLGRYNNKKDLKDAVKKMAYMERGTMTGQALNFMVENSFGRSRPGVAKVGIVFTDGRSQDYIGD--AAKKAKDNGYKMYAVGVGNAV-ENELKEIASEPTADHYFYTADFKTMNQIA 411          

HSP 2 Score: 50.0618 bits (118), Expect = 3.777e-6
Identity = 37/151 (24.50%), Postives = 76/151 (50.33%), Query Frame = 1
Query:  178 EVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDAL----NMVLTDIESKTRRS--TGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSM 612
            +++FI+D S SV P  F + K F  +++  L +G N TRV ++ Y S  +   ++  + +   + + + K E     T+ G A+    N+  ++IE    +S    +V I+++DG+    +    VA++ +     +  IG+ +  D N++
Sbjct:   16 DLVFIIDSSRSVRPSEFEQVKVFLAKVIEGLDVGPNATRVGVVNYASRVKNEVSLKTHRSKPALVKAVTKIEPLSTGTMTGLAIQFAQNVAFSEIEGARTKSPDISRVAIIVTDGRPQDNVRD--VAQRAREAGIEIFAIGVGR-VDMNTL 163          
BLAST of Collagen alpha-1(XXVIII) chain vs. Planmine SMEST
Match: SMESG000033673.1 (SMESG000033673.1)

HSP 1 Score: 1041.95 bits (2693), Expect = 0.000e+0
Identity = 512/515 (99.42%), Postives = 514/515 (99.81%), Query Frame = 1
Query:   40 MKIEFILSVCLIFVAIIKCENFENSLEFQILKELTQEDKKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAISDKKNFYLIKDFDSLPKIVSTIVQKTCTGFHISKCSAPIVKKGPCVNKEQINVITTFYYYNGKCVSENRKLTVKCLGPKDCPDPYYQKTSCGSANYSFILFHNFSRVNDLCRTETVNLKKYSCGCSKPEESVLKVVYGKECENGYKKRMLLYYEFSQFKCSETYLNLEPVKCDTLCNGTTLVTSPCVNGKRNNTIYTKVFTNNKCSLKIVKTTESFCDTICPKSLIIESKECVNNIKDVFHITFQNVNGKCIKQTKKIKSNNCTKIQECPQPKFISSDCVEGKKILMKLSYRLVGGKCQEINERIGNENCSIAKCPKPSYK 1584
            MKIEF+LSVCLIFV IIKCENFENSLEFQILKELTQEDKKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAISDKKNFYLIKDFDSLPKIVSTIVQKTCTGFHISKCSAPIVKKGPCVNKEQINVITTFYYYNGKCVSENRKLTVKCLGPKDCPDPYYQKTSCGSANYSFILFHNFSRVNDLCRTETVNLKKYSCGCSKPEESVLKVVYGKECENGYKKRMLLYYEFSQFKCSETYLNLEPVKCDTLCNGTTLVTSPCVNGKRNNTIYTKVFTNNKCSLKIVKTTESFCDTICPKSLIIESKECVNNIKDVFHITFQNVNGKCIKQTKKIKSNNCTKIQECPQPKFISSDC+EGKKILMKLSYRLVGGKCQEINERIGNENCSIAKCPKPSYK
Sbjct:    1 MKIEFLLSVCLIFVTIIKCENFENSLEFQILKELTQEDKKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAISDKKNFYLIKDFDSLPKIVSTIVQKTCTGFHISKCSAPIVKKGPCVNKEQINVITTFYYYNGKCVSENRKLTVKCLGPKDCPDPYYQKTSCGSANYSFILFHNFSRVNDLCRTETVNLKKYSCGCSKPEESVLKVVYGKECENGYKKRMLLYYEFSQFKCSETYLNLEPVKCDTLCNGTTLVTSPCVNGKRNNTIYTKVFTNNKCSLKIVKTTESFCDTICPKSLIIESKECVNNIKDVFHITFQNVNGKCIKQTKKIKSNNCTKIQECPQPKFISSDCIEGKKILMKLSYRLVGGKCQEINERIGNENCSIAKCPKPSYK 515          

HSP 2 Score: 89.3521 bits (220), Expect = 2.843e-18
Identity = 81/270 (30.00%), Postives = 116/270 (42.96%), Query Frame = 1
Query:  724 CSAPIVKKGPCVNKEQINVITTFYYYNGKC-VSENRKLTVKCLGPKDCPDPYYQKTSCGSANYSFILFHNF-SRVNDLCRTETVNLKKYSCGCSKPEESVLKVVYGKECENGYKKRMLLYYEFSQFKCSETYLNLEPVKCDTLCN-GTTLVTSPCVNGKRNNTIYTKVFTNNKCSLKIVKTTESFCDTICPKSLIIESK-ECVNNIKDVFHITFQNVNGKCIKQTKKIKSNNCTKIQECPQPKFISSDCVEGKK--ILMKLSYRLVGGKC 1515
            C  P  K+  C+ K+Q     TF     KC  S  R   V C G   C +  Y+   C        L   F    N  C  + V +KK SC C+      + VV GK+C+NGY  R+L   E    KC +    L  ++C   C+    LV + CV+ KR       V    KC LK+V +    C  +CP  L  E K  C+   + V  +TF+NV   C+  T ++      K Q CP+P +    C   +K   L++++YR     C
Sbjct:  651 CPDPKEKRSRCILKKQAIFRVTFKEVGDKCRFSVIRLSVVPCQG---CQNSTYRIEKCDKGAKETKLVRTFYQETNQTCVKKEVIVKKLSCRCTGNITKNINVVVGKQCQNGYITRVLELTEERNDKCVKVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGKKCVLKVVNSKTVNCKNLCP--LPKEKKSRCIRGKQAVMRLTFRNVGNVCLYSTARV---GLVKCQGCPKPSYKVEKCDNNQKNTSLIRVAYRQTNSSC 912          

HSP 3 Score: 82.4185 bits (202), Expect = 4.175e-16
Identity = 77/296 (26.01%), Postives = 128/296 (43.24%), Query Frame = 1
Query:  724 CSAPIVKKGPCVNKEQINVITTFYYYNGKCV-SENRKLTVKCLGPKDCPDPYYQKTSCGS--ANYSFILFHNFSRVNDLCRTETVNLKKYSCGCSKPEESVLKVVYGKECENGYKKRMLLYYEFSQFKCSETYLNLEPVKCDTLCNGTTLV-TSPCVNGKRNNTIYTKVFTNNKCSLKIVKTTESFCDTICPKSLIIESKECVNNIKDVFHITFQNVNGKCIKQTKKIK-------SNNCTKIQEC----PQPKFISS-------DCVEGKKILMKLSYRLVGGKCQEINERIGNE 1545
            C  P  KK  C+  +Q  +  TF      C+ S  R   VKC G   CP P Y+   C +   N S I    + + N  C      + K  C C +  E+ + V +G++C+NG+  R++        KCS+    L  ++C   C+    V    C + +R+ T+   V   N+C  KIV +    C  +CP      S+ C+   + +F +TF+ V  KC     ++         N+  +I++C     + K + +        CV+ + I+ KLS R  G   + IN  +G +
Sbjct: 1547 CPLPKEKKSRCIRGKQAVMRLTFRNVGNVCLYSTARVRLVKCQG---CPKPSYKVEKCNNNQKNTSLIRVA-YRQTNSSCVRTQTTVTKLPCQCYRNTETNVTVTFGRQCQNGFLSRVIELNVEKSGKCSKVAFKLRSIRCKKPCDRRRKVEVGKCKSNQRSLTVLRAVREKNRCMWKIVTSKFVKCKKVCPDPKEKRSR-CILKKQAIFRVTFKEVGDKCRFSVIRLSVVPCQGCQNSTYRIEKCDKGAKETKLVRTFYQETNQTCVKKEVIVKKLSCRCTGNTTKNINVVVGKQ 1837          

HSP 4 Score: 81.6481 bits (200), Expect = 7.095e-16
Identity = 114/446 (25.56%), Postives = 185/446 (41.48%), Query Frame = 1
Query:  253 QIVNRLV---IGN----NLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRST-GKVIILISDGKRNGGMDPIL---VAKQLKA--LSYMLITIGLDKETDENSMIAI----SDKKNFYLIKDFDSLPKIVSTIVQKTCTGFHISK--CSAPIVKKGPCVNKEQINVITTFYYYNGKC-VSENRKLTVKCLGPKDCPDPYYQKTSCGSANYSFILFHNF-SRVNDLCRTETVNLKKYSCGCSKPEESVLKVVYGKECENGYKKRMLLYYEFSQFKCSETYLNLEPVKCDTLCN-GTTLVTSPCVNGKRNNTIYTKVFTNNKCSLKIVKTTESFCDTICPKSLIIESK-ECVNNIKDVFHITFQNVNGKCIKQTKKIKSNNCTKIQECPQPKFISSDCVEGKK--ILMKLSYRLVGGKC 1515
            Q V RL    +GN    +  RV L+     P+  + V+K +N++  N  +++  + +  +        V T +  +  R+T   V +      +NG +  ++   V K  K   +++ L +I   K  D    + +    S++++  +++      + +  IV    + F   K  C  P  K+  C+ K+      TF     KC  S  R   V C G   C +  Y+   C        L   F    N  C  + V +KK SC C+      + VV GK+C+NGY  R+L   E    KC +    L  ++C   C+    LV + CV+ KR       V   NKC LK+V +    C   CP  L  E +  C+  I+ V  ITF  V  KC     ++   N TK Q C +  +    C   +K   L++++YR     C
Sbjct:  852 QAVMRLTFRNVGNVCLYSTARVGLVKCQGCPKPSYKVEKCDNNQK-NTSLIRVAYRQTNSSCVRTQTTV-TKLPCQCYRNTETNVTVTFGRQCQNGFLSRVIELNVEKSGKCSKVAFKLRSIRCRKPCDRRRKVEVGKCKSNQRSLTVLRAVREKNRCMWKIVT---SKFVKCKKVCPDPKEKRSRCILKKLAIFRVTFKEVGDKCRFSVIRLSVVPCQG---CQNSTYRIEKCDKGAKETKLVRTFYQETNQTCVKKEVIVKKLSCRCTGNITKNINVVVGKQCQNGYITRVLELTEERNDKCVKVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGNKCVLKVVNSKTVNCKNPCP--LPKERRTRCIKGIQGVMKITFNLVGNKCNALFVRV---NITKCQRCQKTSYKVEKCNNNQKNTSLIRVAYRQTNSSC 1284          

