Succinyl-CoA:3-ketoacid-coenzyme A transferase

Overview
NameSuccinyl-CoA:3-ketoacid-coenzyme A transferase
Smed IDSMED30029450
Length (bp)479
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Succinyl-CoA:3-ketoacid-coenzyme A transferase (SMED30029450) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Succinyl-CoA:3-ketoacid-coenzyme A transferase (SMED30029450) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029450

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
tail regionSMED30029450SMESG000080424.1 SmedASXL_016550SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30029450SMESG000080424.1 dd_Smed_v4_1189_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029450SMESG000080424.1 dd_Smed_v4_1189_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30029450SMESG000080424.1 dd_Smed_v4_1189_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029450SMESG000080424.1 dd_Smed_v4_1189_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029450SMESG000080934.1 SMESG000080424.1 SMESG000079283.1 SMESG000076702.1 SMESG000076680.1 SMESG000064484.1 SMESG000057323.1 SMESG000056845.1 SMESG000050587.1 SMESG000046239.1 SMESG000020034.1 SMESG000018611.1 SMESG000017693.1 SMESG000007977.1 Contig12524newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029450SMESG000080934.1 SMESG000080424.1 SMESG000079283.1 SMESG000076702.1 SMESG000076680.1 SMESG000064484.1 SMESG000057323.1 SMESG000056845.1 SMESG000050587.1 SMESG000046239.1 SMESG000020034.1 SMESG000018611.1 SMESG000017693.1 SMESG000007977.1 Contig12524uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029450SMESG000080424.1 Contig46141newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029450SMESG000080424.1 Contig46141uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
tail regionSMED30029450SMESG000080424.1 dd_Smed_v6_1189_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Category 3 cellSMED30029450SMESG000080432.1 SMESG000080424.1 dd_Smed_v6_1189_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30029450SMESG000080424.1 dd_Smed_v4_1189_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Human
Match: OXCT1 (3-oxoacid CoA-transferase 1 [Source:HGNC Symbol;Acc:HGNC:8527])

HSP 1 Score: 154.451 bits (389), Expect = 4.508e-46
Identity = 85/160 (53.12%), Postives = 118/160 (73.75%), Query Frame = 1
Query:    1 MCKSANTTIVEVEQLVEIGEIDPDHIHIPGIYIDRILVGEKFEKRIEKKAYLGKKEKQETDPVKIKKAKE-RERILRRVALELENGMYVNVGIGMPMQLARYIPQDMIVALQSENGILGIGQYPSESEIDPDLISAAKETVTLKPGGXXXXXXXXXXMIR 477
            MCK+A TT+VEVE++V+IG   P+ IHIP IY+ R++ GEK+EKRIE+   L  +++ + +    K   + RERI++R ALE E+GMY N+GIG+P+  + +I  ++ V LQSENG+LG+G YP + E D DLI+A KETVT+ PG SFFSSD SF+MIR
Sbjct:   48 MCKAAETTVVEVEEIVDIGAFAPEDIHIPQIYVHRLIKGEKYEKRIER---LSIRKEGDGEAKSAKPGDDVRERIIKRAALEFEDGMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHEADADLINAGKETVTILPGASFFSSDESFAMIR 204          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Human
Match: OXCT1 (3-oxoacid CoA-transferase 1 [Source:HGNC Symbol;Acc:HGNC:8527])

HSP 1 Score: 154.836 bits (390), Expect = 1.143e-44
Identity = 85/160 (53.12%), Postives = 118/160 (73.75%), Query Frame = 1
Query:    1 MCKSANTTIVEVEQLVEIGEIDPDHIHIPGIYIDRILVGEKFEKRIEKKAYLGKKEKQETDPVKIKKAKE-RERILRRVALELENGMYVNVGIGMPMQLARYIPQDMIVALQSENGILGIGQYPSESEIDPDLISAAKETVTLKPGGXXXXXXXXXXMIR 477
            MCK+A TT+VEVE++V+IG   P+ IHIP IY+ R++ GEK+EKRIE+   L  +++ + +    K   + RERI++R ALE E+GMY N+GIG+P+  + +I  ++ V LQSENG+LG+G YP + E D DLI+A KETVT+ PG SFFSSD SF+MIR
Sbjct:  234 MCKAAETTVVEVEEIVDIGAFAPEDIHIPQIYVHRLIKGEKYEKRIER---LSIRKEGDGEAKSAKPGDDVRERIIKRAALEFEDGMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHEADADLINAGKETVTILPGASFFSSDESFAMIR 390          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Human
Match: OXCT2 (3-oxoacid CoA-transferase 2 [Source:HGNC Symbol;Acc:HGNC:18606])

