Outer dense fiber protein 3

Overview
NameOuter dense fiber protein 3
Smed IDSMED30029463
Uniprot Best hitOuter dense fiber protein 3 OS=Xenopus laevis OX=8355 GN=odf3 PE=2 SV=1 (E=1.2513e-55)
Length (bp)1012
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Outer dense fiber protein 3 (SMED30029463) t-SNE clustered cells

Violin plots show distribution of expression levels for Outer dense fiber protein 3 (SMED30029463) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Outer dense fiber protein 3 (SMED30029463) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Outer dense fiber protein 3 (SMED30029463) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029463

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30029463SMESG000019620.1 SmedASXL_004684SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30029463SMESG000019620.1 dd_Smed_v4_8903_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30029463SMESG000019620.1 dd_Smed_v4_8903_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30029463SMESG000019620.1 dd_Smed_v6_8903_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30029463SMESG000019620.1 DN291109ncbi_smed_estsPMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30029463SMESG000019620.1 DN291109ncbi_smed_estsPMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30029463SMESG000019620.1 dd_Smed_v4_8903_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30029463SMESG000019620.1 dd_Smed_v4_8903_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Outer dense fiber protein 3 vs. Ensembl Human
Match: ODF3 (outer dense fiber of sperm tails 3 [Source:HGNC Symbol;Acc:HGNC:19905])

HSP 1 Score: 145.206 bits (365), Expect = 6.796e-41
Identity = 96/245 (39.18%), Postives = 129/245 (52.65%), Query Frame = 1
Query:   91 RGPIGAEYTSPGPIYPLPSLLGRQNHDPRSSFKRAPAWALGDRYGKLRDDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLENDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPP----NRDNGPAFSFGSHHSQYRGHLIVNDDVE 813
            RGPI A Y+SPGP Y +P   G   H P     RAPA++       L ++  PGP Y V   +LRTG     ++S+  R    +   TP PG Y  E S   ++ S+P++S   +      D TPGP  Y+L PM+       K S PS+S+  R+K+GGFS+DL KTPGP AY   D    K K P  T+++R   PGD ++KPGPG + P      +   P  +FG  HS Y   L+V  DVE
Sbjct:   16 RGPIMALYSSPGPKYLIPPTTGFMKHTPTKL--RAPAYSFRGAPMLLAENCSPGPRYNVNPKILRTGKDLGPAYSILGR-YQTKTMLTPGPGDYFPEKSTKYVFDSAPSHSISARTKAFRVDSTPGPAAYML-PMVMGPNTVGKASQPSFSIKGRSKLGGFSDDLHKTPGPAAYRQTDVRVTKFKAPQYTMAARVEPPGDKTLKPGPGAHSPEKVTLTKPCAPVVTFGIKHSDYMTPLLV--DVE 254          
BLAST of Outer dense fiber protein 3 vs. Ensembl Human
Match: ODF3B (outer dense fiber of sperm tails 3B [Source:HGNC Symbol;Acc:HGNC:34388])

HSP 1 Score: 137.887 bits (346), Expect = 3.602e-38
Identity = 91/240 (37.92%), Postives = 120/240 (50.00%), Query Frame = 1
Query:   91 RGPIGAEYTSPGPIYPLPSLLGRQNHDPRSSFKRAPAWALGDRYGKLRDDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLENDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSG-KTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPPNRDNGPAFSFGSHHSQYRGHLIVNDD 807
            RGPI A Y  PGP Y LP   G   HDP  S  RAPA+  G R+   +   GPGP + V + +   G   + ++S++ RP       TP PGRY  E + N  Y S+P ++   +  G +    +PGP  Y +  +L       K SAP+ S+  R   G F EDL+KTPGP AY V     YK + P  TI +R  LP DN+ KPGP  Y          +SFG  HS Y   L+ + D
Sbjct:   16 RGPIAAHYGGPGPKYKLPPNTGYALHDP--SRPRAPAFTFGARFPTQQTTCGPGPGHLVPARMTVRGTDGAPAYSIYGRPRRSAPFLTPGPGRYFPERAGNATYPSAPRHTIAPRNWGVQAEQQSPGPAAYTVPSLLGPRVIG-KVSAPTCSIYGRRAAGSFFEDLSKTPGPCAYQVVSPGVYKSRAPQFTILARTSLPQDNTRKPGPAAYNVDQHRKPRGWSFGIRHSDYLAPLVTDAD 252          
BLAST of Outer dense fiber protein 3 vs. Ensembl Human
Match: ODF3B (outer dense fiber of sperm tails 3B [Source:HGNC Symbol;Acc:HGNC:34388])

HSP 1 Score: 137.887 bits (346), Expect = 3.602e-38
Identity = 91/240 (37.92%), Postives = 120/240 (50.00%), Query Frame = 1
Query:   91 RGPIGAEYTSPGPIYPLPSLLGRQNHDPRSSFKRAPAWALGDRYGKLRDDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLENDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSG-KTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPPNRDNGPAFSFGSHHSQYRGHLIVNDD 807
            RGPI A Y  PGP Y LP   G   HDP  S  RAPA+  G R+   +   GPGP + V + +   G   + ++S++ RP       TP PGRY  E + N  Y S+P ++   +  G +    +PGP  Y +  +L       K SAP+ S+  R   G F EDL+KTPGP AY V     YK + P  TI +R  LP DN+ KPGP  Y          +SFG  HS Y   L+ + D
Sbjct:   16 RGPIAAHYGGPGPKYKLPPNTGYALHDP--SRPRAPAFTFGARFPTQQTTCGPGPGHLVPARMTVRGTDGAPAYSIYGRPRRSAPFLTPGPGRYFPERAGNATYPSAPRHTIAPRNWGVQAEQQSPGPAAYTVPSLLGPRVIG-KVSAPTCSIYGRRAAGSFFEDLSKTPGPCAYQVVSPGVYKSRAPQFTILARTSLPQDNTRKPGPAAYNVDQHRKPRGWSFGIRHSDYLAPLVTDAD 252          
BLAST of Outer dense fiber protein 3 vs. Ensembl Human
Match: ODF3L2 (outer dense fiber of sperm tails 3 like 2 [Source:HGNC Symbol;Acc:HGNC:26841])

HSP 1 Score: 106.686 bits (265), Expect = 3.687e-26
Identity = 75/223 (33.63%), Postives = 117/223 (52.47%), Query Frame = 1
Query:  130 IYPLPSLLGRQNHDPRSSFKRAPAWALGDRYGKLR-DDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLENDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSGKTTDVT-PGPNVYLLDPML-SKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPP----NRDNGPAFSFGSHHSQ 777
            +Y LPS +G  NHD   +   +PA++L  R  +    D+ PGP Y ++  + R G + + ++S+  R      + TP PG Y+ E      +++ PA++ G +   K  D + P PN Y + P+  S+ F   KPS+PSY+++ R       +D  + PGPG Y  PD +TY+++LPA T+  R   P      PGPG + P     N+   PAFS G  HS+
Sbjct:   48 LYVLPSTVGFINHD--CTRVASPAYSLVRRPSEAPPQDTSPGPIYFLDPKVTRFGRSCTPAYSMQGRAKSRGPEVTPGPGAYSPEKVPPVRHRTPPAFTLGCRLPLKPLDTSAPAPNAYTMPPLWGSQIF--TKPSSPSYTVVGRTPPARPPQDPAEIPGPGQYDSPDANTYRQRLPAFTMLGRPRAPRPLEETPGPGAHCPEQVTVNKARAPAFSMGIRHSK 266          
BLAST of Outer dense fiber protein 3 vs. Ensembl Human
Match: ODF3L1 (outer dense fiber of sperm tails 3 like 1 [Source:HGNC Symbol;Acc:HGNC:28735])

HSP 1 Score: 99.3673 bits (246), Expect = 1.761e-23
Identity = 76/254 (29.92%), Postives = 125/254 (49.21%), Query Frame = 1
Query:   73 ITMTKRRGPIGAEYTSPGPIYPLPSLLGRQNHDPRSSFKRAPAWALGDRYGKLR--DDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLENDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTY----YPPNRDNGPAFSFGSHHSQYRGHLIVNDDVED 816
            + M K +GP  A+Y  P       S  G  +HD   S  +APA+ L  R+ + R    S PGP Y ++  + R G ++     +  R + L  + T    +Y +E       + +P Y+FG +R  +  D+ P PN Y + P+L         +AP YSL SR+K   + ED+   PGP  Y+ P+ S Y+ + P  +++ R   P D + +PGPG++       ++ + PAF+ G  HS +   L++  D+ D
Sbjct:   33 VIMAKIKGPGPAKYLRP-------SCTGYIDHD--ISMFKAPAYTLHSRHSEKRMVCHSSPGPCYLLDPKITRFGMSSCPQVPMEERISNLRLNPTLASCQYYFEKIHPPGERRAPQYTFGYRRPYRVMDLNPAPNQYQM-PLLLGPNTPVSRAAPCYSLASRDKNWFYKEDVAGGPGPTTYARPEPSIYQNRSPTYSMAKRFAYPLDLTPRPGPGSHEVQQVTVHKPHIPAFTMGIKHSLHLCPLVI--DIRD 274          
BLAST of Outer dense fiber protein 3 vs. Ensembl Fly
Match: CG8086 (gene:FBgn0032010 transcript:FBtr0332362)

HSP 1 Score: 106.301 bits (264), Expect = 1.777e-26
Identity = 82/242 (33.88%), Postives = 122/242 (50.41%), Query Frame = 1
Query:   76 TMTKRRGPIGAEYTSPGP-IYPLPSLLGRQNHDPRSSFKRAPAWALGDRYGKLRDDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLENDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPP--NRDNGPAFSFGSHHSQYRGHL 792
            T T R G I AE T+PGP    LP+L+G +   P S  K AP+++ G + G   D SGPGPA    + +   G     + +L SRP  L     P PG Y+   +   +  ++P Y+FG +     T   P PNVY +  ++  +   +  SAP+Y++  R K       +   PGPG Y   +++  K K P  ++  +  +  ++S KPGPG + P   N  + PA+SFG  HSQY G L
Sbjct:   11 TPTVRIGKIAAETTNPGPATVQLPTLIGSKV--PDSKKKAAPSYSFGHKLGGKYDTSGPGPAQYNVTGMRAKGRDYPRAATLQSRPKELTRFSNPGPGEYDVVPAAKAVIDATPKYTFGQRPVALKTFQIPAPNVYKIPTVMGSSKEGKIRSAPAYTITGREKPPLIP--VMIFPGPGYYDG-EYTVVKPKPPVFSMRGKYKMGSEDS-KPGPGAHCPEKVNLSHVPAYSFGIKHSQYLGRL 246          
BLAST of Outer dense fiber protein 3 vs. Ensembl Fly
Match: CG10252 (gene:FBgn0039104 transcript:FBtr0084475)