HSP 5 Score: 80.8777 bits (198), Expect = 1.422e-15
Identity = 56/186 (30.11%), Postives = 93/186 (50.00%), Query Frame = 1
Query:  862 CPDPYYQKTSC-GSANYSFILFHNFSRVNDLCRTETVNLKKYSCGCSKPEESVLKVVYGKECENGYKKRML-LYYEFSQFKCSETYLNLEPVKCDTLCNGTTLVTSPCVNGKRNNTIYTKVFTNN-KCSLKIVKTTESFCDTICPKSLIIESKECVNNIKDVFHITFQNVNGKCIKQTKKIKSNNC 1410
            CP   Y+   C  +A  +F++   F   N +C  + + LK   C C       + V+ G  C+NGYK R+L L  E +Q    ET+  L  +KC+  CN T  +  PC   KR   +  ++ +NN  C  K++ +T   C   CP+   I++  C+N  + +  I++Q   GKC K+ +K+++  C
Sbjct: 1946 CPRSVYRIDRCEKNAKETFLIRTFFQSANGVCLRKELKLKTLPCKCYDNVTRNITVIIGPSCQNGYKSRVLELRVEKNQNCIKETF-KLRSIKCEGACNRTNQIVGPCFLNKRLVKVLKQIKSNNGSCHWKLLSSTFVNCSHKCPEPQ-IKTTACINGERFMVRISYQETGGKCEKREQKLQTLKC 2129          

HSP 6 Score: 79.337 bits (194), Expect = 3.726e-15
Identity = 77/296 (26.01%), Postives = 126/296 (42.57%), Query Frame = 1
Query:  724 CSAPIVKKGPCVNKEQINVITTFYYYNGKCV-SENRKLTVKCLGPKDCPDPYYQKTSC--GSANYSFILFHNFSRVNDLCRTETVNLKKYSCGCSKPEESVLKVVYGKECENGYKKRMLLYYEFSQFKCSETYLNLEPVKCDTLCNGTTLV-TSPCVNGKRNNTIYTKVFTNNKCSLKIVKTTESFCDTICPKSLIIESKECVNNIKDVFHITFQNVNGKCIKQTKKIK-------SNNCTKIQEC----PQPKFISS-------DCVEGKKILMKLSYRLVGGKCQEINERIGNE 1545
            C  P  KK  C+  +Q  +  TF      C+ S  R   VKC G   CP P Y+   C     N S I    + + N  C      + K  C C +  E+ + V +G++C+NG+  R++        KCS+    L  ++C   C+    V    C + +R+ T+   V   N+C  KIV +    C  +CP      S+ C+     +F +TF+ V  KC     ++         N+  +I++C     + K + +        CV+ + I+ KLS R  G   + IN  +G +
Sbjct:  837 CPLPKEKKSRCIRGKQAVMRLTFRNVGNVCLYSTARVGLVKCQG---CPKPSYKVEKCDNNQKNTSLIRVA-YRQTNSSCVRTQTTVTKLPCQCYRNTETNVTVTFGRQCQNGFLSRVIELNVEKSGKCSKVAFKLRSIRCRKPCDRRRKVEVGKCKSNQRSLTVLRAVREKNRCMWKIVTSKFVKCKKVCPDPKEKRSR-CILKKLAIFRVTFKEVGDKCRFSVIRLSVVPCQGCQNSTYRIEKCDKGAKETKLVRTFYQETNQTCVKKEVIVKKLSCRCTGNITKNINVVVGKQ 1127          

HSP 7 Score: 79.337 bits (194), Expect = 4.135e-15
Identity = 71/298 (23.83%), Postives = 128/298 (42.95%), Query Frame = 1
Query:  715 ISKCSAPIVKKGPCVNKEQINVITTFYYYNGKCVSENRKLTVKCLGPKDCPDPYYQKTSCGS--ANYSFILFHNFSRVNDLCRTETVNLKKYSCGCSKPEESVLKVVYGKECENGYKKRMLLYYEFSQFKCSETYLNLEPVKCDTLCNGTTLV-TSPCVNGKRNNTIYTKVFTNNKCSLKIVKTTESFCDTICPKSLIIESKECVNNIKDVFHITFQNVNGKCIKQTKKIK-------SNNCTKIQEC----PQPKFISS-------DCVEGKKILMKLSYRLVGGKCQEINERIGNE 1545
            I +C  P      C+  ++I +  ++    GKC   N ++  +      CP P Y+   C +   N S I    + + N  C      + K  C C +  E+ + V +G++C+NG+  R++        KCS+    L  ++C   C+    V    C + +R+ T+   V   N+C  KIV +    C  +CP      S+ C+   + +F +TF+ V  KC     ++         N+  +I++C     + K + +        CV+ + I+ KLS R  G   + IN  +G +
Sbjct:  460 IQECPQPKFISSDCIEGKKILMKLSYRLVGGKCQEINERIGNENCSIAKCPKPSYKVEKCNNNQKNTSLIRVA-YRQTNSSCVRTQTTVTKLPCQCYRNTETNVTVTFGRQCQNGFLSRVIELNVEKSGKCSKVAFKLRSIRCKKPCDRRRKVEVGKCKSNQRSLTVLRAVREKNRCMWKIVTSKFVKCKKVCPDPKEKRSR-CILKKQAIFRVTFKEVGDKCRFSVIRLSVVPCQGCQNSTYRIEKCDKGAKETKLVRTFYQETNQTCVKKEVIVKKLSCRCTGNITKNINVVVGKQ 755          

HSP 8 Score: 78.1814 bits (191), Expect = 1.001e-14
Identity = 82/305 (26.89%), Postives = 129/305 (42.30%), Query Frame = 1
Query:  745 KGPCVNKEQINVITTFYYYNGKCVSENRKLTV--------KCLGP----------KDCPDPYYQKTSCGSANYSFILFHNFSRVNDLCRTETVNLKKYSC-GCSKPEESVLKVVYGKECENGYKKRMLL--YYEFSQFKCSETYLNLEPVKCDTLCNGT----TLVTSPCVNGKRNNTIYTKVFTNNKCSLKIVKTTESFCDTICPKSLIIESKECVNNIKDVFHITFQNVNGKCIKQTKKIKSNNCTKIQECPQPKFISSDCVEGKKILMKLSYRLVGGKCQEINERIGNENCSIAKCPKPSYK 1584
            K PC  + ++ V        GKC S  R LTV        +C+            K CPDP  +++ C     + I    F  V D CR   + L    C GC   + S  ++   ++C+ G K+  L+  +Y+ +   C +  + ++ + C    N T     +V   C NG     +      N+KC     K     C   C + L +   +CV+N + +  +       KC+ +    K+ NC  +  CP PK   S C+ GK+ +M+L++R VG  C     R+G   C    CPKPSYK
Sbjct:  602 KKPCDRRRKVEV--------GKCKSNQRSLTVLRAVREKNRCMWKIVTSKFVKCKKVCPDPKEKRSRCILKKQA-IFRVTFKEVGDKCRFSVIRLSVVPCQGC---QNSTYRI---EKCDKGAKETKLVRTFYQETNQTCVKKEVIVKKLSCRCTGNITKNINVVVGKQCQNGYITRVLELTEERNDKCVKVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGKKCVLKVVNSKTVNCKNL--CPLPKEKKSRCIRGKQAVMRLTFRNVGNVCLYSTARVGLVKCQ--GCPKPSYK 887          

HSP 9 Score: 75.0998 bits (183), Expect = 8.208e-14
Identity = 101/390 (25.90%), Postives = 162/390 (41.54%), Query Frame = 1
Query:  253 QIVNRLV---IGN----NLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRST-GKVIILISDGKRNGGMDPIL---VAKQLKA--LSYMLITIGLDKETDENSMIAI----SDKKNFYLIKDFDSLPKIVSTIVQKTCTGFHISK--CSAPIVKKGPCVNKEQINVITTFYYYNGKC-VSENRKLTVKCLGPKDCPDPYYQKTSCGSANYSFILFHNF-SRVNDLCRTETVNLKKYSCGCSKPEESVLKVVYGKECENGYKKRMLLYYEFSQFKCSETYLNLEPVKCDTLCN-GTTLVTSPCVNGKRNNTIYTKVFTNNKCSLKIVKTTESFCDTICPKSLIIESK-ECVNNIKDVFHITF 1353
            Q V RL    +GN    +  RV L+     P+  + V+K NN++  N  +++  + +  +        V T +  +  R+T   V +      +NG +  ++   V K  K   +++ L +I   K  D    + +    S++++  +++      + +  IV    + F   K  C  P  K+  C+ K+Q     TF     KC  S  R   V C G   C +  Y+   C        L   F    N  C  + V +KK SC C+      + VV GK+C+NGY  R+L   E    KC +    L  ++C   C+    LV + CV+ KR       V    KC LK+V +    C   CP  L  E +  C+  I+ V  ITF
Sbjct: 1562 QAVMRLTFRNVGNVCLYSTARVRLVKCQGCPKPSYKVEKCNNNQK-NTSLIRVAYRQTNSSCVRTQTTV-TKLPCQCYRNTETNVTVTFGRQCQNGFLSRVIELNVEKSGKCSKVAFKLRSIRCKKPCDRRRKVEVGKCKSNQRSLTVLRAVREKNRCMWKIVT---SKFVKCKKVCPDPKEKRSRCILKKQAIFRVTFKEVGDKCRFSVIRLSVVPCQG---CQNSTYRIEKCDKGAKETKLVRTFYQETNQTCVKKEVIVKKLSCRCTGNTTKNINVVVGKQCQNGYITRVLELTEERNDKCVKVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGKKCVLKVVNSKTVNCKNPCP--LPKERRTRCIKGIQGVMKITF 1941          