HSP 1 Score: 142.895 bits (359), Expect = 3.217e-40
Identity = 84/159 (52.83%), Postives = 116/159 (72.96%), Query Frame = 1
Query:    1 MCKSANTTIVEVEQLVEIGEIDPDHIHIPGIYIDRILVGEKFEKRIEKKAYLGKKEKQETDPVKIKKAKERERILRRVALELENGMYVNVGIGMPMQLARYIPQDMIVALQSENGILGIGQYPSESEIDPDLISAAKETVTLKPGGXXXXXXXXXXMIR 477
            MCK+A+ T VEVE++VE+G   P+ IH+P IY+DR++ G+K+EKRIE+   L     +E D    K+   R RI+RR ALE E+GMY N+GIG+P+  + +I   M V L SENGILG+G +P+E E+D DLI+A K+TVT+ PGG FF+SD+SF+MIR
Sbjct:  234 MCKAADVTAVEVEEIVEVGAFPPEDIHVPNIYVDRVIKGQKYEKRIERLTIL-----KEEDGDAGKEEDARTRIIRRAALEFEDGMYANLGIGIPLLASNFISPSMTVHLHSENGILGLGPFPTEDEVDADLINAGKQTVTVLPGGCFFASDDSFAMIR 387          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Celegans
Match: C05C10.3 (Probable succinyl-CoA:3-ketoacid coenzyme A transferase, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q09450])

HSP 1 Score: 133.265 bits (334), Expect = 4.817e-37
Identity = 74/159 (46.54%), Postives = 98/159 (61.64%), Query Frame = 1
Query:    1 MCKSANTTIVEVEQLVEIGEIDPDHIHIPGIYIDRILVGEKFEKRIEKKAYLGKKEKQETDPVKIKKAKERERILRRVALELENGMYVNVGIGMPMQLARYIPQDMIVALQSENGILGIGQYPSESEIDPDLISAAKETVTLKPGGXXXXXXXXXXMIR 477
            MCK++  TIVEVE++VE G I P+ +HIP IY  R+++G+ ++K IE+  +     +    P      K RE I  R ALE  +GMY N+GIG+P     YIP    V LQSENGI+G+G YP +   D DLI+A KE +TL  G S   SD SF+MIR
Sbjct:  233 MCKASKCTIVEVEEIVEPGVIAPNDVHIPSIYCHRLVLGKNYKKPIERPMF---AHEGPIKPSTSAAGKSREIIAARAALEFTDGMYANLGIGIPTLAPNYIPNGFTVHLQSENGIIGVGPYPRKGTEDADLINAGKEPITLLKGASIVGSDESFAMIR 388          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Fly
Match: SCOT (gene:FBgn0035298 transcript:FBtr0333431)

HSP 1 Score: 156.377 bits (394), Expect = 3.906e-46
Identity = 82/159 (51.57%), Postives = 113/159 (71.07%), Query Frame = 1
Query:    1 MCKSANTTIVEVEQLVEIGEIDPDHIHIPGIYIDRILVGEKFEKRIEKKAYLGKKEKQETDPVKIKKAKERERILRRVALELENGMYVNVGIGMPMQLARYIPQDMIVALQSENGILGIGQYPSESEIDPDLISAAKETVTLKPGGXXXXXXXXXXMIR 477
            MC++A  T+ EVE++V IG + PD IH+PGIYI+RI  G  + KR+E+      K+  +  P        RERI RRVALE  +GMY N+GIG+P+  + YIP+ M V LQSENGILG+G +P++ ++DPDLI+A KE+VT+ PG S+F SD+SF+MIR
Sbjct:  162 MCRAAKITVAEVEEIVPIGALSPDEIHVPGIYINRIFKGTNYNKRVERLRITEPKDPSKPAPPPNPAQVLRERIARRVALEFHDGMYANLGIGIPVLSSNYIPKGMNVMLQSENGILGLGPFPTKDKVDPDLINAGKESVTVVPGASYFGSDDSFAMIR 320          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Fly
Match: SCOT (gene:FBgn0035298 transcript:FBtr0072843)

HSP 1 Score: 156.377 bits (394), Expect = 1.017e-45
Identity = 82/159 (51.57%), Postives = 113/159 (71.07%), Query Frame = 1
Query:    1 MCKSANTTIVEVEQLVEIGEIDPDHIHIPGIYIDRILVGEKFEKRIEKKAYLGKKEKQETDPVKIKKAKERERILRRVALELENGMYVNVGIGMPMQLARYIPQDMIVALQSENGILGIGQYPSESEIDPDLISAAKETVTLKPGGXXXXXXXXXXMIR 477
            MC++A  T+ EVE++V IG + PD IH+PGIYI+RI  G  + KR+E+      K+  +  P        RERI RRVALE  +GMY N+GIG+P+  + YIP+ M V LQSENGILG+G +P++ ++DPDLI+A KE+VT+ PG S+F SD+SF+MIR
Sbjct:  214 MCRAAKITVAEVEEIVPIGALSPDEIHVPGIYINRIFKGTNYNKRVERLRITEPKDPSKPAPPPNPAQVLRERIARRVALEFHDGMYANLGIGIPVLSSNYIPKGMNVMLQSENGILGLGPFPTKDKVDPDLINAGKESVTVVPGASYFGSDDSFAMIR 372          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Fly
Match: SCOT (gene:FBgn0035298 transcript:FBtr0072844)