HSP 1 Score: 97.8265 bits (242), Expect = 1.105e-23
Identity = 79/235 (33.62%), Postives = 116/235 (49.36%), Query Frame = 1
Query:  121 PGP-IYPLPSLLGRQNHDPRSSFKRAPAWALGDRYGKLRDDSGPGP-AYKVESNLLRTGPATSFSFSLHSRPNYLENDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPG----TYYPPNRDNGPAFSFGSHHSQYRGHLIVNDD 807
            PGP +Y LP  +G   HD R   +R P ++ G R     +D GPGP AYKV+  L R G +    FS+  R N ++   +P PG ++  +       ++P+YS GL+         PGPN Y  +        + +P  PSYS+  + KI     + T +PGP AY   D +    + P  ++  R  +PG+N V PGP      YY P + +GP +SFG  H Q+   +IV  D
Sbjct:    8 PGPGVYMLPPTVGYDKHDNRK--QRLPQYSFGMRTRAPGEDLGPGPGAYKVDK-LTRYGTSKGLEFSMAPRTNVIDKRSSPGPGAHDVHNRPFFKGVNAPSYSMGLRTDFNFKKDGPGPNAYKYE------VNAVRPGVPSYSMGLQTKI----LNKTNSPGPAAYGGGDINVKLTRAPIYSMQPRTTIPGEN-VGPGPNYYDLMYYRPGK-SGPGYSFGVRHHQFAPPMIVRCD 227          
BLAST of Outer dense fiber protein 3 vs. Ensembl Fly
Match: CG8086 (gene:FBgn0032010 transcript:FBtr0079620)

HSP 1 Score: 96.6709 bits (239), Expect = 6.472e-23
Identity = 78/239 (32.64%), Postives = 116/239 (48.54%), Query Frame = 1
Query:   76 TMTKRRGPIGAEYTSPGP-IYPLPSLLGRQNHDPRSSFKRAPAWALGDRYGKLRDDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLENDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPP---NRDNGPAFSFGSHHSQY 780
            T T R G I AE T+PGP    LP+L+G +  D  S  K AP+++ G + G   D SGPGPA    + +   G     + +L SRP  L     P PG Y+   +   +  ++P Y+FG +     T   P PNVY +  ++  +   +  SAP+Y++  R K       +   PGPG Y   +++  K K P  ++  +  + G    KPGPG + P     + + PA SFG  HS Y
Sbjct:   11 TPTVRIGKIAAETTNPGPATVQLPTLIGSKVPD--SKKKAAPSYSFGHKLGGKYDTSGPGPAQYNVTGMRAKGRDYPRAATLQSRPKELTRFSNPGPGEYDVVPAAKAVIDATPKYTFGQRPVALKTFQIPAPNVYKIPTVMGSSKEGKIRSAPAYTITGREKPPLIP--VMIFPGPGYYDG-EYTVVKPKPPVFSMRGKYKM-GSEDSKPGPGAHCPEKYWEKRSPPAISFGILHSPY 243          
BLAST of Outer dense fiber protein 3 vs. Ensembl Fly
Match: CG8086 (gene:FBgn0032010 transcript:FBtr0079621)

HSP 1 Score: 96.6709 bits (239), Expect = 1.052e-22
Identity = 78/239 (32.64%), Postives = 116/239 (48.54%), Query Frame = 1
Query:   76 TMTKRRGPIGAEYTSPGP-IYPLPSLLGRQNHDPRSSFKRAPAWALGDRYGKLRDDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLENDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPP---NRDNGPAFSFGSHHSQY 780
            T T R G I AE T+PGP    LP+L+G +  D  S  K AP+++ G + G   D SGPGPA    + +   G     + +L SRP  L     P PG Y+   +   +  ++P Y+FG +     T   P PNVY +  ++  +   +  SAP+Y++  R K       +   PGPG Y   +++  K K P  ++  +  + G    KPGPG + P     + + PA SFG  HS Y
Sbjct:   37 TPTVRIGKIAAETTNPGPATVQLPTLIGSKVPD--SKKKAAPSYSFGHKLGGKYDTSGPGPAQYNVTGMRAKGRDYPRAATLQSRPKELTRFSNPGPGEYDVVPAAKAVIDATPKYTFGQRPVALKTFQIPAPNVYKIPTVMGSSKEGKIRSAPAYTITGREKPPLIP--VMIFPGPGYYDG-EYTVVKPKPPVFSMRGKYKM-GSEDSKPGPGAHCPEKYWEKRSPPAISFGILHSPY 269          
BLAST of Outer dense fiber protein 3 vs. Ensembl Fly
Match: CG8086 (gene:FBgn0032010 transcript:FBtr0332360)

HSP 1 Score: 93.2041 bits (230), Expect = 2.060e-20
Identity = 78/239 (32.64%), Postives = 107/239 (44.77%), Query Frame = 1
Query:   76 TMTKRRGPIGAEYTSPGP-IYPLPSLLGRQNHDPRSSFKRAPAWALGDRYGKLRDDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLENDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPPNR--DNGPAFSFGSHHSQYR 783
            T T R G I AE T+PGP    LP+L+G +   P S  K AP+++ G + G   D SGPGPA    + +   G     + +L SRP  L     P PG Y+   +   +  ++P Y+FG +     T   PGPN Y + P+     R     AP YS   R K+  +   L   P P +Y     +  K+  P  T   R  +  D    P PG Y P     +  P FSFG  H + R
Sbjct:   37 TPTVRIGKIAAETTNPGPATVQLPTLIGSKV--PDSKKKAAPSYSFGHKLGGKYDTSGPGPAQYNVTGMRAKGRDYPRAATLQSRPKELTRFSNPGPGEYDVVPAAKAVIDATPKYTFGQRPVALKTFQIPGPNYYQVVPLDVVKRR-----APRYSF--RIKVNVY---LVNNPAPNSYCPEKVTQSKKNAPRYTFGRRTKIEHDQGT-PAPGAYCPEKVKLNKTPEFSFGIKHHEQR 262          

HSP 2 Score: 65.4698 bits (158), Expect = 2.564e-11
Identity = 70/199 (35.18%), Postives = 85/199 (42.71%), Query Frame = 1
Query:  178 SSFKRAPAWALGDRYGKLRDDSGPGP-AYKVESNLLRTGPATSFSFSLH-SRPNYLENDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTK-TPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPPNR--DNGPAFSF 759
             S K AP +  G R     D   P P AY  E   L   P  SF    H  RP     D+TP PG Y  E     + +  PAYSFGLK        TP P  Y  +       +S   SAP+YS+      G  S+D+   TP PGAY  P+     R  PA +   R  L   +S  P PGTY P     D+ PAF+ 
Sbjct:  211 QSKKNAPRYTFGRRTKIEHDQGTPAPGAYCPEKVKLNKTPEFSFGIKHHEQRP-----DYTPAPGTYKPEQV---VLEHIPAYSFGLKTKHIQVSDTPAPGAYSPE-------KSRLHSAPAYSI-----AGKASQDVVDCTPAPGAYE-PEKCVLSR-TPAFSFGHRAEL-AKSSDTPAPGTYNPEKVRLDHTPAFTL 386          

HSP 3 Score: 55.0694 bits (131), Expect = 5.938e-8
Identity = 56/204 (27.45%), Postives = 90/204 (44.12%), Query Frame = 1
Query:  184 FKRAPAWALGDRYGKLRDDSGPGP-AYKVESNLLRTGPATSFSFSLHSRPNYLENDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPM-LSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPPN--RDNGPAFSFGSHHSQYR 783
             +  PA++ G +   ++    P P AY  E + L + PA    +S+  + +    D TP PG Y  E  +      +PA+SFG +     +  TP P  Y  + + L  T        P+++L  R +    SE    TP PG+Y+   +     + PA T   ++    ++S  P PG Y P     D+ PAFSF   H  ++
Sbjct:  279 LEHIPAYSFGLKTKHIQVSDTPAPGAYSPEKSRLHSAPA----YSIAGKASQDVVDCTPAPGAYEPEKCV---LSRTPAFSFGHRAELAKSSDTPAPGTYNPEKVRLDHT--------PAFTLSGRPETRSVSE----TPAPGSYAPEKYRN--DRTPAFTFGGKHEQRLESST-PAPGDYCPEKVRHDHNPAFSFAGRHDLHK 460          
BLAST of Outer dense fiber protein 3 vs. Ensembl Zebrafish
Match: odf3b (outer dense fiber of sperm tails 3B [Source:NCBI gene;Acc:335524])

HSP 1 Score: 172.555 bits (436), Expect = 1.315e-51
Identity = 102/245 (41.63%), Postives = 136/245 (55.51%), Query Frame = 1
Query:   85 KRRGPIGAEYTSPGPIYPLPSLLGRQNHDPRSSFKRAPAWALGDRYGKLRDDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLENDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPP----NRDNGPAFSFGSHHSQYRGHLIVNDD 807
            K RGPI A Y SPGP Y LP   G  NHDPR   ++ PA++ G R+     +  PGP Y V SN+ R G   + ++S++ R   ++   TP PG Y+ E++    Y S PA++   +      D TPGP  Y+L P+L       K SAP+ S   R+ IG F EDL KTPGPG Y V D   YK K P  +++ RN +PGD + KPGPG +YP      R   P+FSFG  HS+Y    IV+ +
Sbjct:   15 KPRGPIAAMYNSPGPTYALPGATGMNNHDPR--MQKGPAFSFGIRHHNFHGNYSPGPGYLVPSNITRVGRDGTPAYSVYGRRKDIQPFQTPGPGSYSPENATKATYLSPPAFTLSARTKLFRNDQTPGPAAYMLPPVLGPKV-VNKTSAPNVSFSGRSAIGSFHEDLRKTPGPGTYQVVDPCVYKHKGPQYSMTGRNMMPGDMTKKPGPGAHYPEMVCFTRAKAPSFSFGIRHSEYVAPTIVDGE 256          
BLAST of Outer dense fiber protein 3 vs. Ensembl Zebrafish
Match: odf3b (tripartite motif containing 35-30 [Source:ZFIN;Acc:ZDB-GENE-060503-557])

HSP 1 Score: 172.555 bits (436), Expect = 1.315e-51
Identity = 102/245 (41.63%), Postives = 136/245 (55.51%), Query Frame = 1
Query:   85 KRRGPIGAEYTSPGPIYPLPSLLGRQNHDPRSSFKRAPAWALGDRYGKLRDDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLENDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPP----NRDNGPAFSFGSHHSQYRGHLIVNDD 807
            K RGPI A Y SPGP Y LP   G  NHDPR   ++ PA++ G R+     +  PGP Y V SN+ R G   + ++S++ R   ++   TP PG Y+ E++    Y S PA++   +      D TPGP  Y+L P+L       K SAP+ S   R+ IG F EDL KTPGPG Y V D   YK K P  +++ RN +PGD + KPGPG +YP      R   P+FSFG  HS+Y    IV+ +
Sbjct:   15 KPRGPIAAMYNSPGPTYALPGATGMNNHDPR--MQKGPAFSFGIRHHNFHGNYSPGPGYLVPSNITRVGRDGTPAYSVYGRRKDIQPFQTPGPGSYSPENATKATYLSPPAFTLSARTKLFRNDQTPGPAAYMLPPVLGPKV-VNKTSAPNVSFSGRSAIGSFHEDLRKTPGPGTYQVVDPCVYKHKGPQYSMTGRNMMPGDMTKKPGPGAHYPEMVCFTRAKAPSFSFGIRHSEYVAPTIVDGE 256          
BLAST of Outer dense fiber protein 3 vs. Ensembl Zebrafish
Match: odf3b (tripartite motif containing 35-30 [Source:ZFIN;Acc:ZDB-GENE-060503-557])