HSP 10 Score: 71.633 bits (174), Expect = 1.124e-12
Identity = 80/297 (26.94%), Postives = 126/297 (42.42%), Query Frame = 1
Query:  721 KCSAPIVKKGPCVNKEQINVITTFYYYNGKCVSENRKL-TVKCLGPKDCPDPYYQKTSCGSANYSFILFHNFSRVNDLCRTETVN-------LKKYSCGCSKPEESVLKVVYGKECENGYKKRMLLYYEFSQFKCSETYLNLEPVKCDTLCNGTTLVTSPCVNGKRNNTIYTKVFTNNKCSLKIVKTTESFCDTICPKSLIIESKECVNNIKDVFHITFQNVNGKC------IKQTK---KIKSNNCTKIQECPQPKFISSDCVEGKK--ILMKLSYRLVGGKCQEINERIGNENCS 1554
            KC  P +K   C+N E+  V  ++    GKC    +KL T+KC            +T    + Y  +     S+ ++L RT   N       L    C C       L V     C NG + + L +Y     KC    L+++  KC   C G+T   S CVNG R    +T+  + ++C  K+V + +  C +ICP + ++ S +C+   K      F+    +C       K TK    I   NC+KI+     +   S+C +GK   I  K + + V G C   + +I   NC+
Sbjct: 2087 KCPEPQIKTTACINGERFMVRISYQETGGKCEKREQKLQTLKC------------QTCFRKSVYELMECSKTSKTSELVRTSHRNCTRKVEKLLDVDCLCEGLNNYGLNVTSTANCTNGVRVKTLSFYTTVNGKCQVKSLSIKGGKCG--CLGSTFNLSVCVNGNRILEKFTRYQSGSQCLSKLVFSRKIRCRSICPTNSVVLSSKCLKKRKLRVISLFEKSYNQCKLVKFSFKWTKCIIPISGKNCSKIK-----RLTMSNCQKGKAYIIFTKSAEKPVNGTCGLNSSKIAQVNCT 2364          

HSP 11 Score: 68.5514 bits (166), Expect = 1.031e-11
Identity = 77/305 (25.25%), Postives = 128/305 (41.97%), Query Frame = 1
Query:  745 KGPCVNKEQINVITTFYYYNGKCVSENRKLTV--------KCLGP----------KDCPDPYYQKTSCGSANYSFILFHNFSRVNDLCRTETVNLKKYSC-GCSKPEESVLKVVYGKECENGYKKRMLL--YYEFSQFKCSETYLNLEPVKCDTLCNGT----TLVTSPCVNGKRNNTIYTKVFTNNKCSLKIVKTTESFCDTICPKSLIIESKECVNNIKDVFHITFQNVNGKCIKQTKKIKSNNCTKIQECPQPKFISSDCVEGKKILMKLSYRLVGGKCQEINERIGNENCSIAKCPKPSYK 1584
            + PC  + ++ V        GKC S  R LTV        +C+            K CPDP  +++ C     + I    F  V D CR   + L    C GC   + S  ++   ++C+ G K+  L+  +Y+ +   C +  + ++ + C    N T     +V   C NG     +      N+KC     K     C   C + L +   +CV+N + +  +       KC+ +    K+ NC     CP PK   + C++G + +MK+++ LVG KC  +  R+    C   +C K SYK
Sbjct:  974 RKPCDRRRKVEV--------GKCKSNQRSLTVLRAVREKNRCMWKIVTSKFVKCKKVCPDPKEKRSRCILKKLA-IFRVTFKEVGDKCRFSVIRLSVVPCQGC---QNSTYRI---EKCDKGAKETKLVRTFYQETNQTCVKKEVIVKKLSCRCTGNITKNINVVVGKQCQNGYITRVLELTEERNDKCVKVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGNKCVLKVVNSKTVNCK--NPCPLPKERRTRCIKGIQGVMKITFNLVGNKCNALFVRVNITKCQ--RCQKTSYK 1259          

HSP 12 Score: 67.3958 bits (163), Expect = 2.199e-11
Identity = 74/310 (23.87%), Postives = 112/310 (36.13%), Query Frame = 1
Query:  745 KGPCVNKEQINVITTFYYYNGKCVSENRKLTV--------KCLGP----------KDCPDPYYQKTSCGSANYSFILFHNFSRVNDLCRTETVNLKKYSCG------------CSKPEESVLKVVYGKECENGYKKRMLLYYEFSQFKCSETYLNLEPVKCDTLCNGTTLVTSPCVNGKRNNTIYTKVFTNNKCSLKIVKTTESFCDTICPKSLIIESKECVNNIKDVFHITFQNVNGKCIKQTKKIKSNNCTKIQECPQPKFISSDCVEGKKILMKLSYRLVGGKCQEINERIGNENCSIAKCPKPSYK 1584
            + PC  + ++ V        GKC S  R LTV        +C+            K CPDP  +++ C     + I    F  V D CR   + L    C             C+      + VV GK+C++GY  R+L   E    KC +    L  ++                                             C   C + L +   +CV+N + +  +       KC+ +    K+ NC  +  CP PK   S C+ GK+ +M+L++R VG  C     R+    C    CPKPSYK
Sbjct: 1346 RKPCDRRRKVEV--------GKCKSNQRSLTVLRAVREKNRCMWKIVTSKFVKCKKVCPDPKEKRSRCILKKQA-IFRVTFKEVGDKCRFSVIRLSVVPCQDSFNILLILSGRCTGNTTKNINVVVGKQCQSGYITRVLELTEERNDKCVKVAFKLRRIR---------------------------------------------CQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGKKCVLKVVNSKTVNCKNL--CPLPKEKKSRCIRGKQAVMRLTFRNVGNVCLYSTARVRLVKCQ--GCPKPSYK 1597          

HSP 13 Score: 63.929 bits (154), Expect = 2.486e-10
Identity = 55/221 (24.89%), Postives = 96/221 (43.44%), Query Frame = 1
Query:  724 CSAPIVKKGPCVNKEQINVITTFYYYNGKCVSENRKLTV-KCLGPKDCPDPYYQKTSCGS--ANYSFILFHNFSRVNDLCRTETVNLKKYSCGCSKPEESVLKVVYGKECENGYKKRMLLYYEFSQFKCSETYLNLEPVKCDTLCNGTTLV-TSPCVNGKRNNTIYTKVFTNNKCSLKIVKTTESFCDTICPKSLIIESKECVNNIKDVFHITFQNVNGKC 1374
            C  P  ++  C+   Q  +  TF     KC +   ++ + KC   + C    Y+   C +   N S I    + + N  C      + K  C C +  E+ + V +G++C+NG+  R++        KCS+    L  ++C   C+    V    C + +R+ T+   V   N+C  KIV +    C  +CP      S+ C+   + +F +TF+ V  KC
Sbjct: 1209 CPLPKERRTRCIKGIQGVMKITFNLVGNKCNALFVRVNITKC---QRCQKTSYKVEKCNNNQKNTSLIRVA-YRQTNSSCVRTQTTVTKLPCQCYRNTETNVTVTFGRQCQNGFLSRVIELNVEKSGKCSKVAFKLRSIRCRKPCDRRRKVEVGKCKSNQRSLTVLRAVREKNRCMWKIVTSKFVKCKKVCPDPKEKRSR-CILKKQAIFRVTFKEVGDKC 1424          

HSP 14 Score: 58.9214 bits (141), Expect = 9.791e-9
Identity = 70/281 (24.91%), Postives = 117/281 (41.64%), Query Frame = 1
Query:  745 KGPCVNKEQINVITTFYYYNGKCVSENRKLTV--------KCLGP----------KDCPDPYYQKTSCGSANYSFILFHNFSRVNDLCRTETVNLKKYSC-GCSKPEESVLKVVYGKECENGYKKRMLL--YYEFSQFKCSETYLNLEPVKCDTLCNGTT------LVTSPCVNGKRNNTIYTKVFTNNKCSLKIVKTTESFCDTICPKSLIIESKECVNNIKDVFHITFQNVNGKCIKQTKKIKSNNCTKIQECPQPKFISSDCVEGKKILMKLSYRLVG 1506
            K PC  + ++ V        GKC S  R LTV        +C+            K CPDP  +++ C     + I    F  V D CR   + L    C GC   + S  ++   ++C+ G K+  L+  +Y+ +   C +  + ++ + C   C G T      +V   C NG     +      N+KC     K     C   C + L +   +CV+N + +  +       KC+ +    K+ NC     CP PK   + C++G + +MK+++ LVG
Sbjct: 1684 KKPCDRRRKVEV--------GKCKSNQRSLTVLRAVREKNRCMWKIVTSKFVKCKKVCPDPKEKRSRCILKKQA-IFRVTFKEVGDKCRFSVIRLSVVPCQGC---QNSTYRI---EKCDKGAKETKLVRTFYQETNQTCVKKEVIVKKLSCR--CTGNTTKNINVVVGKQCQNGYITRVLELTEERNDKCVKVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGKKCVLKVVNSKTVNCK--NPCPLPKERRTRCIKGIQGVMKITFNLVG 1945          
BLAST of Collagen alpha-1(XXVIII) chain vs. Planmine SMEST
Match: SMESG000033673.1 (SMESG000033673.1)