HSP 1 Score: 156.377 bits (394), Expect = 1.215e-45
Identity = 82/159 (51.57%), Postives = 113/159 (71.07%), Query Frame = 1
Query:    1 MCKSANTTIVEVEQLVEIGEIDPDHIHIPGIYIDRILVGEKFEKRIEKKAYLGKKEKQETDPVKIKKAKERERILRRVALELENGMYVNVGIGMPMQLARYIPQDMIVALQSENGILGIGQYPSESEIDPDLISAAKETVTLKPGGXXXXXXXXXXMIR 477
            MC++A  T+ EVE++V IG + PD IH+PGIYI+RI  G  + KR+E+      K+  +  P        RERI RRVALE  +GMY N+GIG+P+  + YIP+ M V LQSENGILG+G +P++ ++DPDLI+A KE+VT+ PG S+F SD+SF+MIR
Sbjct:  228 MCRAAKITVAEVEEIVPIGALSPDEIHVPGIYINRIFKGTNYNKRVERLRITEPKDPSKPAPPPNPAQVLRERIARRVALEFHDGMYANLGIGIPVLSSNYIPKGMNVMLQSENGILGLGPFPTKDKVDPDLINAGKESVTVVPGASYFGSDDSFAMIR 386          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Zebrafish
Match: oxct1b (3-oxoacid CoA transferase 1b [Source:ZFIN;Acc:ZDB-GENE-060929-212])

HSP 1 Score: 175.637 bits (444), Expect = 1.260e-52
Identity = 93/159 (58.49%), Postives = 122/159 (76.73%), Query Frame = 1
Query:    1 MCKSANTTIVEVEQLVEIGEIDPDHIHIPGIYIDRILVGEKFEKRIEKKAYLGKKEKQETDPVKIKKAKERERILRRVALELENGMYVNVGIGMPMQLARYIPQDMIVALQSENGILGIGQYPSESEIDPDLISAAKETVTLKPGGXXXXXXXXXXMIR 477
            MCK+A  TIVEVE++V+IG  + + IHIPGIY+DR++ G  +EKRIEK+  L +  K+E   VK +    RERI+RR ALE ++GMY N+GIG+PM  + YI  D+ V LQSENGILG+G YP+ESE+DPDLI+A KETVT+ PG ++FSSD SF+MIR
Sbjct:  242 MCKAAKVTIVEVEEIVDIGSFNAEDIHIPGIYVDRVVKGASYEKRIEKR--LVQSGKEEKPKVKQESDITRERIIRRAALEFQDGMYANLGIGIPMLASNYISPDITVHLQSENGILGLGPYPTESEVDPDLINAGKETVTVYPGAAYFSSDESFAMIR 398          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Zebrafish
Match: oxct1a (3-oxoacid CoA transferase 1a [Source:ZFIN;Acc:ZDB-GENE-040723-3])

HSP 1 Score: 160.999 bits (406), Expect = 3.212e-47
Identity = 89/161 (55.28%), Postives = 119/161 (73.91%), Query Frame = 1
Query:    1 MCKSANTTIVEVEQLVEIGEIDPDHIHIPGIYIDRILVGEKFEKRIEKKAYLGKKEKQETDPVKIKKAKE--RERILRRVALELENGMYVNVGIGMPMQLARYIPQDMIVALQSENGILGIGQYPSESEIDPDLISAAKETVTLKPGGXXXXXXXXXXMIR 477
            MCK+A TTIVEVE++V++G    + IHIP IY+ RI+ G+ +EKRIE++     K+ Q  +P K KK  +  RERI+RR ALE E+GMY N+GIG+PM  + +I  D+ V LQSENGILG+G YP+E  +D DLI+A KETVT+ PG ++FSSD SF+MIR
Sbjct:  241 MCKAAKTTIVEVEEIVDVGTFASEDIHIPSIYVHRIVNGDHYEKRIERRTV---KKAQAENP-KPKKDSDIVRERIIRRAALEFEDGMYANLGIGIPMLASNFIKPDITVHLQSENGILGLGPYPTEDAVDADLINAGKETVTILPGAAYFSSDESFAMIR 397          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Zebrafish
Match: oxct1a (3-oxoacid CoA transferase 1a [Source:ZFIN;Acc:ZDB-GENE-040723-3])