HSP 1 Score: 172.555 bits (436), Expect = 1.315e-51
Identity = 102/245 (41.63%), Postives = 136/245 (55.51%), Query Frame = 1
Query:   85 KRRGPIGAEYTSPGPIYPLPSLLGRQNHDPRSSFKRAPAWALGDRYGKLRDDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLENDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPP----NRDNGPAFSFGSHHSQYRGHLIVNDD 807
            K RGPI A Y SPGP Y LP   G  NHDPR   ++ PA++ G R+     +  PGP Y V SN+ R G   + ++S++ R   ++   TP PG Y+ E++    Y S PA++   +      D TPGP  Y+L P+L       K SAP+ S   R+ IG F EDL KTPGPG Y V D   YK K P  +++ RN +PGD + KPGPG +YP      R   P+FSFG  HS+Y    IV+ +
Sbjct:   15 KPRGPIAAMYNSPGPTYALPGATGMNNHDPR--MQKGPAFSFGIRHHNFHGNYSPGPGYLVPSNITRVGRDGTPAYSVYGRRKDIQPFQTPGPGSYSPENATKATYLSPPAFTLSARTKLFRNDQTPGPAAYMLPPVLGPKV-VNKTSAPNVSFSGRSAIGSFHEDLRKTPGPGTYQVVDPCVYKHKGPQYSMTGRNMMPGDMTKKPGPGAHYPEMVCFTRAKAPSFSFGIRHSEYVAPTIVDGE 256          
BLAST of Outer dense fiber protein 3 vs. Ensembl Zebrafish
Match: odf3b (outer dense fiber of sperm tails 3B [Source:NCBI gene;Acc:335524])

HSP 1 Score: 172.17 bits (435), Expect = 1.834e-51
Identity = 102/245 (41.63%), Postives = 136/245 (55.51%), Query Frame = 1
Query:   85 KRRGPIGAEYTSPGPIYPLPSLLGRQNHDPRSSFKRAPAWALGDRYGKLRDDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLENDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPP----NRDNGPAFSFGSHHSQYRGHLIVNDD 807
            K RGPI A Y SPGP Y LP   G  NHDPR   ++ PA++ G R+     +  PGP Y V SN+ R G   + ++S++ R   ++   TP PG Y+ E++    Y S PA++   +      D TPGP  Y+L P+L       K SAP+ S   R+ IG F EDL KTPGPG Y V D   YK K P  +++ RN +PGD + KPGPG +YP      R   P+FSFG  HS+Y    IV+ +
Sbjct:   15 KPRGPIAAMYNSPGPTYALPGATGMNNHDPR--MQKGPAFSFGIRHHNFHGNYSPGPGYLVPSNITRVGRDGTPAYSVYGRRKDIQPFQTPGPGSYSPENATKVTYLSPPAFTLSARTKLFRNDQTPGPAAYMLPPVLGPKV-VNKTSAPNVSFSGRSAIGSFHEDLRKTPGPGTYQVVDPCVYKHKGPQYSMTGRNMMPGDMTKKPGPGAHYPEMVCFTRAKAPSFSFGIRHSEYIAPTIVDGE 256          
BLAST of Outer dense fiber protein 3 vs. Ensembl Zebrafish
Match: odf3l2a (outer dense fiber of sperm tails 3-like 2a [Source:ZFIN;Acc:ZDB-GENE-050417-380])

HSP 1 Score: 113.62 bits (283), Expect = 3.709e-29
Identity = 93/260 (35.77%), Postives = 139/260 (53.46%), Query Frame = 1
Query:   70 LITMTKRRGPIGA-EYTSPGP-IYPLPSLLGRQNHDPRSSFKRAPAWALGDRYGK--LRDDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLENDF-TPDPGRYNYESS--INRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTY----YPPNRDNGPAFSFGSHHSQYRGHLIVNDDVED 816
            +  + +RR PI A     PGP  Y LP  +G  NHD   +   +PA++   R     +  DS PGP Y+V++ + R G   + S+S+  R     + F TP PG Y+ E +  +N ++   P+Y+   +   ++ D  P PN Y L P L  T  S KPS+P +++ +R K GG SEDL+ TPGPG Y+  D S Y  + P+ ++ SR+ +  D++ KPGPGTY       +    P+ S G  HS++   LIV  DV D
Sbjct:    1 MAEVERRRRPIIAGRERGPGPGRYALPPTIGYINHD--YTKPSSPAYSFHSRMSSNMVSVDSSPGPRYRVDAKMTRFGRDGTPSYSMLGRRKRTASTFQTPGPGAYSPEKAPPLN-LHHRPPSYTMSSRTRYRSVDPVPAPNRYTL-PNLFGTTVSCKPSSPCFTMSARMKAGGPSEDLSMTPGPGRYNSTDPSVYLNRQPSFSMQSRHNILIDSTGKPGPGTYSSEKVTAHLPRAPSVSLGVRHSEFVTPLIV--DVLD 254          
BLAST of Outer dense fiber protein 3 vs. Ensembl Xenopus
Match: scml2 (Scm polycomb group protein like 2 [Source:Xenbase;Acc:XB-GENE-6043728])

HSP 1 Score: 180.259 bits (456), Expect = 2.089e-54
Identity = 109/246 (44.31%), Postives = 146/246 (59.35%), Query Frame = 1
Query:   91 RGPIGAEYTSPGPIYPLPSLLGRQNHDPRSSFKRAPAWALGDRYGKLRDDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLENDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPP----NRDNGPAFSFGSHHSQYRGHLIVNDDVED 816
            RGPI A Y+SPGP Y LP   G  +HDP  S  RAPA+++G+R  K  DD  PGP Y V SN+   G   + ++S++ RP  + +  TP PG Y+ E +    Y+S+P YS G +    + D TPGP  Y+L  ++       + SAP+YS+  R+KIG F EDL +TPGPG Y V D  +YK + P  ++++RN LPGD ++KPGPG Y P     +R   P FSFG  HS Y   LIV  DV D
Sbjct:   16 RGPIAALYSSPGPKYSLPGNTGFVSHDP--SRYRAPAYSMGNRRFKFVDDCSPGPGYLVPSNITVKGKDGTPAYSIYGRPKDISSFRTPGPGSYSPERAGKSAYRSAPTYSLGERTKTFSNDQTPGPAAYVLPSVIGPRI-VNRISAPNYSMTGRSKIGSFHEDLQRTPGPGTYRVIDPGSYKHRPPQYSMTARNVLPGDTTIKPGPGAYSPEKVVMSRPQAPNFSFGIRHSDYVAPLIV--DVAD 256          
BLAST of Outer dense fiber protein 3 vs. Ensembl Xenopus
Match: ODF3L2 (outer dense fiber of sperm tails 3-like 1 [Source:NCBI gene;Acc:100487571])

HSP 1 Score: 112.079 bits (279), Expect = 1.684e-28
Identity = 86/243 (35.39%), Postives = 127/243 (52.26%), Query Frame = 1
Query:  100 IGAEYTSPGP-IYPLPSLLGRQNHDPRSSFKRAPAWALGDR--YGKLRDDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLE--NDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPP----NRDNGPAFSFGSHHSQYRGHLIVN 801
            I A+ T PGP  Y LP  +G  +HD  + F  +PA++   R        DS PGP Y V+++L R G +   S+S+ +R    +  ND  P PG Y+ E       +  P+YS G +   ++ D  P PN Y L P+L     + K  AP+++L  + + GG SEDL+ TPGP  Y   D S Y ++ PA ++  R+P        PGPG+YYP     ++ + PA+S G  HS+Y   LI+ 
Sbjct:   12 IAAKVTGPGPGRYNLPPTVGFVSHD-YTKFS-SPAYSFHGRPSNSAHVSDSSPGPRYYVDASLTRFGRSAGPSYSMLARGRSADKKNDI-PGPGTYSPEKCTVPTQRKFPSYSMGSRTRYRSMDRVPAPNSYSLPPVLGPRA-TAKVCAPAFTLSGKYQHGGHSEDLSGTPGPAHYQQTDPSRYLKRGPAFSMQGRHPNSKAEQKTPGPGSYYPEKVNQHKRHAPAYSMGIRHSEYTAPLIIE 250          
BLAST of Outer dense fiber protein 3 vs. Ensembl Mouse
Match: Odf3 (outer dense fiber of sperm tails 3 [Source:MGI Symbol;Acc:MGI:1916537])

HSP 1 Score: 140.969 bits (354), Expect = 1.676e-39
Identity = 93/245 (37.96%), Postives = 130/245 (53.06%), Query Frame = 1
Query:   91 RGPIGAEYTSPGPIYPLPSLLGRQNHDPRSSFKRAPAWALGDRYGKLRDDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLENDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPP----NRDNGPAFSFGSHHSQYRGHLIVNDDVE 813
            RGPI A Y+SPGP Y +P   G   H P     RAPA++       L ++  PGP Y V   +L+TG     ++S+  R  + +   TP PG Y  E S   ++ S+P++S   +      D TPGP  Y+L P++       K S PS+S+  R+K+G FS+DL KTPGP AY   +    K K P  T+++R   PGD ++KPGPG + P     N+   P  +FG  HS Y   L+V  DVE
Sbjct:   16 RGPIMALYSSPGPKYLIPPTTGFVKHTPTKL--RAPAYSFRGAPMLLAENCSPGPRYSVNPKILKTGKDLGPAYSILGR-YHTKTLLTPGPGDYFPEKSTKYVFDSAPSHSISARTKTFRVDSTPGPAAYML-PVVMGPHTVGKVSQPSFSIKGRSKLGSFSDDLHKTPGPAAYRQTEVQVTKFKAPQYTMAARVEPPGDKTLKPGPGAHSPEKVTLNKPCAPTVTFGIKHSDYMTPLVV--DVE 254          
BLAST of Outer dense fiber protein 3 vs. Ensembl Mouse
Match: Odf3 (outer dense fiber of sperm tails 3 [Source:MGI Symbol;Acc:MGI:1916537])

HSP 1 Score: 140.969 bits (354), Expect = 3.111e-39
Identity = 93/245 (37.96%), Postives = 130/245 (53.06%), Query Frame = 1
Query:   91 RGPIGAEYTSPGPIYPLPSLLGRQNHDPRSSFKRAPAWALGDRYGKLRDDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLENDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPP----NRDNGPAFSFGSHHSQYRGHLIVNDDVE 813
            RGPI A Y+SPGP Y +P   G   H P     RAPA++       L ++  PGP Y V   +L+TG     ++S+  R  + +   TP PG Y  E S   ++ S+P++S   +      D TPGP  Y+L P++       K S PS+S+  R+K+G FS+DL KTPGP AY   +    K K P  T+++R   PGD ++KPGPG + P     N+   P  +FG  HS Y   L+V  DVE
Sbjct:   42 RGPIMALYSSPGPKYLIPPTTGFVKHTPTK--LRAPAYSFRGAPMLLAENCSPGPRYSVNPKILKTGKDLGPAYSILGR-YHTKTLLTPGPGDYFPEKSTKYVFDSAPSHSISARTKTFRVDSTPGPAAYML-PVVMGPHTVGKVSQPSFSIKGRSKLGSFSDDLHKTPGPAAYRQTEVQVTKFKAPQYTMAARVEPPGDKTLKPGPGAHSPEKVTLNKPCAPTVTFGIKHSDYMTPLVV--DVE 280          
BLAST of Outer dense fiber protein 3 vs. Ensembl Mouse
Match: Odf3b (outer dense fiber of sperm tails 3B [Source:MGI Symbol;Acc:MGI:1917363])