HSP 1 Score: 1041.95 bits (2693), Expect = 0.000e+0
Identity = 512/515 (99.42%), Postives = 514/515 (99.81%), Query Frame = 1
Query:   40 MKIEFILSVCLIFVAIIKCENFENSLEFQILKELTQEDKKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAISDKKNFYLIKDFDSLPKIVSTIVQKTCTGFHISKCSAPIVKKGPCVNKEQINVITTFYYYNGKCVSENRKLTVKCLGPKDCPDPYYQKTSCGSANYSFILFHNFSRVNDLCRTETVNLKKYSCGCSKPEESVLKVVYGKECENGYKKRMLLYYEFSQFKCSETYLNLEPVKCDTLCNGTTLVTSPCVNGKRNNTIYTKVFTNNKCSLKIVKTTESFCDTICPKSLIIESKECVNNIKDVFHITFQNVNGKCIKQTKKIKSNNCTKIQECPQPKFISSDCVEGKKILMKLSYRLVGGKCQEINERIGNENCSIAKCPKPSYK 1584
            MKIEF+LSVCLIFV IIKCENFENSLEFQILKELTQEDKKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAISDKKNFYLIKDFDSLPKIVSTIVQKTCTGFHISKCSAPIVKKGPCVNKEQINVITTFYYYNGKCVSENRKLTVKCLGPKDCPDPYYQKTSCGSANYSFILFHNFSRVNDLCRTETVNLKKYSCGCSKPEESVLKVVYGKECENGYKKRMLLYYEFSQFKCSETYLNLEPVKCDTLCNGTTLVTSPCVNGKRNNTIYTKVFTNNKCSLKIVKTTESFCDTICPKSLIIESKECVNNIKDVFHITFQNVNGKCIKQTKKIKSNNCTKIQECPQPKFISSDC+EGKKILMKLSYRLVGGKCQEINERIGNENCSIAKCPKPSYK
Sbjct:    1 MKIEFLLSVCLIFVTIIKCENFENSLEFQILKELTQEDKKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAISDKKNFYLIKDFDSLPKIVSTIVQKTCTGFHISKCSAPIVKKGPCVNKEQINVITTFYYYNGKCVSENRKLTVKCLGPKDCPDPYYQKTSCGSANYSFILFHNFSRVNDLCRTETVNLKKYSCGCSKPEESVLKVVYGKECENGYKKRMLLYYEFSQFKCSETYLNLEPVKCDTLCNGTTLVTSPCVNGKRNNTIYTKVFTNNKCSLKIVKTTESFCDTICPKSLIIESKECVNNIKDVFHITFQNVNGKCIKQTKKIKSNNCTKIQECPQPKFISSDCIEGKKILMKLSYRLVGGKCQEINERIGNENCSIAKCPKPSYK 515          

HSP 2 Score: 89.3521 bits (220), Expect = 2.827e-18
Identity = 80/270 (29.63%), Postives = 117/270 (43.33%), Query Frame = 1
Query:  724 CSAPIVKKGPCVNKEQINVITTFYYYNGKC-VSENRKLTVKCLGPKDCPDPYYQKTSCGSANYSFILFHNF-SRVNDLCRTETVNLKKYSCGCSKPEESVLKVVYGKECENGYKKRMLLYYEFSQFKCSETYLNLEPVKCDTLCN-GTTLVTSPCVNGKRNNTIYTKVFTNNKCSLKIVKTTESFCDTICPKSLIIESK-ECVNNIKDVFHITFQNVNGKCIKQTKKIKSNNCTKIQECPQPKFISSDCVEGKK--ILMKLSYRLVGGKC 1515
            C  P  K+  C+ K+Q     TF     KC  S  R   V C G   C +  Y+   C        L   F    N  C  + V +KK SC C+      + VV GK+C++GY  R+L   E    KC +    L  ++C   C+    LV + CV+ KR       V    KC LK+V +    C  +CP  L  E K  C+   + V  +TF+NV   C+  T +++   C   Q CP+P +    C   +K   L++++YR     C
Sbjct: 1395 CPDPKEKRSRCILKKQAIFRVTFKEVGDKCRFSVIRLSVVPCQG---CQNSTYRIEKCDKGAKETKLVRTFYQETNQTCVKKEVIVKKLSCRCTGNTTKNINVVVGKQCQSGYITRVLELTEERNDKCVKVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGKKCVLKVVNSKTVNCKNLCP--LPKEKKSRCIRGKQAVMRLTFRNVGNVCLYSTARVRLVKC---QGCPKPSYKVEKCNNNQKNTSLIRVAYRQTNSSC 1656          

HSP 3 Score: 88.9669 bits (219), Expect = 3.908e-18
Identity = 81/270 (30.00%), Postives = 116/270 (42.96%), Query Frame = 1
Query:  724 CSAPIVKKGPCVNKEQINVITTFYYYNGKC-VSENRKLTVKCLGPKDCPDPYYQKTSCGSANYSFILFHNF-SRVNDLCRTETVNLKKYSCGCSKPEESVLKVVYGKECENGYKKRMLLYYEFSQFKCSETYLNLEPVKCDTLCN-GTTLVTSPCVNGKRNNTIYTKVFTNNKCSLKIVKTTESFCDTICPKSLIIESK-ECVNNIKDVFHITFQNVNGKCIKQTKKIKSNNCTKIQECPQPKFISSDCVEGKK--ILMKLSYRLVGGKC 1515
            C  P  K+  C+ K+Q     TF     KC  S  R   V C G   C +  Y+   C        L   F    N  C  + V +KK SC C+      + VV GK+C+NGY  R+L   E    KC +    L  ++C   C+    LV + CV+ KR       V    KC LK+V +    C  +CP  L  E K  C+   + V  +TF+NV   C+  T ++      K Q CP+P +    C   +K   L++++YR     C
Sbjct:  651 CPDPKEKRSRCILKKQAIFRVTFKEVGDKCRFSVIRLSVVPCQG---CQNSTYRIEKCDKGAKETKLVRTFYQETNQTCVKKEVIVKKLSCRCTGNITKNINVVVGKQCQNGYITRVLELTEERNDKCVKVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGKKCVLKVVNSKTVNCKNLCP--LPKEKKSRCIRGKQAVMRLTFRNVGNVCLYSTARV---GLVKCQGCPKPSYKVEKCDNNQKNTSLIRVAYRQTNSSC 912          

HSP 4 Score: 83.9593 bits (206), Expect = 1.436e-16
Identity = 115/446 (25.78%), Postives = 185/446 (41.48%), Query Frame = 1
Query:  253 QIVNRLV---IGN----NLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRST-GKVIILISDGKRNGGMDPIL---VAKQLKA--LSYMLITIGLDKETDENSMIAI----SDKKNFYLIKDFDSLPKIVSTIVQKTCTGFHISK--CSAPIVKKGPCVNKEQINVITTFYYYNGKC-VSENRKLTVKCLGPKDCPDPYYQKTSCGSANYSFILFHNF-SRVNDLCRTETVNLKKYSCGCSKPEESVLKVVYGKECENGYKKRMLLYYEFSQFKCSETYLNLEPVKCDTLCN-GTTLVTSPCVNGKRNNTIYTKVFTNNKCSLKIVKTTESFCDTICPKSLIIESK-ECVNNIKDVFHITFQNVNGKCIKQTKKIKSNNCTKIQECPQPKFISSDCVEGKK--ILMKLSYRLVGGKC 1515
            Q V RL    +GN    +  RV L+     P+  + V+K NN++  N  +++  + +  +        V T +  +  R+T   V +      +NG +  ++   V K  K   +++ L +I   K  D    + +    S++++  +++      + +  IV    + F   K  C  P  K+  C+ K+Q     TF     KC  S  R   V C G   C +  Y+   C        L   F    N  C  + V +KK SC C+      + VV GK+C+NGY  R+L   E    KC +    L  ++C   C+    LV + CV+ KR       V    KC LK+V +    C   CP  L  E +  C+  I+ V  ITF  V  KC     ++   N TK Q CP+  +    C +  K   L++  ++   G C
Sbjct: 1596 QAVMRLTFRNVGNVCLYSTARVRLVKCQGCPKPSYKVEKCNNNQK-NTSLIRVAYRQTNSSCVRTQTTV-TKLPCQCYRNTETNVTVTFGRQCQNGFLSRVIELNVEKSGKCSKVAFKLRSIRCKKPCDRRRKVEVGKCKSNQRSLTVLRAVREKNRCMWKIVT---SKFVKCKKVCPDPKEKRSRCILKKQAIFRVTFKEVGDKCRFSVIRLSVVPCQG---CQNSTYRIEKCDKGAKETKLVRTFYQETNQTCVKKEVIVKKLSCRCTGNTTKNINVVVGKQCQNGYITRVLELTEERNDKCVKVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGKKCVLKVVNSKTVNCKNPCP--LPKERRTRCIKGIQGVMKITFNLVGNKCNALFVRV---NITKCQRCPRSVYRIDRCEKNAKETFLIRTFFQSANGVC 2028          

HSP 5 Score: 82.0333 bits (201), Expect = 5.204e-16
Identity = 66/233 (28.33%), Postives = 112/233 (48.07%), Query Frame = 1
Query:  724 CSAPIVKKGPCVNKEQINVITTFYYYNGKCVSENRKLTV-KCLGPKDCPDPYYQKTSC-GSANYSFILFHNFSRVNDLCRTETVNLKKYSCGCSKPEESVLKVVYGKECENGYKKRML-LYYEFSQFKCSETYLNLEPVKCDTLCNGTTLVTSPCVNGKRNNTIYTKVFTNN-KCSLKIVKTTESFCDTICPKSLIIESKECVNNIKDVFHITFQNVNGKCIKQTKKIKSNNC 1410
            C  P  ++  C+   Q  +  TF     KC +   ++ + KC   + CP   Y+   C  +A  +F++   F   N +C  + + LK   C C       + V+ G  C+NGYK R+L L  E +Q    ET+  L  +KC+  CN T  +  PC   KR   +  ++ +NN  C  K++ +T   C   CP+   I++  C+N  + +  I++Q   GKC K+ +K+++  C
Sbjct: 1953 CPLPKERRTRCIKGIQGVMKITFNLVGNKCNALFVRVNITKC---QRCPRSVYRIDRCEKNAKETFLIRTFFQSANGVCLRKELKLKTLPCKCYDNVTRNITVIIGPSCQNGYKSRVLELRVEKNQNCIKETF-KLRSIKCEGACNRTNQIVGPCFLNKRLVKVLKQIKSNNGSCHWKLLSSTFVNCSHKCPEPQ-IKTTACINGERFMVRISYQETGGKCEKREQKLQTLKC 2180          