HSP 1 Score: 145.591 bits (366), Expect = 3.251e-41
Identity = 90/196 (45.92%), Postives = 120/196 (61.22%), Query Frame = 1
Query:    1 MCKSANTTIVEVEQLVEIGEIDPDHIHIPGIYIDRILVGEKFEKRIEKK----------AYLGK-------------------------KEKQETDPVKIKKAKE--RERILRRVALELENGMYVNVGIGMPMQLARYIPQDMIVALQSENGILGIGQYPSESEIDPDLISAAKETVTLKPGGXXXXXXXXXXMIR 477
            MCK+A TTIVEVE++V++G    + IHIP IY+ RI+ G+ +EKRIE             +L +                         K+ Q  +P K KK  +  RERI+RR ALE E+GMY N+GIG+PM  + +I  D+ V LQSENGILG+G YP+E  +D DLI+A KETVT+ PG ++FSSD SF+MIR
Sbjct:  241 MCKAAKTTIVEVEEIVDVGTFASEDIHIPSIYVHRIVNGDHYEKRIEVSWHDLTGLFLSVFLDQSNLCHLLSLIAVVILLTDLLQRRTVKKAQAENP-KPKKDSDIVRERIIRRAALEFEDGMYANLGIGIPMLASNFIKPDITVHLQSENGILGLGPYPTEDAVDADLINAGKETVTILPGAAYFSSDESFAMIR 435          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Xenopus
Match: mettl18 (methyltransferase like 18 [Source:Xenbase;Acc:XB-GENE-5811219])

HSP 1 Score: 141.739 bits (356), Expect = 6.965e-40
Identity = 84/161 (52.17%), Postives = 117/161 (72.67%), Query Frame = 1
Query:    1 MCKSANTTIVEVEQLVEIGEIDPDHIHIPGIYIDRILVGEKFEKRIEKKAYLGKKEKQETDPVKIKKAKE--RERILRRVALELENGMYVNVGIGMPMQLARYIPQDMIVALQSENGILGIGQYPSESEIDPDLISAAKETVTLKPGGXXXXXXXXXXMIR 477
            MCK+A  T+VEVE++VE G   P+ +HIP IY+DR++ G  ++K+IE+        K E    K KK  +  RERI+RR ALE ++GMY N+GIG+PM  + +I +D+ V LQSENG+LG+G YP + E+DPDLI+A KETVT+ PG ++FSSD+SF+MIR
Sbjct:  244 MCKAAKVTVVEVEEIVETGTFAPEDVHIPSIYVDRVIKGNGYQKKIERLTL----RKSENSKPKPKKDSDIVRERIIRRAALEFQDGMYANLGIGIPMLASNFIKKDITVHLQSENGVLGLGPYPLQEEVDPDLINAGKETVTVLPGAAYFSSDDSFAMIR 400          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Xenopus
Match: mettl18 (methyltransferase like 18 [Source:Xenbase;Acc:XB-GENE-5811219])

HSP 1 Score: 140.969 bits (354), Expect = 1.036e-39
Identity = 84/161 (52.17%), Postives = 117/161 (72.67%), Query Frame = 1
Query:    1 MCKSANTTIVEVEQLVEIGEIDPDHIHIPGIYIDRILVGEKFEKRIEKKAYLGKKEKQETDPVKIKKAKE--RERILRRVALELENGMYVNVGIGMPMQLARYIPQDMIVALQSENGILGIGQYPSESEIDPDLISAAKETVTLKPGGXXXXXXXXXXMIR 477
            MCK+A  T+VEVE++VE G   P+ +HIP IY+DR++ G  ++K+IE+        K E    K KK  +  RERI+RR ALE ++GMY N+GIG+PM  + +I +D+ V LQSENG+LG+G YP + E+DPDLI+A KETVT+ PG ++FSSD+SF+MIR
Sbjct:  209 MCKAAKVTVVEVEEIVETGTFAPEDVHIPSIYVDRVIKGNGYQKKIERLTL----RKSENSKPKPKKDSDIVRERIIRRAALEFQDGMYANLGIGIPMLASNFIKKDITVHLQSENGVLGLGPYPLQEEVDPDLINAGKETVTVLPGAAYFSSDDSFAMIR 365          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Xenopus
Match: mettl18 (methyltransferase like 18 [Source:Xenbase;Acc:XB-GENE-5811219])