HSP 1 Score: 134.806 bits (338), Expect = 4.433e-37
Identity = 92/236 (38.98%), Postives = 124/236 (52.54%), Query Frame = 1
Query:   91 RGPIGAEYTSPGPIYPLPSLLGRQNHDPRSSFKRAPAWALGDRYGKLRDDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLENDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSGK-TTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPPNRDNGPAFSFGSHHSQYRGHLI 795
            RGPI A Y  PGP Y LP+  G + HDP  S  RAPA++ G R        GPGP+Y V + +   G   S +FS++ R ++     TP PGRY  E + N  Y S+P ++   +  G      TPGP  Y +  +L     S K SAP+YS+ SR+ +G   EDL+KTPGP AY V +   YK + P  T+  R   P +N+ KPGP +Y          +SFG  HS Y   +I
Sbjct:   16 RGPIAALYRGPGPKYKLPTNTGYKLHDP--SRPRAPAFSFGSRPPLRHATCGPGPSYLVPARMTVRGTVGSPAFSIYGRLSHTAPVLTPGPGRYYPERARNVTYPSAPRHTIAPRNWGILAKQETPGPGSYTVPSLLGSRVIS-KVSAPTYSIYSRSPVGSCFEDLSKTPGPCAYHVVNPMIYKTRAPQFTMLGRTLPPRENTKKPGPASYSVDKHRKPCGWSFGIRHSDYLAPMI 248          
BLAST of Outer dense fiber protein 3 vs. Ensembl Mouse
Match: Odf3b (outer dense fiber of sperm tails 3B [Source:MGI Symbol;Acc:MGI:1917363])

HSP 1 Score: 126.331 bits (316), Expect = 4.002e-34
Identity = 85/211 (40.28%), Postives = 115/211 (54.50%), Query Frame = 1
Query:   91 RGPIGAEYTSPGPIYPLPSLLGRQNHDPRSSFKRAPAWALGDRYGKLRDDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLENDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSGK-TTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTY 720
            RGPI A Y  PGP Y LP+  G + HDP  S  RAPA++ G R        GPGP+Y V + +   G   S +FS++ R ++     TP PGRY  E + N  Y S+P ++   +  G      TPGP  Y +  +L     S K SAP+YS+ SR+ +G   EDL+KTPGP AY V +   YK + P  T+  R   P +N+ KPGP +Y
Sbjct:   16 RGPIAALYRGPGPKYKLPTNTGYKLHDP--SRPRAPAFSFGSRPPLRHATCGPGPSYLVPARMTVRGTVGSPAFSIYGRLSHTAPVLTPGPGRYYPERARNVTYPSAPRHTIAPRNWGILAKQETPGPGSYTVPSLLGSRVIS-KVSAPTYSIYSRSPVGSCFEDLSKTPGPCAYHVVNPMIYKTRAPQFTMLGRTLPPRENTKKPGPASY 223          
BLAST of Outer dense fiber protein 3 vs. Ensembl Mouse
Match: Odf3l2 (outer dense fiber of sperm tails 3-like 2 [Source:MGI Symbol;Acc:MGI:2686003])

HSP 1 Score: 107.457 bits (267), Expect = 1.190e-26
Identity = 78/232 (33.62%), Postives = 122/232 (52.59%), Query Frame = 1
Query:  130 IYPLPSLLGRQNHDPRSSFKRAPAWALGDRYGKL-RDDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLENDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSGKTTDVT-PGPNVYLLDPML-SKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPP----NRDNGPAFSFGSHHSQYRGHLIVND 804
            +Y LPS +G  NHD   +   +PA++L  R  +    DS PGP Y ++  + R G +   ++S+  R      + TP PG Y+ E +     +++PA++ G +   K  D + P PN Y + P+  S+ F   KPS+PSY+++ R       +D ++ PGPG Y  PD +TY+++ PA +I  R   P      PGPGT+ P     NR   PA++ G  HS+ R   +V D
Sbjct:   48 LYVLPSTVGYVNHD--CTKAASPAYSLARRPSEAPLQDSSPGPVYFLDPKVTRFGRSCPPAYSMQGRAKVRGLEVTPGPGAYSPEKAPPVRQRNAPAFTLGSRLRQKPPDTSVPAPNAYTMPPLWGSQIF--IKPSSPSYTVVGRTPPARPPQDPSEIPGPGQYESPDPNTYRQRRPAFSILGRPRTPRPLEDTPGPGTHNPEQVTVNRARAPAYTMGIRHSK-RASTMVGD 274          
BLAST of Outer dense fiber protein 3 vs. UniProt
Match: sp|Q8AVY1|ODF3A_XENLA (Outer dense fiber protein 3 OS=Xenopus laevis OX=8355 GN=odf3 PE=2 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 1.251e-55
Identity = 112/246 (45.53%), Postives = 147/246 (59.76%), Query Frame = 1
Query:   91 RGPIGAEYTSPGPIYPLPSLLGRQNHDPRSSFKRAPAWALGDRYGKLRDDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLENDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPP----NRDNGPAFSFGSHHSQYRGHLIVNDDVED 816
            RGPI A Y+SPGP Y LP   G  +HDP  S  RAPA+++G+R  KL DD  PGP Y V SN+   G   + ++S++ RP  + +  TP PG Y+ E +    Y+S+P YS G +      D TPGP  Y+L  ++       + SAP+YS+  R+KIG F EDL KTPGPG Y V D  TYK K P  ++++RN LPGD ++KPGPG Y P     ++   P FSFG  HS+Y   LIV  DV D
Sbjct:   16 RGPIAAFYSSPGPKYSLPGNTGFVSHDP--SRHRAPAYSMGNRRFKLVDDCSPGPGYLVPSNITVKGKDGTPAYSIYGRPRDISSFRTPGPGSYSPERAGKSAYRSAPTYSLGERTKTFGNDQTPGPAAYMLPSVIGPRI-VNRSSAPNYSMTGRSKIGSFHEDLQKTPGPGTYRVIDPGTYKHKPPQYSMTARNVLPGDTTIKPGPGAYSPEKVVMSKAQAPNFSFGIRHSEYVAPLIV--DVAD 256          
BLAST of Outer dense fiber protein 3 vs. UniProt
Match: sp|Q5EB30|ODF3A_XENTR (Outer dense fiber protein 3 OS=Xenopus tropicalis OX=8364 GN=odf3 PE=2 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 1.106e-53
Identity = 109/246 (44.31%), Postives = 146/246 (59.35%), Query Frame = 1
Query:   91 RGPIGAEYTSPGPIYPLPSLLGRQNHDPRSSFKRAPAWALGDRYGKLRDDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLENDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPP----NRDNGPAFSFGSHHSQYRGHLIVNDDVED 816
            RGPI A Y+SPGP Y LP   G  +HDP  S  RAPA+++G+R  K  DD  PGP Y V SN+   G   + ++S++ RP  + +  TP PG Y+ E +    Y+S+P YS G +    + D TPGP  Y+L  ++       + SAP+YS+  R+KIG F EDL +TPGPG Y V D  +YK + P  ++++RN LPGD ++KPGPG Y P     +R   P FSFG  HS Y   LIV  DV D
Sbjct:   16 RGPIAALYSSPGPKYSLPGNTGFVSHDP--SRYRAPAYSMGNRRFKFVDDCSPGPGYLVPSNITVKGKDGTPAYSIYGRPKDISSFRTPGPGSYSPERAGKSAYRSAPTYSLGERTKTFSNDQTPGPAAYVLPSVIGPRI-VNRISAPNYSMTGRSKIGSFHEDLQRTPGPGTYRVIDPGSYKHRPPQYSMTARNVLPGDTTIKPGPGAYSPEKVVMSRPQAPNFSFGIRHSDYVAPLIV--DVAD 256          
BLAST of Outer dense fiber protein 3 vs. UniProt
Match: sp|A3KQA5|ODF3B_DANRE (Outer dense fiber protein 3-B OS=Danio rerio OX=7955 GN=odf3b PE=2 SV=2)