HSP 6 Score: 82.0333 bits (201), Expect = 5.726e-16
Identity = 77/296 (26.01%), Postives = 128/296 (43.24%), Query Frame = 1
Query:  724 CSAPIVKKGPCVNKEQINVITTFYYYNGKCV-SENRKLTVKCLGPKDCPDPYYQKTSCGS--ANYSFILFHNFSRVNDLCRTETVNLKKYSCGCSKPEESVLKVVYGKECENGYKKRMLLYYEFSQFKCSETYLNLEPVKCDTLCNGTTLV-TSPCVNGKRNNTIYTKVFTNNKCSLKIVKTTESFCDTICPKSLIIESKECVNNIKDVFHITFQNVNGKCIKQTKKIK-------SNNCTKIQEC----PQPKFISS-------DCVEGKKILMKLSYRLVGGKCQEINERIGNE 1545
            C  P  KK  C+  +Q  +  TF      C+ S  R   VKC G   CP P Y+   C +   N S I    + + N  C      + K  C C +  E+ + V +G++C+NG+  R++        KCS+    L  ++C   C+    V    C + +R+ T+   V   N+C  KIV +    C  +CP      S+ C+   + +F +TF+ V  KC     ++         N+  +I++C     + K + +        CV+ + I+ KLS R  G   + IN  +G +
Sbjct: 1581 CPLPKEKKSRCIRGKQAVMRLTFRNVGNVCLYSTARVRLVKCQG---CPKPSYKVEKCNNNQKNTSLIRVA-YRQTNSSCVRTQTTVTKLPCQCYRNTETNVTVTFGRQCQNGFLSRVIELNVEKSGKCSKVAFKLRSIRCKKPCDRRRKVEVGKCKSNQRSLTVLRAVREKNRCMWKIVTSKFVKCKKVCPDPKEKRSR-CILKKQAIFRVTFKEVGDKCRFSVIRLSVVPCQGCQNSTYRIEKCDKGAKETKLVRTFYQETNQTCVKKEVIVKKLSCRCTGNTTKNINVVVGKQ 1871          

HSP 7 Score: 81.6481 bits (200), Expect = 7.830e-16
Identity = 114/446 (25.56%), Postives = 185/446 (41.48%), Query Frame = 1
Query:  253 QIVNRLV---IGN----NLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRST-GKVIILISDGKRNGGMDPIL---VAKQLKA--LSYMLITIGLDKETDENSMIAI----SDKKNFYLIKDFDSLPKIVSTIVQKTCTGFHISK--CSAPIVKKGPCVNKEQINVITTFYYYNGKC-VSENRKLTVKCLGPKDCPDPYYQKTSCGSANYSFILFHNF-SRVNDLCRTETVNLKKYSCGCSKPEESVLKVVYGKECENGYKKRMLLYYEFSQFKCSETYLNLEPVKCDTLCN-GTTLVTSPCVNGKRNNTIYTKVFTNNKCSLKIVKTTESFCDTICPKSLIIESK-ECVNNIKDVFHITFQNVNGKCIKQTKKIKSNNCTKIQECPQPKFISSDCVEGKK--ILMKLSYRLVGGKC 1515
            Q V RL    +GN    +  RV L+     P+  + V+K +N++  N  +++  + +  +        V T +  +  R+T   V +      +NG +  ++   V K  K   +++ L +I   K  D    + +    S++++  +++      + +  IV    + F   K  C  P  K+  C+ K+      TF     KC  S  R   V C G   C +  Y+   C        L   F    N  C  + V +KK SC C+      + VV GK+C+NGY  R+L   E    KC +    L  ++C   C+    LV + CV+ KR       V   NKC LK+V +    C   CP  L  E +  C+  I+ V  ITF  V  KC     ++   N TK Q C +  +    C   +K   L++++YR     C
Sbjct:  852 QAVMRLTFRNVGNVCLYSTARVGLVKCQGCPKPSYKVEKCDNNQK-NTSLIRVAYRQTNSSCVRTQTTV-TKLPCQCYRNTETNVTVTFGRQCQNGFLSRVIELNVEKSGKCSKVAFKLRSIRCRKPCDRRRKVEVGKCKSNQRSLTVLRAVREKNRCMWKIVT---SKFVKCKKVCPDPKEKRSRCILKKLAIFRVTFKEVGDKCRFSVIRLSVVPCQG---CQNSTYRIEKCDKGAKETKLVRTFYQETNQTCVKKEVIVKKLSCRCTGNITKNINVVVGKQCQNGYITRVLELTEERNDKCVKVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGNKCVLKVVNSKTVNCKNPCP--LPKERRTRCIKGIQGVMKITFNLVGNKCNALFVRV---NITKCQRCQKTSYKVEKCNNNQKNTSLIRVAYRQTNSSC 1284          

HSP 8 Score: 78.9518 bits (193), Expect = 5.196e-15
Identity = 77/296 (26.01%), Postives = 126/296 (42.57%), Query Frame = 1
Query:  724 CSAPIVKKGPCVNKEQINVITTFYYYNGKCV-SENRKLTVKCLGPKDCPDPYYQKTSC--GSANYSFILFHNFSRVNDLCRTETVNLKKYSCGCSKPEESVLKVVYGKECENGYKKRMLLYYEFSQFKCSETYLNLEPVKCDTLCNGTTLV-TSPCVNGKRNNTIYTKVFTNNKCSLKIVKTTESFCDTICPKSLIIESKECVNNIKDVFHITFQNVNGKCIKQTKKIK-------SNNCTKIQEC----PQPKFISS-------DCVEGKKILMKLSYRLVGGKCQEINERIGNE 1545
            C  P  KK  C+  +Q  +  TF      C+ S  R   VKC G   CP P Y+   C     N S I    + + N  C      + K  C C +  E+ + V +G++C+NG+  R++        KCS+    L  ++C   C+    V    C + +R+ T+   V   N+C  KIV +    C  +CP      S+ C+     +F +TF+ V  KC     ++         N+  +I++C     + K + +        CV+ + I+ KLS R  G   + IN  +G +
Sbjct:  837 CPLPKEKKSRCIRGKQAVMRLTFRNVGNVCLYSTARVGLVKCQG---CPKPSYKVEKCDNNQKNTSLIRVA-YRQTNSSCVRTQTTVTKLPCQCYRNTETNVTVTFGRQCQNGFLSRVIELNVEKSGKCSKVAFKLRSIRCRKPCDRRRKVEVGKCKSNQRSLTVLRAVREKNRCMWKIVTSKFVKCKKVCPDPKEKRSR-CILKKLAIFRVTFKEVGDKCRFSVIRLSVVPCQGCQNSTYRIEKCDKGAKETKLVRTFYQETNQTCVKKEVIVKKLSCRCTGNITKNINVVVGKQ 1127          

HSP 9 Score: 78.9518 bits (193), Expect = 5.867e-15
Identity = 71/298 (23.83%), Postives = 128/298 (42.95%), Query Frame = 1
Query:  715 ISKCSAPIVKKGPCVNKEQINVITTFYYYNGKCVSENRKLTVKCLGPKDCPDPYYQKTSCGS--ANYSFILFHNFSRVNDLCRTETVNLKKYSCGCSKPEESVLKVVYGKECENGYKKRMLLYYEFSQFKCSETYLNLEPVKCDTLCNGTTLV-TSPCVNGKRNNTIYTKVFTNNKCSLKIVKTTESFCDTICPKSLIIESKECVNNIKDVFHITFQNVNGKCIKQTKKIK-------SNNCTKIQEC----PQPKFISS-------DCVEGKKILMKLSYRLVGGKCQEINERIGNE 1545
            I +C  P      C+  ++I +  ++    GKC   N ++  +      CP P Y+   C +   N S I    + + N  C      + K  C C +  E+ + V +G++C+NG+  R++        KCS+    L  ++C   C+    V    C + +R+ T+   V   N+C  KIV +    C  +CP      S+ C+   + +F +TF+ V  KC     ++         N+  +I++C     + K + +        CV+ + I+ KLS R  G   + IN  +G +
Sbjct:  460 IQECPQPKFISSDCIEGKKILMKLSYRLVGGKCQEINERIGNENCSIAKCPKPSYKVEKCNNNQKNTSLIRVA-YRQTNSSCVRTQTTVTKLPCQCYRNTETNVTVTFGRQCQNGFLSRVIELNVEKSGKCSKVAFKLRSIRCKKPCDRRRKVEVGKCKSNQRSLTVLRAVREKNRCMWKIVTSKFVKCKKVCPDPKEKRSR-CILKKQAIFRVTFKEVGDKCRFSVIRLSVVPCQGCQNSTYRIEKCDKGAKETKLVRTFYQETNQTCVKKEVIVKKLSCRCTGNITKNINVVVGKQ 755          

HSP 10 Score: 77.411 bits (189), Expect = 1.420e-14
Identity = 82/305 (26.89%), Postives = 129/305 (42.30%), Query Frame = 1
Query:  745 KGPCVNKEQINVITTFYYYNGKCVSENRKLTV--------KCLGP----------KDCPDPYYQKTSCGSANYSFILFHNFSRVNDLCRTETVNLKKYSC-GCSKPEESVLKVVYGKECENGYKKRMLL--YYEFSQFKCSETYLNLEPVKCDTLCNGT----TLVTSPCVNGKRNNTIYTKVFTNNKCSLKIVKTTESFCDTICPKSLIIESKECVNNIKDVFHITFQNVNGKCIKQTKKIKSNNCTKIQECPQPKFISSDCVEGKKILMKLSYRLVGGKCQEINERIGNENCSIAKCPKPSYK 1584
            K PC  + ++ V        GKC S  R LTV        +C+            K CPDP  +++ C     + I    F  V D CR   + L    C GC   + S  ++   ++C+ G K+  L+  +Y+ +   C +  + ++ + C    N T     +V   C NG     +      N+KC     K     C   C + L +   +CV+N + +  +       KC+ +    K+ NC  +  CP PK   S C+ GK+ +M+L++R VG  C     R+G   C    CPKPSYK
Sbjct:  602 KKPCDRRRKVEV--------GKCKSNQRSLTVLRAVREKNRCMWKIVTSKFVKCKKVCPDPKEKRSRCILKKQA-IFRVTFKEVGDKCRFSVIRLSVVPCQGC---QNSTYRI---EKCDKGAKETKLVRTFYQETNQTCVKKEVIVKKLSCRCTGNITKNINVVVGKQCQNGYITRVLELTEERNDKCVKVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGKKCVLKVVNSKTVNCKNL--CPLPKEKKSRCIRGKQAVMRLTFRNVGNVCLYSTARVGLVKCQ--GCPKPSYK 887          