HSP 1 Score: 140.969 bits (354), Expect = 1.053e-39
Identity = 84/161 (52.17%), Postives = 117/161 (72.67%), Query Frame = 1
Query:    1 MCKSANTTIVEVEQLVEIGEIDPDHIHIPGIYIDRILVGEKFEKRIEKKAYLGKKEKQETDPVKIKKAKE--RERILRRVALELENGMYVNVGIGMPMQLARYIPQDMIVALQSENGILGIGQYPSESEIDPDLISAAKETVTLKPGGXXXXXXXXXXMIR 477
            MCK+A  T+VEVE++VE G   P+ +HIP IY+DR++ G  ++K+IE+        K E    K KK  +  RERI+RR ALE ++GMY N+GIG+PM  + +I +D+ V LQSENG+LG+G YP + E+DPDLI+A KETVT+ PG ++FSSD+SF+MIR
Sbjct:  212 MCKAAKVTVVEVEEIVETGTFAPEDVHIPSIYVDRVIKGNGYQKKIERLTL----RKSENSKPKPKKDSDIVRERIIRRAALEFQDGMYANLGIGIPMLASNFIKKDITVHLQSENGVLGLGPYPLQEEVDPDLINAGKETVTVLPGAAYFSSDDSFAMIR 368          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Xenopus
Match: mettl18 (methyltransferase like 18 [Source:Xenbase;Acc:XB-GENE-5811219])

HSP 1 Score: 141.739 bits (356), Expect = 1.091e-39
Identity = 84/161 (52.17%), Postives = 117/161 (72.67%), Query Frame = 1
Query:    1 MCKSANTTIVEVEQLVEIGEIDPDHIHIPGIYIDRILVGEKFEKRIEKKAYLGKKEKQETDPVKIKKAKE--RERILRRVALELENGMYVNVGIGMPMQLARYIPQDMIVALQSENGILGIGQYPSESEIDPDLISAAKETVTLKPGGXXXXXXXXXXMIR 477
            MCK+A  T+VEVE++VE G   P+ +HIP IY+DR++ G  ++K+IE+        K E    K KK  +  RERI+RR ALE ++GMY N+GIG+PM  + +I +D+ V LQSENG+LG+G YP + E+DPDLI+A KETVT+ PG ++FSSD+SF+MIR
Sbjct:  244 MCKAAKVTVVEVEEIVETGTFAPEDVHIPSIYVDRVIKGNGYQKKIERLTL----RKSENSKPKPKKDSDIVRERIIRRAALEFQDGMYANLGIGIPMLASNFIKKDITVHLQSENGVLGLGPYPLQEEVDPDLINAGKETVTVLPGAAYFSSDDSFAMIR 400          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Xenopus
Match: mettl18 (methyltransferase like 18 [Source:Xenbase;Acc:XB-GENE-5811219])

HSP 1 Score: 141.354 bits (355), Expect = 1.131e-39
Identity = 84/161 (52.17%), Postives = 117/161 (72.67%), Query Frame = 1
Query:    1 MCKSANTTIVEVEQLVEIGEIDPDHIHIPGIYIDRILVGEKFEKRIEKKAYLGKKEKQETDPVKIKKAKE--RERILRRVALELENGMYVNVGIGMPMQLARYIPQDMIVALQSENGILGIGQYPSESEIDPDLISAAKETVTLKPGGXXXXXXXXXXMIR 477
            MCK+A  T+VEVE++VE G   P+ +HIP IY+DR++ G  ++K+IE+        K E    K KK  +  RERI+RR ALE ++GMY N+GIG+PM  + +I +D+ V LQSENG+LG+G YP + E+DPDLI+A KETVT+ PG ++FSSD+SF+MIR
Sbjct:  229 MCKAAKVTVVEVEEIVETGTFAPEDVHIPSIYVDRVIKGNGYQKKIERLTL----RKSENSKPKPKKDSDIVRERIIRRAALEFQDGMYANLGIGIPMLASNFIKKDITVHLQSENGVLGLGPYPLQEEVDPDLINAGKETVTVLPGAAYFSSDDSFAMIR 385          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Mouse
Match: Oxct1 (3-oxoacid CoA transferase 1 [Source:MGI Symbol;Acc:MGI:1914291])

HSP 1 Score: 154.451 bits (389), Expect = 6.880e-45
Identity = 86/159 (54.09%), Postives = 114/159 (71.70%), Query Frame = 1
Query:    1 MCKSANTTIVEVEQLVEIGEIDPDHIHIPGIYIDRILVGEKFEKRIEKKAYLGKKEKQETDPVKIKKAKERERILRRVALELENGMYVNVGIGMPMQLARYIPQDMIVALQSENGILGIGQYPSESEIDPDLISAAKETVTLKPGGXXXXXXXXXXMIR 477
            MCK+A TT+VEVE++V+IG   P+ IHIP IY+ R++ GEK+EKRIE+ +   +KE              RERI++R ALE E+GMY N+GIG+P+  + +I  +M V LQSENG+LG+G YP + E D DLI+A KETVT+ PG SFFSSD SF+MIR
Sbjct:  234 MCKAAGTTVVEVEEIVDIGSFAPEDIHIPKIYVHRLIKGEKYEKRIERLSL--RKEGDGKGKSGKPGGDVRERIIKRAALEFEDGMYANLGIGIPLLASNFISPNMTVHLQSENGVLGLGPYPLKDEADADLINAGKETVTVLPGASFFSSDESFAMIR 390          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Mouse
Match: Oxct1 (3-oxoacid CoA transferase 1 [Source:MGI Symbol;Acc:MGI:1914291])