HSP 1 Score: 172.555 bits (436), Expect = 9.929e-51
Identity = 102/245 (41.63%), Postives = 136/245 (55.51%), Query Frame = 1
Query:   85 KRRGPIGAEYTSPGPIYPLPSLLGRQNHDPRSSFKRAPAWALGDRYGKLRDDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLENDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPP----NRDNGPAFSFGSHHSQYRGHLIVNDD 807
            K RGPI A Y SPGP Y LP   G  NHDPR   ++ PA++ G R+     +  PGP Y V SN+ R G   + ++S++ R   ++   TP PG Y+ E++    Y S PA++   +      D TPGP  Y+L P+L       K SAP+ S   R+ IG F EDL KTPGPG Y V D   YK K P  +++ RN +PGD + KPGPG +YP      R   P+FSFG  HS+Y    IV+ +
Sbjct:   15 KPRGPIAAMYNSPGPTYALPGATGMNNHDPR--MQKGPAFSFGIRHHNFHGNYSPGPGYLVPSNITRVGRDGTPAYSVYGRRKDIQPFQTPGPGSYSPENATKATYLSPPAFTLSARTKLFRNDQTPGPAAYMLPPVLGPKV-VNKTSAPNVSFSGRSAIGSFHEDLRKTPGPGTYQVVDPCVYKHKGPQYSMTGRNMMPGDMTKKPGPGAHYPEMVCFTRAKAPSFSFGIRHSEYVAPTIVDGE 256          
BLAST of Outer dense fiber protein 3 vs. UniProt
Match: sp|Q2TBH0|ODF3A_BOVIN (Outer dense fiber protein 3 OS=Bos taurus OX=9913 GN=ODF3 PE=2 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 2.349e-40
Identity = 94/243 (38.68%), Postives = 127/243 (52.26%), Query Frame = 1
Query:   91 RGPIGAEYTSPGPIYPLPSLLGRQNHDPRSSFKRAPAWALGDRYGKLRDDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLENDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPP----NRDNGPAFSFGSHHSQYRGHLIVNDD 807
            RGPI A Y+SPGP Y +P   G     P     RAPA++       L ++  PGP Y V   +LRTG     ++S+  R  + +   TP PG Y  E S   ++ S+P++S   +      D TPGP  Y+L PM+       K S PS+S+  R+K+G FS+DL KTPGP AY   D    K K P  T+++R   PGD ++KPGPG + P      R   P  SFG  HS Y   L+V+ D
Sbjct:   16 RGPIMALYSSPGPKYLIPPTTGFVKQTPTK--LRAPAYSFRGAPMLLAENCSPGPRYSVNPKILRTGKDLGPAYSILGR-YHTKTTLTPGPGDYFPEKSTKHVFDSAPSHSISARTKTFRVDSTPGPAAYML-PMVMGPHTIGKVSQPSFSIKGRSKLGSFSDDLHKTPGPAAYRQTDVQVTKFKAPQYTMAARVEPPGDKTLKPGPGAHSPEKVTMTRPCAPVVSFGIKHSDYMTPLVVDVD 254          
BLAST of Outer dense fiber protein 3 vs. UniProt
Match: sp|Q96PU9|ODF3A_HUMAN (Outer dense fiber protein 3 OS=Homo sapiens OX=9606 GN=ODF3 PE=1 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 3.264e-40
Identity = 96/245 (39.18%), Postives = 129/245 (52.65%), Query Frame = 1
Query:   91 RGPIGAEYTSPGPIYPLPSLLGRQNHDPRSSFKRAPAWALGDRYGKLRDDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLENDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPP----NRDNGPAFSFGSHHSQYRGHLIVNDDVE 813
            RGPI A Y+SPGP Y +P   G   H P     RAPA++       L ++  PGP Y V   +LRTG     ++S+  R    +   TP PG Y  E S   ++ S+P++S   +      D TPGP  Y+L PM+       K S PS+S+  R+K+GGFS+DL KTPGP AY   D    K K P  T+++R   PGD ++KPGPG + P      +   P  +FG  HS Y   L+V  DVE
Sbjct:   16 RGPIMALYSSPGPKYLIPPTTGFMKHTPTKL--RAPAYSFRGAPMLLAENCSPGPRYNVNPKILRTGKDLGPAYSILGR-YQTKTMLTPGPGDYFPEKSTKYVFDSAPSHSISARTKAFRVDSTPGPAAYML-PMVMGPNTVGKASQPSFSIKGRSKLGGFSDDLHKTPGPAAYRQTDVRVTKFKAPQYTMAARVEPPGDKTLKPGPGAHSPEKVTLTKPCAPVVTFGIKHSDYMTPLLV--DVE 254          
BLAST of Outer dense fiber protein 3 vs. TrEMBL
Match: gnl|BL_ORD_ID|18222849 (tr|A0A1I8H174|A0A1I8H174_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 233.802 bits (595), Expect = 4.500e-72
Identity = 124/249 (49.80%), Postives = 160/249 (64.26%), Query Frame = 1
Query:   70 LITMTKRRGPIGAEYTSPGPIYPLPSLLGRQNHDPRSSFKRAPAWALGDRYGKLRDDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLENDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPPNRDNG-PAFSFGSHHSQYRGHLIVNDDVE 813
            +   TK RGP+ A Y+SPGP Y LP L+G+ +HDPRS   R PA+  G R+GK RDDS PGP Y   + + R G   +  +SL+ RP        P PG Y  +++   IY  +PAYSFG++     TD TPGPN Y  DPML KT RSEK +APSY+L+ R+K+GGF EDL +TPGPGAYSV     YK   PA +++SRN +PGD++ KPGPG + P     G PAFSFG  HSQY+G  I + D++
Sbjct:    8 VYNYTKPRGPVAAMYSSPGPKYGLPGLVGQPHHDPRSVHTRGPAYPFGIRHGKFRDDSSPGPCYLPGARIFRDGKDGTPQYSLYGRPKDGTMFSAPGPGAYKTDNTNKEIYSKAPAYSFGVRHMEFRTDNTPGPNAYTPDPMLGKTLRSEKKAAPSYTLVGRSKVGGFHEDLQRTPGPGAYSVTSPGKYKSTPPAYSMTSRNSMPGDSTTKPGPGAHSPETTKRGTPAFSFGIRHSQYKGESITDADLQ 256          
BLAST of Outer dense fiber protein 3 vs. TrEMBL
Match: gnl|BL_ORD_ID|18309809 (tr|A0A267EQJ8|A0A267EQJ8_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023580g1 PE=4 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 1.016e-71
Identity = 124/253 (49.01%), Postives = 161/253 (63.64%), Query Frame = 1
Query:   70 LITMTKRRGPIGAEYTSPGPIYPLPSLLGRQNHDPRSSFKRAPAWALGDRYGKLRDDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLENDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPP-----NRDNGPAFSFGSHHSQYRGHLIVNDDVE 813
            +   TK RGP+ A Y+SPGP Y LP L+G+ +HDPRS   R PA+  G R+GK RDDS PGP Y   + + R G   +  +SL+ RP        P PG Y  +++   IY  +PAYSFG++     TD TPGPN Y  DPML KT RSEK +APSY+L+ R+K+GGF EDL +TPGPGAYSV     YK   PA +++SRNP+PGD++ KPGPG + P       +   PAFSFG  HSQY+G  I + D++
Sbjct:    2 VYNYTKPRGPVAAMYSSPGPKYGLPGLVGQPHHDPRSVHTRGPAYPFGIRHGKFRDDSSPGPCYLPGARIFRDGKDGTPQYSLYGRPKDGTMFSAPGPGAYKTDNTNKEIYSKAPAYSFGVRHMEFRTDNTPGPNAYTPDPMLGKTLRSEKKAAPSYTLVGRSKVGGFHEDLQRTPGPGAYSVTSPGKYKSTPPAYSMTSRNPMPGDSTTKPGPGAHSPETGYYKTKRGTPAFSFGIRHSQYKGESITDADLQ 254          
BLAST of Outer dense fiber protein 3 vs. TrEMBL
Match: gnl|BL_ORD_ID|18338999 (tr|A0A267F4K0|A0A267F4K0_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig024012g1 PE=4 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 1.562e-70
Identity = 123/253 (48.62%), Postives = 160/253 (63.24%), Query Frame = 1
Query:   70 LITMTKRRGPIGAEYTSPGPIYPLPSLLGRQNHDPRSSFKRAPAWALGDRYGKLRDDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLENDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPP-----NRDNGPAFSFGSHHSQYRGHLIVNDDVE 813
            +   TK RGP+ A Y+SPGP Y LP L+G+ +HDPRS   R PA+  G R+GK RDDS PGP Y   + + R G   +  +SL+ RP        P PG Y  +++   IY  +PAYSFG++     TD TPGPN Y  DPML KT RSEK +APSY+L+ R+K+GGF EDL +TPGPGAYSV     YK   PA +++SRN +PGD++ KPGPG + P       +   PAFSFG  HSQY+G  I + D++
Sbjct:    2 VYNYTKPRGPVAAMYSSPGPKYGLPGLVGQPHHDPRSVHTRGPAYPFGIRHGKFRDDSSPGPCYLPGARIFRDGKDGTPQYSLYGRPKDGTMFSAPGPGAYKTDNTNKEIYSKAPAYSFGVRHMEFRTDNTPGPNAYTPDPMLGKTLRSEKKAAPSYTLVGRSKVGGFHEDLQRTPGPGAYSVTSPGKYKSTPPAYSMTSRNSMPGDSTTKPGPGAHSPETGYYKTKRGTPAFSFGIRHSQYKGESITDADLQ 254          
BLAST of Outer dense fiber protein 3 vs. TrEMBL
Match: gnl|BL_ORD_ID|18230546 (tr|A0A267GE88|A0A267GE88_9PLAT Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011674g1 PE=4 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 7.748e-70
Identity = 127/253 (50.20%), Postives = 160/253 (63.24%), Query Frame = 1
Query:   70 LITMTKRRGPIGAEYTSPGPIYPLPSLLGRQNHDPRSSFKRAPAWALGDRYGKLRDDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLENDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPPN-----RDNGPAFSFGSHHSQYRGHLIVNDDVE 813
            +   TK RGPI A Y+SPGP Y LPSL+G+ +HDPRS   R PA+  G R+GK +D+S PGP Y   +   R G   S  +SL+ RP        P PG Y  ES+   +Y  +PAYSFGL+     TD TPGPN Y  DPML KT RSEK +APSY+L+ R+K+GGF EDL KTPGPGAYSV     Y+   PA +++SRN +PGD++ KPGPG + P       +   PAFSFG  HSQY+G  I + D+E
Sbjct:    7 VYNYTKPRGPIAAMYSSPGPKYMLPSLVGQPHHDPRSVHNRGPAYPFGLRHGKFKDESSPGPCYLPLT--YRDGKDGSPHYSLYGRPKDGTLFSAPGPGAYKPESTNKEVYSRAPAYSFGLRHHQFRTDNTPGPNAYTPDPMLGKTLRSEKKAAPSYTLVGRSKVGGFHEDLQKTPGPGAYSVVPAGRYRHNPPAYSLTSRNSMPGDSTTKPGPGAHSPETNFYRMKRAAPAFSFGIRHSQYKGEFITDADME 257          
BLAST of Outer dense fiber protein 3 vs. TrEMBL
Match: gnl|BL_ORD_ID|18215333 (tr|A0A267GW94|A0A267GW94_9PLAT Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032446g1 PE=4 SV=1)

HSP 1 Score: 227.639 bits (579), Expect = 8.866e-70
Identity = 127/253 (50.20%), Postives = 160/253 (63.24%), Query Frame = 1
Query:   70 LITMTKRRGPIGAEYTSPGPIYPLPSLLGRQNHDPRSSFKRAPAWALGDRYGKLRDDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLENDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPPN-----RDNGPAFSFGSHHSQYRGHLIVNDDVE 813
            +   TK RGPI A Y+SPGP Y LPSL+G+ +HDPRS   R PA+  G R+GK +D+S PGP Y   +   R G   S  +SL+ RP        P PG Y  ES+   +Y  +PAYSFGL+     TD TPGPN Y  DPML KT RSEK +APSY+L+ R+K+GGF EDL KTPGPGAYSV     Y+   PA +++SRN +PGD++ KPGPG + P       +   PAFSFG  HSQY+G  I + D+E
Sbjct:    1 VYNYTKPRGPIAAMYSSPGPKYMLPSLVGQPHHDPRSVHNRGPAYPFGLRHGKFKDESSPGPCYLPLT--YRDGKDGSPHYSLYGRPKDGTLFSAPGPGAYKPESTNKEVYSRAPAYSFGLRHHQFRTDNTPGPNAYTPDPMLGKTLRSEKKAAPSYTLVGRSKVGGFHEDLQKTPGPGAYSVVPAGRYRHNPPAYSLTSRNSMPGDSTTKPGPGAHSPETNFYRMKRAAPAFSFGIRHSQYKGEFITDADME 251          
BLAST of Outer dense fiber protein 3 vs. Ensembl Cavefish
Match: odf3b (outer dense fiber of sperm tails 3B [Source:NCBI gene;Acc:103032435])

HSP 1 Score: 169.474 bits (428), Expect = 1.756e-50
Identity = 101/242 (41.74%), Postives = 144/242 (59.50%), Query Frame = 1
Query:   91 RGPIGAEYTSPGPIYPLPSLLGRQNHDPRSSFKRAPAWALGDRYGKLRDDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLENDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPPN----RDNGPAFSFGSHHSQYRGHLIVND 804
            RGPI A Y SPGP Y LP++ G  +HDPR   ++APA++ G R+ +      PGP + V SN+ + G   + ++SL+SRP   +   TP PG+Y+ E S    + S+PAYS   + +G   D +PGP  Y+L  ++     S++ SAP++S   R K+G F EDL KTP PG YSV D + Y  + P  +++ RN +PGD + KPGPGTY P      R   P+FSFG  HS+Y    I++D
Sbjct:   17 RGPIAALYRSPGPKYGLPAVTGINDHDPRK--RKAPAFSFGTRHKQFSLSCSPGPGHLVPSNITKVGRDGTPAYSLYSRPRDPKPFQTPGPGKYSPEISGKTTFYSAPAYSLSGRSNGYRRDQSPGPAAYMLPNVMGSNTVSKR-SAPNFSFSGRLKVGSFHEDLQKTPAPGTYSVVDPNIYTPRSPHYSMTGRNMMPGDTTKKPGPGTYCPEQVTFTRLKAPSFSFGIRHSEYTAPPIIDD 255          
BLAST of Outer dense fiber protein 3 vs. Ensembl Cavefish
Match: odf3l2b (outer dense fiber protein 3-like protein 2 [Source:NCBI gene;Acc:103025199])