HSP 11 Score: 74.3294 bits (181), Expect = 1.431e-13
Identity = 83/307 (27.04%), Postives = 132/307 (43.00%), Query Frame = 1
Query:  745 KGPCVNKEQINVITTFYYYNGKCVSENRKLTV--------KCLGP----------KDCPDPYYQKTSCGSANYSFILFHNFSRVNDLCRTETVNLKKYSC-GCSKPEESVLKVVYGKECENGYKKRMLL--YYEFSQFKCSETYLNLEPVKCDTLCNGTTLVTSPCVNGKRNNTIY-TKVF-----TNNKCSLKIVKTTESFCDTICPKSLIIESKECVNNIKDVFHITFQNVNGKCIKQTKKIKSNNCTKIQECPQPKFISSDCVEGKKILMKLSYRLVGGKCQEINERIGNENCSIAKCPKPSYK 1584
            + PC  + ++ V        GKC S  R LTV        +C+            K CPDP  +++ C     + I    F  V D CR   + L    C GC   + S  ++   ++C+ G K+  L+  +Y+ +   C +  + ++ + C   C G T      V GK+  + Y T+V       N+KC     K     C   C + L +   +CV+N + +  +       KC+ +    K+ NC  +  CP PK   S C+ GK+ +M+L++R VG  C     R+    C    CPKPSYK
Sbjct: 1346 RKPCDRRRKVEV--------GKCKSNQRSLTVLRAVREKNRCMWKIVTSKFVKCKKVCPDPKEKRSRCILKKQA-IFRVTFKEVGDKCRFSVIRLSVVPCQGC---QNSTYRI---EKCDKGAKETKLVRTFYQETNQTCVKKEVIVKKLSCR--CTGNTTKNINVVVGKQCQSGYITRVLELTEERNDKCVKVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGKKCVLKVVNSKTVNCKNL--CPLPKEKKSRCIRGKQAVMRLTFRNVGNVCLYSTARVRLVKCQ--GCPKPSYK 1631          

HSP 12 Score: 70.8626 bits (172), Expect = 1.592e-12
Identity = 80/297 (26.94%), Postives = 126/297 (42.42%), Query Frame = 1
Query:  721 KCSAPIVKKGPCVNKEQINVITTFYYYNGKCVSENRKL-TVKCLGPKDCPDPYYQKTSCGSANYSFILFHNFSRVNDLCRTETVN-------LKKYSCGCSKPEESVLKVVYGKECENGYKKRMLLYYEFSQFKCSETYLNLEPVKCDTLCNGTTLVTSPCVNGKRNNTIYTKVFTNNKCSLKIVKTTESFCDTICPKSLIIESKECVNNIKDVFHITFQNVNGKC------IKQTK---KIKSNNCTKIQECPQPKFISSDCVEGKK--ILMKLSYRLVGGKCQEINERIGNENCS 1554
            KC  P +K   C+N E+  V  ++    GKC    +KL T+KC            +T    + Y  +     S+ ++L RT   N       L    C C       L V     C NG + + L +Y     KC    L+++  KC  L  G+T   S CVNG R    +T+  + ++C  K+V + +  C +ICP + ++ S +C+   K      F+    +C       K TK    I   NC+KI+     +   S+C +GK   I  K + + V G C   + +I   NC+
Sbjct: 2138 KCPEPQIKTTACINGERFMVRISYQETGGKCEKREQKLQTLKC------------QTCFRKSVYELMECSKTSKTSELVRTSHRNCTRKVEKLLDVDCLCEGLNNYGLNVTSTANCTNGVRVKTLSFYTTVNGKCQVKSLSIKGGKCGCL--GSTFNLSVCVNGNRILEKFTRYQSGSQCLSKLVFSRKIRCRSICPTNSVVLSSKCLKKRKLRVISLFEKSYNQCKLVKFSFKWTKCIIPISGKNCSKIK-----RLTMSNCQKGKAYIIFTKSAEKPVNGTCGLNSSKIAQVNCT 2415          

HSP 13 Score: 67.781 bits (164), Expect = 1.446e-11
Identity = 77/305 (25.25%), Postives = 128/305 (41.97%), Query Frame = 1
Query:  745 KGPCVNKEQINVITTFYYYNGKCVSENRKLTV--------KCLGP----------KDCPDPYYQKTSCGSANYSFILFHNFSRVNDLCRTETVNLKKYSC-GCSKPEESVLKVVYGKECENGYKKRMLL--YYEFSQFKCSETYLNLEPVKCDTLCNGT----TLVTSPCVNGKRNNTIYTKVFTNNKCSLKIVKTTESFCDTICPKSLIIESKECVNNIKDVFHITFQNVNGKCIKQTKKIKSNNCTKIQECPQPKFISSDCVEGKKILMKLSYRLVGGKCQEINERIGNENCSIAKCPKPSYK 1584
            + PC  + ++ V        GKC S  R LTV        +C+            K CPDP  +++ C     + I    F  V D CR   + L    C GC   + S  ++   ++C+ G K+  L+  +Y+ +   C +  + ++ + C    N T     +V   C NG     +      N+KC     K     C   C + L +   +CV+N + +  +       KC+ +    K+ NC     CP PK   + C++G + +MK+++ LVG KC  +  R+    C   +C K SYK
Sbjct:  974 RKPCDRRRKVEV--------GKCKSNQRSLTVLRAVREKNRCMWKIVTSKFVKCKKVCPDPKEKRSRCILKKLA-IFRVTFKEVGDKCRFSVIRLSVVPCQGC---QNSTYRI---EKCDKGAKETKLVRTFYQETNQTCVKKEVIVKKLSCRCTGNITKNINVVVGKQCQNGYITRVLELTEERNDKCVKVAFKLRRIRCQRPCSRKLKLVVNKCVSNKRLIQRMKSVKEGNKCVLKVVNSKTVNCK--NPCPLPKERRTRCIKGIQGVMKITFNLVGNKCNALFVRVNITKCQ--RCQKTSYK 1259          

HSP 14 Score: 66.2402 bits (160), Expect = 5.211e-11
Identity = 70/296 (23.65%), Postives = 126/296 (42.57%), Query Frame = 1
Query:  724 CSAPIVKKGPCVNKEQINVITTFYYYNGKCVSENRKLTV-KCLGPKDCPDPYYQKTSCGS--ANYSFILFHNFSRVNDLCRTETVNLKKYSCGCSKPEESVLKVVYGKECENGYKKRMLLYYEFSQFKCSETYLNLEPVKCDTLCNGTTLV-TSPCVNGKRNNTIYTKVFTNNKCSLKIVKTTESFCDTICPKSLIIESKECVNNIKDVFHITFQNVNGKCIKQTKKIK-------SNNCTKIQEC----PQPKFISS-------DCVEGKKILMKLSYRLVGGKCQEINERIGNE 1545
            C  P  ++  C+   Q  +  TF     KC +   ++ + KC   + C    Y+   C +   N S I    + + N  C      + K  C C +  E+ + V +G++C+NG+  R++        KCS+    L  ++C   C+    V    C + +R+ T+   V   N+C  KIV +    C  +CP      S+ C+   + +F +TF+ V  KC     ++         N+  +I++C     + K + +        CV+ + I+ KLS R  G   + IN  +G +
Sbjct: 1209 CPLPKERRTRCIKGIQGVMKITFNLVGNKCNALFVRVNITKC---QRCQKTSYKVEKCNNNQKNTSLIRVA-YRQTNSSCVRTQTTVTKLPCQCYRNTETNVTVTFGRQCQNGFLSRVIELNVEKSGKCSKVAFKLRSIRCRKPCDRRRKVEVGKCKSNQRSLTVLRAVREKNRCMWKIVTSKFVKCKKVCPDPKEKRSR-CILKKQAIFRVTFKEVGDKCRFSVIRLSVVPCQGCQNSTYRIEKCDKGAKETKLVRTFYQETNQTCVKKEVIVKKLSCRCTGNTTKNINVVVGKQ 1499          
BLAST of Collagen alpha-1(XXVIII) chain vs. Planmine SMEST
Match: SMESG000043380.1 (SMESG000043380.1)

HSP 1 Score: 119.013 bits (297), Expect = 3.349e-28
Identity = 71/211 (33.65%), Postives = 120/211 (56.87%), Query Frame = 1
Query:   85 IIKCENFENSLEFQILKELTQEDKK----CIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAISDKKNFYLIKDFDSLPKI-VSTIVQKTC 702
            I K  NF+ S   +I + + Q  KK    CI    +V+F+LD S+S+GP+N+  +  F ++IV  + +G + TRV  + +NS   + F++DKY    +V + I    F+EG T +GDALN+    +++  R +T  V+IL++DG+ N G  P   A +++     +I IG+  E  ++ +I IS    +Y I DFDSL  + V  + +++C
Sbjct:  377 IFKDFNFQVSFVNEIAENICQNLKKVYVECIAKKLDVVFVLDCSSSIGPENWMNQLQFVSRIVQMMDVGKDSTRVGSVYFNSEAYVGFSLDKYGTKDEVIKAIRNLPFSEGGTAIGDALNLAHDQMKASLRNNTVPVMILVTDGQSNMGRKPESEALEIRNDGVHIICIGITNEISKDQLIRISTSNRYYHINDFDSLNSVSVEAMTKESC 587          

HSP 2 Score: 80.1073 bits (196), Expect = 1.181e-15
Identity = 50/181 (27.62%), Postives = 91/181 (50.28%), Query Frame = 1
Query:  160 CIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAISDKKNFYLIKDFDSLPKIVSTIVQKTC 702
            C K   E+  +LD S+S+ PD+F   K F   ++   V+G + +R  +I+++   +L+F +  +   ++  + I+ A+F  G T +G A+ +  T I  ++R    KVI+LI+DGK N   +   + K  K     +I IG+  E     +  I+    +Y +  + SL  +V T+    C
Sbjct:   31 CSKNRIEMAIVLDASSSIEPDHFKLAKQFIVDVIGDFVVGPDHSRFGMISFSDDAELLFTLTTHKTIEETKKAILDAKFLTGATAMGKAIQLAGTGILQESRTGIPKVILLITDGKNNKFPNAAQMGKLQKEAGVTIIGIGIGSEISPQELTEIASPGLYYQLDTYPSLIGLVKTLKTSFC 211          
BLAST of Collagen alpha-1(XXVIII) chain vs. Planmine SMEST
Match: SMESG000046768.1 (SMESG000046768.1)