HSP 1 Score: 154.451 bits (389), Expect = 9.966e-45
Identity = 86/159 (54.09%), Postives = 114/159 (71.70%), Query Frame = 1
Query:    1 MCKSANTTIVEVEQLVEIGEIDPDHIHIPGIYIDRILVGEKFEKRIEKKAYLGKKEKQETDPVKIKKAKERERILRRVALELENGMYVNVGIGMPMQLARYIPQDMIVALQSENGILGIGQYPSESEIDPDLISAAKETVTLKPGGXXXXXXXXXXMIR 477
            MCK+A TT+VEVE++V+IG   P+ IHIP IY+ R++ GEK+EKRIE+ +   +KE              RERI++R ALE E+GMY N+GIG+P+  + +I  +M V LQSENG+LG+G YP + E D DLI+A KETVT+ PG SFFSSD SF+MIR
Sbjct:  234 MCKAAGTTVVEVEEIVDIGSFAPEDIHIPKIYVHRLIKGEKYEKRIERLSL--RKEGDGKGKSGKPGGDVRERIIKRAALEFEDGMYANLGIGIPLLASNFISPNMTVHLQSENGVLGLGPYPLKDEADADLINAGKETVTVLPGASFFSSDESFAMIR 390          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Mouse
Match: Oxct2b (3-oxoacid CoA transferase 2B [Source:MGI Symbol;Acc:MGI:2664115])

HSP 1 Score: 135.576 bits (340), Expect = 9.891e-38
Identity = 80/162 (49.38%), Postives = 115/162 (70.99%), Query Frame = 1
Query:    1 MCKSANTTIVEVEQLVEIGEIDPDHIHIPGIYIDRILVGEKFEKRIEKKAYLGKKE---KQETDPVKIKKAKERERILRRVALELENGMYVNVGIGMPMQLARYIPQDMIVALQSENGILGIGQYPSESEIDPDLISAAKETVTLKPGGXXXXXXXXXXMIR 477
            MCK+A+ ++VEVE++V++G   P+ IHIP IY+DR++ G KFEKRIE+      K     ++ DP        R RI++R ALE ++GMY N+GIG+P+  + YI   M V L SENGILG+G +P ++E+D D+I+A K+TVT+ PGG FF+SD+SF+MIR
Sbjct:  234 MCKAADISVVEVEEIVDVGTFAPEDIHIPNIYVDRVIKGPKFEKRIERLTTRDSKPAPGSKDNDP-------SRTRIIKRAALEFQDGMYANLGIGIPVLASNYISPKMTVYLHSENGILGLGPFPLKNEVDADVINAGKQTVTVVPGGCFFASDDSFAMIR 388          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Mouse
Match: Oxct2a (3-oxoacid CoA transferase 2A [Source:MGI Symbol;Acc:MGI:1891061])

HSP 1 Score: 135.191 bits (339), Expect = 1.720e-37
Identity = 79/162 (48.77%), Postives = 115/162 (70.99%), Query Frame = 1
Query:    1 MCKSANTTIVEVEQLVEIGEIDPDHIHIPGIYIDRILVGEKFEKRIEKKAYLGKKE---KQETDPVKIKKAKERERILRRVALELENGMYVNVGIGMPMQLARYIPQDMIVALQSENGILGIGQYPSESEIDPDLISAAKETVTLKPGGXXXXXXXXXXMIR 477
            MCK+A+ ++VEVE++V++G   P+ IH+P IY+DR++ G KFEKRIE+      K     ++ DP        R RI++R ALE ++GMY N+GIG+P+  + YI   M V L SENGILG+G +P ++E+D D+I+A K+TVT+ PGG FF+SD+SF+MIR
Sbjct:  234 MCKAADISVVEVEEIVDVGTFAPEDIHVPNIYVDRVIKGPKFEKRIERLTTRDSKPAPGSKDNDP-------SRTRIIKRAALEFQDGMYANLGIGIPVLASNYISPKMTVYLHSENGILGLGPFPLKNEVDADVINAGKQTVTVVPGGCFFASDDSFAMIR 388          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. UniProt/SwissProt
Match: sp|Q29551|SCOT1_PIG (Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Sus scrofa OX=9823 GN=OXCT1 PE=1 SV=2)