HSP 1 Score: 110.923 bits (276), Expect = 3.329e-28
Identity = 85/254 (33.46%), Postives = 134/254 (52.76%), Query Frame = 1
Query:   85 KRRGPIGAEYTSPGP-IYPLPSLLGRQNHDPRSSFKRA--PAWALGDRYGKLRD-----DSGPGPAYKVESNLLRTGPATSFSFSLHSR-PNYLENDFTPDPGRYNYESS-INRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNP-LPGDNSVKPGPGTYYPPN----RDNGPAFSFGSHHSQYRGHLIVN 801
            K+R  I      PGP  Y LPS +G   HD    F +A  PA+     +GK+ +     DS PGP Y +++ + R G   S ++S++ R P   E   TP PG YN E + +    +  P+Y+ G +   ++ D  P PN Y L  ++  +  + KP++ SY++  R K G ++EDL+ TPGPG Y+ PD + Y  + PA ++  R+   P +   +PGPG++ P N    +   PAF+ G  HS +   L+V+
Sbjct:    6 KKRPIIAGREKGPGPGRYALPSTIGFVGHD----FTKATSPAYTF---HGKMSENMYNIDSSPGPRYNIDAKVTRFGRDGSPAYSIYGRTPGPKEMFQTPGPGAYNPEIAPVCSTQRKPPSYTMGYRTPYRSADTVPAPNKYTLPALMGSSVLT-KPASASYTISGRFKFGSYAEDLSNTPGPGRYNRPDPNVYLPRQPAFSMLGRHDGKPSETMPRPGPGSHNPENVTTHKPRAPAFTLGIRHSDFVTPLVVH 251          
BLAST of Outer dense fiber protein 3 vs. Ensembl Cavefish
Match: odf3l2a (outer dense fiber protein 3-like protein 2 [Source:NCBI gene;Acc:103039917])

HSP 1 Score: 105.916 bits (263), Expect = 2.185e-26
Identity = 87/254 (34.25%), Postives = 131/254 (51.57%), Query Frame = 1
Query:   70 LITMTKRRGPIGAEYTSPGP-IYPLPSLLGRQNHDPRSSFKRAPAWALGDRYGK--LRDDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLENDF-TPDPGRYNYESS--INRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYP----PNRDNGPAFSFGSHHSQYRGHLIVN 801
            +  + +RR  I      PGP  Y LP  +G  NHD   +   +PA++   R     +  DS PGP Y VE+ + R G   + S+S+  R       F TP PG Y+ E +  +N  ++  P+Y+   +   ++ D  P PN Y L  +L       K S+ S+S+ SR K GG SEDL  TPGPG Y+  + S Y  + P+ +I SR+ +P D + KPGPGT+ P     +    P+FS G  HS++   L+++
Sbjct:    1 MTEVVRRRPLIAGREKGPGPGRYALPPTIGYVNHD--YTKPSSPAYSFHSRLSSNMVSVDSSPGPQYHVEAKITRFGRDGTPSYSMLGRKKLSAGTFQTPGPGAYSPEKAPPLNG-HRQPPSYTMAYRTRYRSVDAIPAPNSYTLPNLLGSQI-PNKSSSASFSMSSRRKSGGPSEDLAMTPGPGHYNSTEPSIYLNRQPSFSIQSRHSIPSDATRKPGPGTHSPERVIAHLPRPPSFSLGVRHSEFVTPLVID 250          
BLAST of Outer dense fiber protein 3 vs. Ensembl Sea Lamprey
Match: odf3b (tripartite motif containing 35-30 [Source:ZFIN;Acc:ZDB-GENE-060503-557])

HSP 1 Score: 177.563 bits (449), Expect = 2.380e-54
Identity = 107/246 (43.50%), Postives = 143/246 (58.13%), Query Frame = 1
Query:   85 KRRGPIGAEYTSPGPIYPLPSLLGRQNHDPRSSFKRAPAWALGDRYGKLRDDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLENDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPP-----NRDNGPAFSFGSHHSQYRGHLIVNDD 807
            +RRGPI A Y+ PGP Y LP + G   HDP + FK  PA++ G R+   ++D+ PGP Y V S L RTG A +  +SL+ RP       TP PG Y+ E +    ++S+P+YS   +      D TPGP  Y+L  ML       K SAP+YSL SR KIG F EDL KTPGPG Y + + +TY+ K P  ++++RN LPGD + KPGPG Y P           P +SFG  HS+Y   LI++ +
Sbjct:   16 RRRGPIAALYSGPGPKYALPGVTGHSLHDP-TKFKN-PAYSFGARHAHFKEDTSPGPCYLVPSALTRTGRAGTPHYSLYGRPREPGLFKTPGPGSYSPERAGTAAFRSAPSYSLTARTDSFHRDQTPGPAKYMLPAMLGPHV-INKSSAPTYSLSSRGKIGSFHEDLQKTPGPGTYHMVESNTYRNKPPQYSLTARNSLPGDTTRKPGPGAYSPEKVVTLTHLQAPGYSFGLRHSEYVAPLIIHTE 258          
BLAST of Outer dense fiber protein 3 vs. Ensembl Sea Lamprey
Match: odf3l2b (outer dense fiber of sperm tails 3-like 2b [Source:ZFIN;Acc:ZDB-GENE-080723-64])

HSP 1 Score: 94.3597 bits (233), Expect = 2.870e-23
Identity = 69/191 (36.13%), Postives = 91/191 (47.64%), Query Frame = 1
Query:  247 PGPAYKVESNLLRTGPATSFSFSLHSRPNYLENDF-TPDPGRYNYESSINRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYK-RKLPAITISSRNPLPGDNSVKPGPGTYYPP-----NRDNGPAFSFGSHHSQYRGHLIV 798
            PGP Y   S L R G   S  +S+  R       F TP PG Y  E         +PAYS   + + ++ D+ P PN Y L   L       + SAPS+S+ +R  +GG +EDL +TPGP  Y     S  +  + PA ++ SR+ LPGDN+ KPGPG + P           P F  G  HS Y   LI 
Sbjct:   21 PGPKYYSPS-LTRHGLEGSPVYSIQGRHRERTLAFRTPGPGAYASERLFPPSEARAPAYSLAERTASRSVDLVPAPNAYSLPSTLGSHLPHRR-SAPSFSVSARRPVGGHAEDLARTPGPARYDAAHASDLRPHRAPAWSLQSRSRLPGDNTQKPGPGAHRPETCVSVTTRRAPTFRMGVRHSDYVMPLIC 209          
BLAST of Outer dense fiber protein 3 vs. Ensembl Nematostella
Match: EDO37545 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFE9])

HSP 1 Score: 153.295 bits (386), Expect = 7.034e-45
Identity = 96/248 (38.71%), Postives = 138/248 (55.65%), Query Frame = 1
Query:   73 ITMTKRRGPIGAEYTSPGPI-YPLPSLLGRQNHDPRSSFKRAPAWALGDRYGKLRDDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLENDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPP----NRDNGPAFSFGSHHSQYRGHLIVN 801
            +++ ++R  I A +  PGP  Y LP   G  +HDPR   K  PAW+ G + G    + GPGPAY + + + RTG   + +++LH R    +   TP PG Y  E       + +P+YSFG +      D TP  N Y L P +       K + P+YS+ +R KIG F EDL KTPGPG Y V +    K+++PA +++ RN + GDN++KPGPG + P     ++ N P FSFG  HS+Y   LIV+
Sbjct:    1 MSVEQKRPQIAAMFRGPGPAKYRLPGGCGYNDHDPRKHKK--PAWSFGLKLGLKSQNVGPGPAYLIPARITRTGTDGTPAYTLHDRTQLNKAFSTPAPGAYAPEKQRVPHQRWAPSYSFGSRTPYAKRDATPAANAYSL-PNVVGPKAVGKTALPAYSMSARLKIGAFHEDLQKTPGPGTYKVHNPDYNKKRMPAYSMNGRNYMTGDNTLKPGPGAHSPEKVYVHKRNAPRFSFGIRHSEYIAPLIVD 245          
BLAST of Outer dense fiber protein 3 vs. Ensembl Nematostella
Match: EDO35554 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL54])

HSP 1 Score: 145.976 bits (367), Expect = 6.167e-42
Identity = 96/253 (37.94%), Postives = 135/253 (53.36%), Query Frame = 1
Query:   73 ITMTKRRGPIGAEYTSPGPI-YPLPSLLGRQNHDPRSSFKRAPAWALGDRYGKLRDDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLENDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPP----NRDNGPAFSFGSHHSQYRGHLIVNDDVED 816
            +  T++   I A+   PGP  Y LP  +G++NHD R +    PA++ G R+        PGP Y V S L + G   + +FSL+SR         P PG Y+ E       + +P+YSFG +       +TP PN Y L P L+      K SA +YSL  R+  GGFSEDL KTPGPG Y V     Y++++ A +++ RN +PGD++ KPGPG + P     ++   P  SFG  HS+Y   L+V  DV D
Sbjct:    5 VDCTEKEITIAAKCRGPGPAKYLLPGTVGKKNHDVRKTTN--PAFSFGQRHRDFFTQISPGPKYMVPSGLTQCGKDGTPAFSLYSRAKEKNLSHVPGPGEYSPEKHSIPHERKAPSYSFGSRTKYAQKQITPSPNSYSL-PALTGPKVVNKTSAAAYSLTGRSNNGGFSEDLQKTPGPGTYKVTSPDKYRKRMAAYSMNGRNFMPGDSTQKPGPGQHSPEKVVMHQKAAPKVSFGIKHSEYSLPLVV--DVLD 252          
BLAST of Outer dense fiber protein 3 vs. Ensembl Nematostella
Match: EDO39533 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9T2])

HSP 1 Score: 121.709 bits (304), Expect = 1.014e-32
Identity = 88/246 (35.77%), Postives = 126/246 (51.22%), Query Frame = 1
Query:  100 IGAEYTSPGP-IYPLPSLLGRQNHDPRSSFKRAPAWALGDRY--GKLRDDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLENDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPP----NRDNGPAFSFGSHHSQYRGHLIVNDDVED 816
            I A    PGP  Y LPS  G   HD   +  RAPA++ G R      + D  PGP Y+++ ++ + G   + S+S+  R        TP PG Y+ E    +  + +PAYS G +   +  D +P PN Y L  +L     ++  SA SYS+  R   G FSEDL K PGPG Y+    +TYK + P  ++  R+ +PGD++ KPGPG + P     N+   P  S G  HS++   LI+  DV D
Sbjct:   15 IAARERGPGPGRYGLPSTCGFPEHD--FTKNRAPAYSFGTRLENSMFKKDCSPGPGYRIDPSITKHGKDGTPSYSVLGRQRDPNTFKTPAPGAYSPEKVHPQGERHAPAYSMGGRTRYRKRDASPSPNAYNLPQLLGPKVPNKYSSA-SYSMTGRATTGSFSEDLAKAPGPGKYNTTIPNTYKNRQPQYSMLGRSYMPGDSTKKPGPGAHSPEKVYINKHQAPKISLGIRHSEFITPLII--DVSD 255          
BLAST of Outer dense fiber protein 3 vs. Ensembl Medaka
Match: odf3b (outer dense fiber protein 3-B [Source:NCBI gene;Acc:101159189])