HSP 1 Score: 90.8929 bits (224), Expect = 7.688e-19
Identity = 55/182 (30.22%), Postives = 99/182 (54.40%), Query Frame = 1
Query:  151 DKKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAISDKKNFYLIKDFDSLPKIVSTIVQK 696
            +K+C     +++F LD S+S+GPD +  E DF  +IV  + I  N T+V ++T+N+  +  F +D++     +   + +  F +G T +G+AL     ++ + TR+   KVI+L++DG   GG+ P L +  +K L   +I IG+   T  + +  +S    FY I DF +L    +T + +
Sbjct: 1249 NKECSTKQLDLMFALDSSSSIGPDYWQTELDFVERIVRDMDINANFTKVGVVTFNTDARKEFGLDQFTEKYAMISAVKRIIFDDGATDIGEALRECKNELLNSTRKEVPKVIVLVTDGVSTGGLSPELESTLIKKLGIKIIVIGIGDSTSPSQLKILSSSGTFYRILDFKTLKDYDTTFITR 1430          

HSP 2 Score: 90.8929 bits (224), Expect = 9.243e-19
Identity = 58/187 (31.02%), Postives = 94/187 (50.27%), Query Frame = 1
Query:  145 QEDKKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAISDKKNFYLIKDFDSLPKI-VSTIVQKTC 702
            Q   +C     +VI  +D STS+GP+NF  E DF  +IV  L +  + TR+ + T+NS   L   +D    + D+ +EI K  F EG T +G A+      + +K R    KV+++++DG  + G  P + A + K     +I++G+ ++  E  +  I+    FY +K F  L K    TI    C
Sbjct:  870 QRQDECTMKKLDVIVTIDKSTSLGPENFQIELDFVNRIVQNLDLRKDRTRIGIFTFNSEVYLNVPIDSNFENADMQKEINKIPFIEGNTAIGWAIGNATDYLFTKGREDVPKVLVVLTDGANDIGESPQISAVKAKLGGIKIISVGVGQQISEKELNDIASSGEFYNVKTFTDLEKFNAKTISNDAC 1056          

HSP 3 Score: 56.9954 bits (136), Expect = 3.666e-8
Identity = 51/203 (25.12%), Postives = 94/203 (46.31%), Query Frame = 1
Query:   67 CLIFVAIIKCENFENSLEFQILKELTQEDKKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEG-ITVVGDALNMVLTDIESKTRRST--GKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAISDKKNFYLIKDFDSL 666
            CLI VA   C NFE  L           D++CI    ++  ILD S+S+    F        Q ++  +I  N TRV+ + Y    +  F   K+ +S  +N  +       G  +V+G ALN  L DI  + R ++   ++++++SDG     +    +A +++     + T+ +    +   +++IS KKN  +  +F ++
Sbjct:    7 CLIVVA---CINFEVILAL---------DQRCIGKPRDIAVILDSSSSITNGEFQSSLIAINQFLSFFLIMPNNTRVSFMGYGDTLKTEFLFTKHTSSPTLNFAVRLHRKVGGDSSVLGRALNSTLYDIVPEMRPTSEIDRILLILSDGSNTDELSVKDLATKIQEKGVTIYTVAIGSNLNIPLLLSISSKKNVVMFPEFQTM 197          

HSP 4 Score: 49.2914 bits (116), Expect = 7.723e-6
Identity = 45/181 (24.86%), Postives = 84/181 (46.41%), Query Frame = 1
Query:  166 KTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQL--VFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAISDKKNFYLIKDFDSLPKIVSTIVQKTC 702
            K AG++IF++  S +   + F +  DF   +    V+    TRVA++ +N    +   F  D Y N +    ++  +  T G+  +G AL       +S TR++  K +I+I DG+     +    A  LK     + TIGL  +T E+ + +++       + +F +L +  + I  + C
Sbjct: 1066 KAAGDLIFVMGSSANKTSERFKQMSDFMKSLTKLTVVDKENTRVAILKFNRGNYIDSGFKED-YKNFESSIEDMTTS--TNGV-FIGKALTSARVLFKSDTRKNATKTVIIIIDGEITDRNETFEEANLLKKDGIKVFTIGLTGKTSESDLKSVASPDKALFVDNFSNLQRYNAYISSELC 1242          
BLAST of Collagen alpha-1(XXVIII) chain vs. Planmine SMEST
Match: SMESG000024982.1 (SMESG000024982.1)

HSP 1 Score: 77.0258 bits (188), Expect = 8.015e-15
Identity = 54/212 (25.47%), Postives = 98/212 (46.23%), Query Frame = 1
Query:  136 ELTQEDKKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAISDKKNFYLIKDFDSLPKIVSTIVQKTCTGFHISKCSAPIVKKGPCVNKEQ 771
            ++T     C     +V+FILDGS S+  D+F   K F   ++  +   N   R+A I +    ++VF    Y   K++  ++         T +G ALN+ L ++    R+   K+++L +DG  N    P + A +LK  +  ++TIG+  + + N +  ++       ++ F  L K  S +V       HI     P ++K PC  ++Q
Sbjct:   27 QITSLTAACTFIIRDVLFILDGSQSISKDDFELAKKFTKDMMTIIKNSNTENRIAFIKFGDDAEIVFEFQTYTKLKEMLLDVTNTRNLYSSTGIGKALNLTLKEVYPTMRKEVEKLVVLFTDGTNNMYPAPYVYADKLKEANVQILTIGIGSDININELTRLASPGLSLQVESFTGLLKTQSQVVS------HICPIPDPGLEK-PCTLEQQ 231          