HSP 1 Score: 160.229 bits (404), Expect = 5.641e-46
Identity = 88/159 (55.35%), Postives = 121/159 (76.10%), Query Frame = 1
Query:    1 MCKSANTTIVEVEQLVEIGEIDPDHIHIPGIYIDRILVGEKFEKRIEKKAYLGKKEKQETDPVKIKKAKERERILRRVALELENGMYVNVGIGMPMQLARYIPQDMIVALQSENGILGIGQYPSESEIDPDLISAAKETVTLKPGGXXXXXXXXXXMIR 477
            MCK+A TT+VEVE++V+IG   P+ IHIP IY+ R++ GEK+EKRIE+ + + K+E  +T   K+     RERI++R ALE E+GMY N+GIG+P+  + +I  +M V LQSENGILG+G YP ++E+D DLI+A KETVT+ PG S+FSSD SF+MIR
Sbjct:  234 MCKAAETTVVEVEEIVDIGSFAPEDIHIPKIYVHRLVKGEKYEKRIERLS-VRKEEDVKTRSGKLGD-NVRERIIKRAALEFEDGMYANLGIGIPLLASNFISPNMTVHLQSENGILGLGPYPLQNEVDADLINAGKETVTVLPGASYFSSDESFAMIR 390          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. UniProt/SwissProt
Match: sp|Q9W058|SCOT_DROME (Succinyl-CoA:3-ketoacid-coenzyme A transferase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=SCOT PE=1 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 1.218e-44
Identity = 82/159 (51.57%), Postives = 113/159 (71.07%), Query Frame = 1
Query:    1 MCKSANTTIVEVEQLVEIGEIDPDHIHIPGIYIDRILVGEKFEKRIEKKAYLGKKEKQETDPVKIKKAKERERILRRVALELENGMYVNVGIGMPMQLARYIPQDMIVALQSENGILGIGQYPSESEIDPDLISAAKETVTLKPGGXXXXXXXXXXMIR 477
            MC++A  T+ EVE++V IG + PD IH+PGIYI+RI  G  + KR+E+      K+  +  P        RERI RRVALE  +GMY N+GIG+P+  + YIP+ M V LQSENGILG+G +P++ ++DPDLI+A KE+VT+ PG S+F SD+SF+MIR
Sbjct:  228 MCRAAKITVAEVEEIVPIGALSPDEIHVPGIYINRIFKGTNYNKRVERLRITEPKDPSKPAPPPNPAQVLRERIARRVALEFHDGMYANLGIGIPVLSSNYIPKGMNVMLQSENGILGLGPFPTKDKVDPDLINAGKESVTVVPGASYFGSDDSFAMIR 386          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. UniProt/SwissProt
Match: sp|B2GV06|SCOT1_RAT (Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Oxct1 PE=1 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 1.304e-44
Identity = 88/161 (54.66%), Postives = 116/161 (72.05%), Query Frame = 1
Query:    1 MCKSANTTIVEVEQLVEIGEIDPDHIHIPGIYIDRILVGEKFEKRIEKKAYLGKKEKQETDPVKIKKAKE--RERILRRVALELENGMYVNVGIGMPMQLARYIPQDMIVALQSENGILGIGQYPSESEIDPDLISAAKETVTLKPGGXXXXXXXXXXMIR 477
            MCK+A TT+VEVE++V+IG   P+ IHIP IY+ R++ GEK+EKRIE+ +      K+     K  K  E  RERI++R ALE E+GMY N+GIG+P+  + +I  +M V LQSENG+LG+G YP + E D DLI+A KETVT+ PG SFFSSD SF+MIR
Sbjct:  234 MCKAAGTTVVEVEEIVDIGSFAPEDIHIPKIYVHRLIKGEKYEKRIERLSL----RKEGEGKAKSGKPGEDVRERIIKRAALEFEDGMYANLGIGIPLLASNFISPNMTVHLQSENGVLGLGPYPLKDEADADLINAGKETVTVLPGASFFSSDESFAMIR 390          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. UniProt/SwissProt
Match: sp|Q54JD9|SCOT_DICDI (Probable succinyl-CoA:3-ketoacid coenzyme A transferase, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=oxct1 PE=3 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 3.883e-44
Identity = 84/159 (52.83%), Postives = 110/159 (69.18%), Query Frame = 1
Query:    1 MCKSANTTIVEVEQLVEIGEIDPDHIHIPGIYIDRILVGEKFEKRIEKKAYLGKKEKQETDPVKIKKAKERERILRRVALELENGMYVNVGIGMPMQLARYIPQDMIVALQSENGILGIGQYPSESEIDPDLISAAKETVTLKPGGXXXXXXXXXXMIR 477