HSP 1 Score: 162.155 bits (409), Expect = 1.087e-47
Identity = 101/248 (40.73%), Postives = 135/248 (54.44%), Query Frame = 1
Query:   85 KRRGPIGAEYTSPGPIYPLPSLLGRQNHDPRSSFKRAPAWALGDRYGKLRDDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLENDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPP----NRDNGPAFSFGSHHSQYRGHLIVNDDVED 816
            K RGP+ A Y SPGP Y LP L+G    DP     +AP ++ G R  K   +S PGP Y + SN+ R G   + +FS+ SR         P PG+Y+ E+S   I+ S PAYS   +    +T   PGP  Y L PML     +   S+P+Y+L  R+K G F ED+ K+PGP AY   D   YK+K P  +++ RN +PG+ + KPGPG Y P      R   P+F+FG  HSQY    I+  DVE 
Sbjct:   15 KPRGPVAALYGSPGPKYALPGLIGSAQRDPTKC--KAPVFSFGIRCEKANSNSSPGPTYLIPSNITRRGRNGTPAFSISSRSKQPLLFRAPGPGQYSPENSEKLIFHSPPAYSLSGRSKAGSTKQLPGPATYTLPPMLGPK-SAVTTSSPTYTLCGRSKSGSFHEDMAKSPGPAAYKAVDPYIYKQKPPHFSMTGRNFIPGEAAQKPGPGAYCPERVTFTRAKAPSFTFGLRHSQYVSPFIM--DVES 257          
BLAST of Outer dense fiber protein 3 vs. Ensembl Medaka
Match: odf3b (outer dense fiber protein 3-B [Source:NCBI gene;Acc:101159189])

HSP 1 Score: 137.502 bits (345), Expect = 2.381e-38
Identity = 87/225 (38.67%), Postives = 119/225 (52.89%), Query Frame = 1
Query:  154 GRQNHDPRSSFKRAPAWALGDRYGKLRDDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLENDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPP----NRDNGPAFSFGSHHSQYRGHLIVNDDVED 816
            G    DP     +AP ++ G R  K   +S PGP Y + SN+ R G   + +FS+ SR         P PG+Y+ E+S   I+ S PAYS   +    +T   PGP  Y L PML     +   S+P+Y+L  R+K G F ED+ K+PGP AY   D   YK+K P  +++ RN +PG+ + KPGPG Y P      R   P+F+FG  HSQY    I+  DVE 
Sbjct:   25 GSAQRDPTKC--KAPVFSFGIRCEKANSNSSPGPTYLIPSNITRRGRNGTPAFSISSRSKQPLLFRAPGPGQYSPENSEKLIFHSPPAYSLSGRSKAGSTKQLPGPATYTLPPMLGPK-SAVTTSSPTYTLCGRSKSGSFHEDMAKSPGPAAYKAVDPYIYKQKPPHFSMTGRNFIPGEAAQKPGPGAYCPERVTFTRAKAPSFTFGLRHSQYVSPFIM--DVES 244          
BLAST of Outer dense fiber protein 3 vs. Ensembl Medaka
Match: odf3l2a (outer dense fiber protein 3-like protein 2 [Source:NCBI gene;Acc:101159872])

HSP 1 Score: 109.768 bits (273), Expect = 8.578e-28
Identity = 90/256 (35.16%), Postives = 127/256 (49.61%), Query Frame = 1
Query:   79 MTKRRGPIGAEYTSPGP-IYPLPSLLGRQNHDPRSSFKR--APAWALGDRY--GKLRDDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLEND----FTPDPGRYNYESS--INRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPPNRDNG----PAFSFGSHHSQYRGHLIVN 801
            + ++R  I A    PGP  Y LP  +G  NHD    F +  +PA++   R     +  DS PGP Y V + L R G   + S+S   R + + N      TP PG Y+ E    +N   +  P+Y+ G +   ++ D  P PN Y L  +L       K S+ SYS   R K+G  +EDL KTPGPG YS  +   Y+++ P+ T+ SR   P  +S  PGPGTY P          P+FS G  HS+Y   L++N
Sbjct:    4 VVRQRPVISARERGPGPGRYALPPTVGFINHD----FTKPSSPAYSFRCRTSSAMVSVDSSPGPRYHVHAKLTRFGQMETPSYSFSGRGSQIGNKDVLFQTPGPGAYSPERVPPVNG-QRRPPSYTIGPRTRYRSVDPVPAPNSYSLPNLLGCQV-PHKTSSASYSFSCRRKVGAPTEDLAKTPGPGQYSSTNPDIYRQRQPSFTMQSRTKRPLYSSAIPGPGTYSPEKIHTHLPKPPSFSMGIRHSEYITPLVIN 253          
BLAST of Outer dense fiber protein 3 vs. Ensembl Medaka
Match: odf3l2b (outer dense fiber protein 3-like protein 2 [Source:NCBI gene;Acc:101156004])

HSP 1 Score: 104.76 bits (260), Expect = 5.484e-26
Identity = 86/253 (33.99%), Postives = 126/253 (49.80%), Query Frame = 1
Query:   79 MTKRRGPIGAEYTSPGP-IYPLPSLLGRQNHDPRSSFKRA--PAWAL-GDRYGKL-RDDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLENDF--TPDPGRYNYESSI-NRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPP----NRDNGPAFSFGSHHSQYRGHLIVN 801
            M K+  PI  +   PGP  Y LP  +G   HD    F +A  PA++  G    K+   DS PGP Y V +   R G   + S+S+  R   L+ +   TP PG Y+ E +    + ++ P+Y+ G +   ++ D  P PN Y L P+L       KP++ +Y++      GG S DL KTPGP  Y+    S Y  + PA +I  R  LP D + +PGPG Y P     ++   PAFS G  HS +   L+++
Sbjct:    1 MEKKYPPIAGKEKGPGPGRYGLPPTIGFIGHD----FTKAASPAYSFHGSMSTKMYHVDSSPGPQYHVSAKFTRFGKDGTPSYSMLGR-RKLQKELCHTPGPGAYSPEKAPPCGLQRTPPSYTMGARTHYRSVDQVPAPNKYSLPPLLGPHI-PNKPASANYTMSGSYSTGGASVDLAKTPGPCGYNCTAPSVYLSRQPAFSILGRPGLPRDGTERPGPGAYNPEKVTVHKARAPAFSMGIRHSDFVTPLVLD 247          
BLAST of Outer dense fiber protein 3 vs. Ensembl Medaka
Match: odf3l2b (outer dense fiber protein 3-like protein 2 [Source:NCBI gene;Acc:101156004])

HSP 1 Score: 103.219 bits (256), Expect = 2.805e-25
Identity = 86/251 (34.26%), Postives = 124/251 (49.40%), Query Frame = 1
Query:   79 MTKRRGPIGAEYTSPGP-IYPLPSLLGRQNHDPRSSFKRA--PAWAL-GDRYGKL-RDDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLENDF--TPDPGRYNYESSI-NRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPP----NRDNGPAFSFGSHHSQYRGHLI 795
            M K+  PI  +   PGP  Y LP  +G   HD    F +A  PA++  G    K+   DS PGP Y V +   R G   + S+S+  R   L+ +   TP PG Y+ E +    + ++ P+Y+ G +   ++ D  P PN Y L P+L       KP++ +Y++      GG S DL KTPGP  Y+    S Y  + PA +I  R  LP D + +PGPG Y P     ++   PAFS G  HS +   L+
Sbjct:    1 MEKKYPPIAGKEKGPGPGRYGLPPTIGFIGHD----FTKAASPAYSFHGSMSTKMYHVDSSPGPQYHVSAKFTRFGKDGTPSYSMLGR-RKLQKELCHTPGPGAYSPEKAPPCGLQRTPPSYTMGARTHYRSVDQVPAPNKYSLPPLLGPHI-PNKPASANYTMSGSYSTGGASVDLAKTPGPCGYNCTAPSVYLSRQPAFSILGRPGLPRDGTERPGPGAYNPEKVTVHKARAPAFSMGIRHSDFVTPLV 245          
BLAST of Outer dense fiber protein 3 vs. Planmine SMEST
Match: SMESG000019620.1 (SMESG000019620.1)

HSP 1 Score: 408.297 bits (1048), Expect = 1.112e-144
Identity = 213/246 (86.59%), Postives = 219/246 (89.02%), Query Frame = 1
Query:   79 MTKRRGPIGAEYTSPGPIYPLPSLLGRQNHDPRSSFKRAPAWALGDRYGKLRDDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLENDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPPNRDNGPAFSFGSHHSQYRGHLIVNDDVED 816
            MTKRRGPIGAEYTSPGPIYPLPSLLGRQNHDPRSSFKR        ++G L  D       +    ++  G   +FSFSLHSRPNYLENDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPPNRDNGPAFSFGSHHSQYRGHLIVNDDVED
Sbjct:    1 MTKRRGPIGAEYTSPGPIYPLPSLLGRQNHDPRSSFKRP-------QHGHLVTD------MENFGTIVVLGLHINFSFSLHSRPNYLENDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPPNRDNGPAFSFGSHHSQYRGHLIVNDDVED 233          
BLAST of Outer dense fiber protein 3 vs. Planmine SMEST
Match: SMESG000038718.1 (SMESG000038718.1)

HSP 1 Score: 251.906 bits (642), Expect = 9.312e-83
Identity = 128/245 (52.24%), Postives = 165/245 (67.35%), Query Frame = 1
Query:   91 RGPIGAEYTSPGPIYPLPSLLGRQNHDPRSSFKRAPAWALGDRYGKLRDDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLENDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPP----NRDNGPAFSFGSHHSQYRGHLIVNDDVE 813
            R PIGA Y+SPGP Y LP L+G   HDPRS   ++P W+ G R+GK +DDS PGP Y   S L RTG   S  +SL+SRP  L  D+ P PG Y  E++I ++Y  +P Y FG++   + TD TPGPNVY +DPML +T RS+KPSAP  S+ SR+KIGGF EDL KTPGPG Y V D   +K + P  +++SRNP+PGD + KPGPGTY       +R   P F+FG  HSQY+G +IVN+D++
Sbjct:    9 RRPIGAMYSSPGPQYMLPGLVGTTFHDPRSVHYKSPGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQYKGEMIVNNDID 253          
BLAST of Outer dense fiber protein 3 vs. Planmine SMEST
Match: SMESG000072745.1 (SMESG000072745.1)