HSP 2 Score: 60.4622 bits (145), Expect = 1.456e-9
Identity = 43/186 (23.12%), Postives = 91/186 (48.92%), Query Frame = 1
Query:  151 DKKCIKTAGEVIFILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFNVDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVIILISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAISDKKNFYLIKDFDSLPKIVSTIVQKTCTG 708
            +K C     +++ ILD S S+  +++ + K+F  + ++   +G    RVA+++++   +  F    Y  S D+  ++       G T +G AL  V + + S+ R +    I++I+DG  N    P+  A +LK     +I++G+ +E +   +  IS +     ++ +  L K + T+++    G
Sbjct:  223 EKPCTLEQQDLVVILDSSNSISEEDYEQGKNFLVKFLSNFELGPEKNRVAMLSFSDEIRFDFGFTDYYKSDDMINKVKSLIKFGGATGIGKALREVDSKLISQQRPNVPFNILIITDGVNNMFPRPLEYANRLKMKGANIISLGIGEEINLKELKMISSEDKILTVETYGDLKKSLKTVMKTVICG 408          
The following BLAST results are available for this feature:
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VIT2.331e-1827.42vitrin [Source:HGNC Symbol;Acc:HGNC:12697][more]
VIT1.019e-1727.27vitrin [Source:HGNC Symbol;Acc:HGNC:12697][more]
VIT1.102e-1727.42vitrin [Source:HGNC Symbol;Acc:HGNC:12697][more]
VIT1.205e-1727.42vitrin [Source:HGNC Symbol;Acc:HGNC:12697][more]
VIT1.254e-1727.27vitrin [Source:HGNC Symbol;Acc:HGNC:12697][more]
back to top
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cut-63.304e-1535.71CUTiclin [Source:UniProtKB/TrEMBL;Acc:Q21540][more]
cut-63.304e-1535.71CUTiclin [Source:UniProtKB/TrEMBL;Acc:Q21540][more]
mua-37.209e-1225.60Transmembrane cell adhesion receptor mua-3 [Sourc... [more]
mua-39.445e-1225.60Transmembrane cell adhesion receptor mua-3 [Sourc... [more]
F31F7.21.258e-1033.33pep chromosome:WBcel235:V:6272671:6274911:1 gene:W... [more]
back to top
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
col28a2b4.221e-2030.93collagen, type XXVIII, alpha 2b [Source:ZFIN;Acc:Z... [more]
col28a2a4.824e-1726.80collagen, type XXVIII, alpha 2a [Source:ZFIN;Acc:Z... [more]
col28a2a6.132e-1726.80collagen, type XXVIII, alpha 2a [Source:ZFIN;Acc:Z... [more]
CR352283.13.432e-1627.23von Willebrand factor A domain containing 2 [Sourc... [more]
vwa23.442e-1627.23von Willebrand factor A domain containing 2 [Sourc... [more]
back to top
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VWA28.430e-2026.55von Willebrand factor A domain containing 2 [Sourc... [more]
VWA28.439e-2026.55von Willebrand factor A domain containing 2 [Sourc... [more]
VWA29.309e-2026.55von Willebrand factor A domain containing 2 [Sourc... [more]
VWA21.061e-1926.55von Willebrand factor A domain containing 2 [Sourc... [more]
ENSXETT00000017138.11.523e-1927.57pep primary_assembly:Xenopus_tropicalis_v9.1:5:884... [more]
back to top
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Vit1.624e-1829.79vitrin [Source:MGI Symbol;Acc:MGI:1921449][more]
Vit1.648e-1829.79vitrin [Source:MGI Symbol;Acc:MGI:1921449][more]
Col6a43.864e-1827.32collagen, type VI, alpha 4 [Source:MGI Symbol;Acc:... [more]
Col14a11.297e-1728.08collagen, type XIV, alpha 1 [Source:MGI Symbol;Acc... [more]
Col14a11.297e-1728.08collagen, type XIV, alpha 1 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Collagen alpha-1(XXVIII) chain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6DCQ6|VWA2_XENLA6.368e-2026.67von Willebrand factor A domain-containing protein ... [more]
sp|Q8VHI5|VITRN_MOUSE1.136e-1729.79Vitrin OS=Mus musculus OX=10090 GN=Vit PE=1 SV=2[more]
sp|A2AX52|CO6A4_MOUSE2.703e-1727.32Collagen alpha-4(VI) chain OS=Mus musculus OX=1009... [more]
sp|Q6UXI7|VITRN_HUMAN6.022e-1727.27Vitrin OS=Homo sapiens OX=9606 GN=VIT PE=2 SV=1[more]
sp|Q80X19|COEA1_MOUSE9.073e-1728.08Collagen alpha-1(XIV) chain OS=Mus musculus OX=100... [more]
back to top
BLAST of Collagen alpha-1(XXVIII) chain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267H7R91.486e-2823.54Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FE729.029e-2724.55Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8JHM68.479e-2623.92Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8JI621.024e-2523.71VWFA domain-containing protein OS=Macrostomum lign... [more]
A0A1I8JH981.135e-2523.92Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
col28a2a3.273e-2130.93collagen alpha-1(XXVIII) chain-like [Source:NCBI g... [more]
col28a2b2.964e-2029.90collagen, type XXVIII, alpha 2b [Source:ZFIN;Acc:Z... [more]
col12a1b8.261e-1728.65collagen, type XII, alpha 1b [Source:ZFIN;Acc:ZDB-... [more]
col12a1a7.697e-1626.63collagen, type XII, alpha 1a [Source:ZFIN;Acc:ZDB-... [more]
si:ch211-62a1.31.922e-1524.61si:ch211-62a1.3 [Source:ZFIN;Acc:ZDB-GENE-061207-4... [more]
back to top
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009635.18.708e-1827.04pep scaffold:Pmarinus_7.0:GL479939:22902:31906:-1 ... [more]
ENSPMAT00000009632.14.296e-1726.42pep scaffold:Pmarinus_7.0:GL479939:9900:31909:-1 g... [more]
ENSPMAT00000004974.14.958e-1726.60pep scaffold:Pmarinus_7.0:GL476356:523666:534068:1... [more]
ENSPMAT00000009633.14.106e-1627.27pep scaffold:Pmarinus_7.0:GL479939:15464:32536:-1 ... [more]
col21a12.585e-1526.74collagen, type XXI, alpha 1 [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO500791.844e-2229.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO263842.963e-1930.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406885.906e-1832.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453782.284e-1726.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO324257.548e-1729.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Collagen alpha-1(XXVIII) chain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
col28a2a6.188e-2029.27collagen alpha-1(XXVIII) chain [Source:NCBI gene;A... [more]
ENSORLT00000044137.17.841e-2027.80pep primary_assembly:ASM223467v1:2:16334979:163763... [more]
ENSORLT00000045235.12.274e-1829.03pep primary_assembly:ASM223467v1:2:16334729:163726... [more]
col28a2a4.839e-1830.10collagen alpha-1(XXVIII) chain [Source:NCBI gene;A... [more]
matn13.456e-1728.98matrilin 1, cartilage matrix protein [Source:NCBI ... [more]
back to top
BLAST of Collagen alpha-1(XXVIII) chain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033673.12.843e-1899.42SMESG000033673.1[more]
SMESG000033673.12.827e-1899.42SMESG000033673.1[more]
SMESG000043380.13.349e-2833.65SMESG000043380.1[more]
SMESG000046768.17.688e-1930.22SMESG000046768.1[more]
SMESG000024982.18.015e-1525.47SMESG000024982.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029471 ID=SMED30029471|Name=Collagen alpha-1(XXVIII) chain|organism=Schmidtea mediterranea sexual|type=transcript|length=1586bp
ATTTTCATTCAGAAATTGATGCAATTCTAATTTTTCGTTATGAAAATTGA
ATTCATTTTATCAGTTTGCTTGATTTTTGTTGCGATAATAAAATGTGAAA
ACTTTGAGAATTCACTCGAATTTCAGATTCTGAAAGAACTTACCCAAGAA
GATAAAAAATGCATTAAAACTGCAGGGGAAGTGATTTTTATTCTTGACGG
GTCGACGTCAGTTGGTCCAGATAATTTCAATAAAGAAAAAGATTTTGCAA
CACAAATCGTGAACAGATTAGTTATCGGAAACAATTTAACTCGGGTGGCT
TTGATAACTTACAACAGCGTACCCCAGTTGGTTTTCAATGTTGACAAATA
CAACAATAGCAAAGATGTAAACCGAGAAATAATGAAGGCAGAATTTACGG
AAGGAATCACAGTCGTTGGAGATGCCTTAAATATGGTTTTAACCGACATT
GAATCTAAAACGAGAAGATCCACCGGTAAAGTCATCATTTTAATATCGGA
TGGAAAGCGAAACGGAGGAATGGATCCGATTCTCGTGGCCAAACAACTGA
AAGCACTGTCGTACATGCTTATAACAATCGGCCTGGACAAAGAAACAGAC
GAAAATTCCATGATTGCTATTTCAGACAAGAAGAATTTTTATTTGATAAA
AGATTTCGATTCTTTGCCGAAAATCGTTTCCACAATCGTTCAGAAAACCT
GCACAGGTTTCCACATTTCGAAATGCTCCGCACCAATCGTTAAAAAAGGC
CCATGCGTAAACAAAGAACAAATTAATGTCATAACGACTTTTTATTACTA
CAATGGAAAATGCGTGTCCGAAAATAGAAAATTGACAGTGAAATGCCTCG
GCCCTAAAGACTGTCCTGATCCATATTATCAAAAAACCTCTTGTGGATCG
GCGAATTATTCGTTTATTTTGTTCCATAATTTCTCAAGAGTGAACGACTT
GTGCCGTACGGAAACCGTTAACCTCAAAAAATACAGTTGTGGCTGTTCGA
AACCTGAAGAGAGTGTTTTAAAAGTAGTTTATGGGAAAGAATGTGAAAAT
GGATATAAAAAACGAATGCTTCTCTACTACGAATTCAGTCAATTCAAATG
CTCAGAGACCTATTTGAATCTAGAACCAGTAAAATGTGATACCCTGTGCA
ACGGAACGACTTTAGTCACGAGTCCATGCGTAAATGGCAAACGAAACAAC
ACGATTTATACGAAAGTATTCACCAACAACAAATGCTCATTGAAAATCGT
CAAAACGACCGAATCATTCTGTGACACGATTTGTCCAAAATCACTAATAA
TTGAATCGAAAGAATGCGTAAACAATATTAAAGACGTTTTCCACATAACA
TTTCAAAATGTCAACGGAAAATGCATCAAACAAACAAAGAAAATCAAATC
AAACAACTGTACCAAAATTCAAGAGTGCCCACAGCCGAAGTTCATTTCTT
CAGATTGTGTTGAAGGGAAAAAGATTTTGATGAAGCTCTCATACAGATTG
GTCGGTGGAAAGTGCCAAGAAATAAACGAAAGAATTGGAAACGAAAATTG
TAGCATTGCAAAATGTCCAAAGCCTTCATACAAAGT
back to top

protein sequence of SMED30029471-orf-1

>SMED30029471-orf-1 ID=SMED30029471-orf-1|Name=SMED30029471-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=515bp
MKIEFILSVCLIFVAIIKCENFENSLEFQILKELTQEDKKCIKTAGEVIF
ILDGSTSVGPDNFNKEKDFATQIVNRLVIGNNLTRVALITYNSVPQLVFN
VDKYNNSKDVNREIMKAEFTEGITVVGDALNMVLTDIESKTRRSTGKVII
LISDGKRNGGMDPILVAKQLKALSYMLITIGLDKETDENSMIAISDKKNF
YLIKDFDSLPKIVSTIVQKTCTGFHISKCSAPIVKKGPCVNKEQINVITT
FYYYNGKCVSENRKLTVKCLGPKDCPDPYYQKTSCGSANYSFILFHNFSR
VNDLCRTETVNLKKYSCGCSKPEESVLKVVYGKECENGYKKRMLLYYEFS
QFKCSETYLNLEPVKCDTLCNGTTLVTSPCVNGKRNNTIYTKVFTNNKCS
LKIVKTTESFCDTICPKSLIIESKECVNNIKDVFHITFQNVNGKCIKQTK
KIKSNNCTKIQECPQPKFISSDCVEGKKILMKLSYRLVGGKCQEINERIG
NENCSIAKCPKPSYK
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004867serine-type endopeptidase inhibitor activity
GO:0003674molecular_function
Vocabulary: biological process
TermDefinition
GO:0010951negative regulation of endopeptidase activity
GO:0007155cell adhesion
GO:0070208protein heterotrimerization
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000110pharynx progenitor cell
PLANA:0000418head
PLANA:0000420parapharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR036465vWFA_dom_sf
IPR002035VWF_A
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005578proteinaceous extracellular matrix
GO:0005581collagen trimer
GO:0043234protein complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00453VWFADOMAINcoord: 46..63
score: 41.03
coord: 85..99
score: 28.33
coord: 148..156
score: 41.67
NoneNo IPR availablePANTHERPTHR24020:SF32coord: 32..158
NoneNo IPR availablePANTHERPTHR24020FAMILY NOT NAMEDcoord: 140..290
NoneNo IPR availablePANTHERPTHR24020:SF32coord: 140..290
NoneNo IPR availablePANTHERPTHR24020FAMILY NOT NAMEDcoord: 32..158
NoneNo IPR availableCDDcd01450vWFA_subfamily_ECMcoord: 48..193
e-value: 1.87922E-35
score: 127.793
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.706
IPR002035von Willebrand factor, type ASMARTSM00327VWA_4coord: 45..221
e-value: 4.9E-29
score: 112.5
IPR002035von Willebrand factor, type APFAMPF00092VWAcoord: 48..214
e-value: 1.8E-32
score: 113.0
IPR002035von Willebrand factor, type APROSITEPS50234VWFAcoord: 47..216
score: 25.556
IPR036465von Willebrand factor A-like domain superfamilyGENE3DG3DSA:3.40.50.410coord: 32..227
e-value: 5.2E-42
score: 145.9
IPR036465von Willebrand factor A-like domain superfamilySUPERFAMILYSSF53300vWA-likecoord: 38..222