HSP 1 Score: 167.162 bits (422), Expect = 7.786e-50
Identity = 101/247 (40.89%), Postives = 136/247 (55.06%), Query Frame = 1
Query:   91 RGPIGAEYTSPGPIYPLPSLLGRQNHDPRSSFKRAPAWALGDRYGKLR-DDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLENDFTPDPGRYNYESSINRI--YKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPP----NRDNGPAFSFGSHHSQYRGHLIVNDDV 810
            R  +GA  +SPGPIY LPS+  +      S++  +P W +G    + R    GPGP Y V+S LLR G + S  FS+  R +   N  TP P  Y  E S N+I   KS P+YS   + +    D  P PN Y + P L +++ S K SAP+YSL  R  IG F+EDL  TPGP  Y++P  +TYK KLPA ++  R  LP D+ +KPGPGTY P        + PA SFG  HS +    ++  D+
Sbjct:    9 RRSVGAMQSSPGPIYALPSIFDKNKVHHNSNYNNSPCWKIGSLINRNRFVTDGPGPCYNVDSKLLRNGFSRSEKFSIRGRSSEPANTITPGPDLYFTEKSTNKISHQKSVPSYSISGRPNQMKIDKNPAPNSYDIKPTLGRSYESRKVSAPAYSLYGRKVIGSFNEDLRDTPGPNKYALPSSNTYKSKLPAYSLYGRTQLPCDSVLKPGPGTYKPEKVAITTKSAPASSFGIKHSPFASGFVLPPDL 255          
BLAST of Outer dense fiber protein 3 vs. Planmine SMEST
Match: SMESG000061272.1 (SMESG000061272.1)

HSP 1 Score: 97.8265 bits (242), Expect = 1.675e-23
Identity = 80/253 (31.62%), Postives = 116/253 (45.85%), Query Frame = 1
Query:   82 TKRRGPIGAEYTSPGPIYPLPSLLGRQNHDPRSSFKRAPAWALGDRYGKLRDDSGPGP-AYKVESNLLRTGPATSFSFSLHSRPNYLENDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSL---LSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTY----YPPNRDNGPAFSFGSHHSQYRGHLIVNDDVED 816
            T+ R PI A++ +PGPIY  P+L+G + HD RS   +APA++ G +      D  PGP AY  ++ L   G  +   +S+    +    + TP P  Y+   + N ++  +P +  G   +  T +VTP PN Y L P       S+KPS P YS+   L  +K    S D    PGP  Y V     Y    P  T+ S    P    + P P  Y       +  + PAF+ G  HS Y+G       +ED
Sbjct:   12 TRPRMPIAAQFANPGPIYGAPTLVGEKGHDIRSVHVKAPAYSFGLKTFPHSQDQSPGPAAYGPDTKLTHHGYDSIPKYSIGQLLHPYAKEVTPGPSDYDITKANNVVWPKAPEHVMGKYLTESTANVTPAPNEYKLPP---PDITSDKPSGPKYSVGQYLHYDK----SRD---GPGPADYKVGSPDLYLTASPKYTMGSGAQCPDSRLLTPSPAHYKHEMVTSHLPSSPAFTMGIIHSPYKGEHFKEPPIED 254          
The following BLAST results are available for this feature:
BLAST of Outer dense fiber protein 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ODF36.796e-4139.18outer dense fiber of sperm tails 3 [Source:HGNC Sy... [more]
ODF3B3.602e-3837.92outer dense fiber of sperm tails 3B [Source:HGNC S... [more]
ODF3B3.602e-3837.92outer dense fiber of sperm tails 3B [Source:HGNC S... [more]
ODF3L23.687e-2633.63outer dense fiber of sperm tails 3 like 2 [Source:... [more]
ODF3L11.761e-2329.92outer dense fiber of sperm tails 3 like 1 [Source:... [more]
back to top
BLAST of Outer dense fiber protein 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Outer dense fiber protein 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG80861.777e-2633.88gene:FBgn0032010 transcript:FBtr0332362[more]
CG102521.105e-2333.62gene:FBgn0039104 transcript:FBtr0084475[more]
CG80866.472e-2332.64gene:FBgn0032010 transcript:FBtr0079620[more]
CG80861.052e-2232.64gene:FBgn0032010 transcript:FBtr0079621[more]
CG80862.060e-2032.64gene:FBgn0032010 transcript:FBtr0332360[more]
back to top
BLAST of Outer dense fiber protein 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
odf3b1.315e-5141.63outer dense fiber of sperm tails 3B [Source:NCBI g... [more]
odf3b1.315e-5141.63tripartite motif containing 35-30 [Source:ZFIN;Acc... [more]
odf3b1.315e-5141.63tripartite motif containing 35-30 [Source:ZFIN;Acc... [more]
odf3b1.834e-5141.63outer dense fiber of sperm tails 3B [Source:NCBI g... [more]
odf3l2a3.709e-2935.77outer dense fiber of sperm tails 3-like 2a [Source... [more]
back to top
BLAST of Outer dense fiber protein 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
scml22.089e-5444.31Scm polycomb group protein like 2 [Source:Xenbase... [more]
ODF3L21.684e-2835.39outer dense fiber of sperm tails 3-like 1 [Source:... [more]
back to top
BLAST of Outer dense fiber protein 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Odf31.676e-3937.96outer dense fiber of sperm tails 3 [Source:MGI Sym... [more]
Odf33.111e-3937.96outer dense fiber of sperm tails 3 [Source:MGI Sym... [more]
Odf3b4.433e-3738.98outer dense fiber of sperm tails 3B [Source:MGI Sy... [more]
Odf3b4.002e-3440.28outer dense fiber of sperm tails 3B [Source:MGI Sy... [more]
Odf3l21.190e-2633.62outer dense fiber of sperm tails 3-like 2 [Source:... [more]
back to top
BLAST of Outer dense fiber protein 3 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8AVY1|ODF3A_XENLA1.251e-5545.53Outer dense fiber protein 3 OS=Xenopus laevis OX=8... [more]
sp|Q5EB30|ODF3A_XENTR1.106e-5344.31Outer dense fiber protein 3 OS=Xenopus tropicalis ... [more]
sp|A3KQA5|ODF3B_DANRE9.929e-5141.63Outer dense fiber protein 3-B OS=Danio rerio OX=79... [more]
sp|Q2TBH0|ODF3A_BOVIN2.349e-4038.68Outer dense fiber protein 3 OS=Bos taurus OX=9913 ... [more]
sp|Q96PU9|ODF3A_HUMAN3.264e-4039.18Outer dense fiber protein 3 OS=Homo sapiens OX=960... [more]
back to top
BLAST of Outer dense fiber protein 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|182228494.500e-7249.80tr|A0A1I8H174|A0A1I8H174_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|183098091.016e-7149.01tr|A0A267EQJ8|A0A267EQJ8_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|183389991.562e-7048.62tr|A0A267F4K0|A0A267F4K0_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|182305467.748e-7050.20tr|A0A267GE88|A0A267GE88_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|182153338.866e-7050.20tr|A0A267GW94|A0A267GW94_9PLAT Uncharacterized pro... [more]
back to top
BLAST of Outer dense fiber protein 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
odf3b1.756e-5041.74outer dense fiber of sperm tails 3B [Source:NCBI g... [more]
odf3l2b3.329e-2833.46outer dense fiber protein 3-like protein 2 [Source... [more]
odf3l2a2.185e-2634.25outer dense fiber protein 3-like protein 2 [Source... [more]
back to top
BLAST of Outer dense fiber protein 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
odf3b2.380e-5443.50tripartite motif containing 35-30 [Source:ZFIN;Acc... [more]
odf3l2b2.870e-2336.13outer dense fiber of sperm tails 3-like 2b [Source... [more]
back to top
BLAST of Outer dense fiber protein 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Outer dense fiber protein 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO375457.034e-4538.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355546.167e-4237.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO395331.014e-3235.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Outer dense fiber protein 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
odf3b1.087e-4740.73outer dense fiber protein 3-B [Source:NCBI gene;Ac... [more]
odf3b2.381e-3838.67outer dense fiber protein 3-B [Source:NCBI gene;Ac... [more]
odf3l2a8.578e-2835.16outer dense fiber protein 3-like protein 2 [Source... [more]
odf3l2b5.484e-2633.99outer dense fiber protein 3-like protein 2 [Source... [more]
odf3l2b2.805e-2534.26outer dense fiber protein 3-like protein 2 [Source... [more]
back to top
BLAST of Outer dense fiber protein 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000019620.11.112e-14486.59SMESG000019620.1[more]
SMESG000038718.19.312e-8352.24SMESG000038718.1[more]
SMESG000072745.17.786e-5040.89SMESG000072745.1[more]
SMESG000061272.11.675e-2331.62SMESG000061272.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029463 ID=SMED30029463|Name=Outer dense fiber protein 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1012bp
TATTCATAACCAAAGCGATAAAAAGTAATATTTTTGATATCAAAATACTA
GTTCAAGATCACTTTATAATTAATTACAATGACAAAAAGGAGAGGACCTA
TTGGAGCTGAATATACCAGCCCTGGTCCAATTTATCCATTACCATCATTG
TTGGGCCGACAAAATCACGATCCTCGCTCTTCGTTTAAACGGGCCCCAGC
ATGGGCACTTGGTGACAGATATGGAAAACTTCGGGACGATAGTGGTCCTG
GGCCTGCATATAAAGTCGAATCAAATTTATTAAGAACCGGACCGGCAACA
AGCTTTTCTTTCTCTCTCCATTCACGACCGAACTATCTCGAGAATGATTT
CACTCCAGATCCAGGACGATATAATTATGAAAGTTCTATAAATAGAATTT
ATAAAAGTTCACCTGCTTACTCTTTCGGTTTAAAGCGTTCCGGTAAAACA
ACAGATGTTACACCAGGACCCAATGTTTATTTGTTGGATCCGATGTTGTC
AAAAACTTTCAGAAGTGAAAAACCCAGTGCACCAAGTTATAGTTTGCTTT
CAAGAAATAAAATTGGAGGATTTAGTGAAGATTTAACGAAAACTCCAGGA
CCCGGAGCTTATAGTGTTCCTGATTTCTCAACATACAAAAGGAAATTGCC
TGCTATAACAATATCTAGCAGAAATCCTCTGCCTGGTGATAATTCTGTGA
AACCTGGACCCGGCACTTATTATCCACCTAATAGAGACAACGGACCTGCC
TTTAGTTTCGGATCCCATCACAGTCAATATAGAGGACATTTAATTGTTAA
TGATGATGTTGAGGATTAAATATTAAATTTTCGTGCTGGATCAAAATTTG
TTTTATATATATATATATTTGATTATAGAAAACAGATTATAACAGATTAT
TATTTGTCCTAGTGATTTTGTTTGATTGTGTGATTTCTAGGTCGTTTGAT
CGTCATTGATGTGATTGCAAATATTTTTTAAAAATAAAACTTGAATTAAA
AAGATCGGAGGA
back to top

protein sequence of SMED30029463-orf-1

>SMED30029463-orf-1 ID=SMED30029463-orf-1|Name=SMED30029463-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=247bp
MTKRRGPIGAEYTSPGPIYPLPSLLGRQNHDPRSSFKRAPAWALGDRYGK
LRDDSGPGPAYKVESNLLRTGPATSFSFSLHSRPNYLENDFTPDPGRYNY
ESSINRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPS
APSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNP
LPGDNSVKPGPGTYYPPNRDNGPAFSFGSHHSQYRGHLIVNDDVED*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR010736SHIPPO-rpt
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR010736Sperm-tail PG-rich repeatPFAMPF07004SHIPPO-rptcoord: 34..62
e-value: 0.0022
score: 18.8
coord: 71..91
e-value: 0.0025
score: 18.7
NoneNo IPR availablePANTHERPTHR21580SHIPPO-1-RELATEDcoord: 4..96
NoneNo IPR availablePANTHERPTHR21580:SF9OUTER DENSE FIBER PROTEIN 3-Bcoord: 4..96