            M  +A  TI EVE++V+ GEI PD +H+PGIYI RI+ G  FEKRIE+     +K  +     K + A +RERI+RR ALE E+GMY N+GIGMP   + +IP+ + + LQSENG+LG+G +P   E D DLI+A KETVT  PG S FSS +SF+MIR
Sbjct:  223 MATAAKITIAEVEEIVDAGEIKPDEVHVPGIYIQRIVKGPSFEKRIERLTVQKEKTGEAAAKPKDEAAAKRERIVRRAALEFEDGMYCNLGIGMPTLASNFIPKGIRIELQSENGLLGMGPFPKMGEHDADLINAGKETVTTIPGSSIFSSADSFAMIR 381          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. UniProt/SwissProt
Match: sp|P55809|SCOT1_HUMAN (Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=OXCT1 PE=1 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 5.487e-44
Identity = 85/160 (53.12%), Postives = 118/160 (73.75%), Query Frame = 1
Query:    1 MCKSANTTIVEVEQLVEIGEIDPDHIHIPGIYIDRILVGEKFEKRIEKKAYLGKKEKQETDPVKIKKAKE-RERILRRVALELENGMYVNVGIGMPMQLARYIPQDMIVALQSENGILGIGQYPSESEIDPDLISAAKETVTLKPGGXXXXXXXXXXMIR 477
            MCK+A TT+VEVE++V+IG   P+ IHIP IY+ R++ GEK+EKRIE+   L  +++ + +    K   + RERI++R ALE E+GMY N+GIG+P+  + +I  ++ V LQSENG+LG+G YP + E D DLI+A KETVT+ PG SFFSSD SF+MIR
Sbjct:  234 MCKAAETTVVEVEEIVDIGAFAPEDIHIPQIYVHRLIKGEKYEKRIER---LSIRKEGDGEAKSAKPGDDVRERIIKRAALEFEDGMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHEADADLINAGKETVTILPGASFFSSDESFAMIR 390          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. TrEMBL
Match: A0A0M9A457 (Succinyl-CoA:3-ketoacid-coenzyme A transferase OS=Melipona quadrifasciata OX=166423 GN=WN51_12762 PE=3 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 4.989e-52
Identity = 95/160 (59.38%), Postives = 124/160 (77.50%), Query Frame = 1
Query:    1 MCKSANTTIVEVEQLVEIGEIDPDHIHIPGIYIDRILVGEKFEKRIEKKAYLGKKEKQETDPVKIKKA-KERERILRRVALELENGMYVNVGIGMPMQLARYIPQDMIVALQSENGILGIGQYPSESEIDPDLISAAKETVTLKPGGXXXXXXXXXXMIR 477
            MCK+A  TI EVE++VEIG++DPDH+H+PGI++DRI+ G  +EKR+EK+       KQ   P K+  A K R+RI+RR ALE ++GMY N+GIG+PM    YIP+++ V LQSENGILG+G +P ESE+DPDLI+A KETVT+ PG SFFSSD SF+MIR
Sbjct:  216 MCKAAKITIAEVEEIVEIGQLDPDHVHLPGIFVDRIVKGPSYEKRVEKQY-----TKQNVKPKKVTPASKARDRIIRRAALEFKDGMYANLGIGIPMLACNYIPKNVKVTLQSENGILGLGPFPDESEVDPDLINAGKETVTVFPGASFFSSDESFAMIR 370          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. TrEMBL
Match: V9IHA7 (Succinyl-CoA:3-ketoacid-coenzyme A transferase OS=Apis cerana OX=7461 GN=ACCB04145 PE=2 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 2.855e-51
Identity = 95/160 (59.38%), Postives = 123/160 (76.88%), Query Frame = 1
Query:    1 MCKSANTTIVEVEQLVEIGEIDPDHIHIPGIYIDRILVGEKFEKRIEKKAYLGKKEKQETDPVKIKKA-KERERILRRVALELENGMYVNVGIGMPMQLARYIPQDMIVALQSENGILGIGQYPSESEIDPDLISAAKETVTLKPGGXXXXXXXXXXMIR 477
            MCK+A   I EVE++VEIG++DPD IH+PGIY+DRI+ G  +EKRIEK+       KQ   P K+  A K R+RI+RR ALE ++GMY N+GIG+PM    YIP+++ + LQSENGILG+G +P+ESE+DPDLI+A KETVT+ PG SFFSSD SF+MIR
Sbjct:  253 MCKAAKIAIAEVEEIVEIGQLDPDQIHLPGIYVDRIVKGLSYEKRIEKRF-----TKQNIKPKKVTPASKARDRIIRRAALEFKDGMYANLGIGIPMLACNYIPKNVKITLQSENGILGVGPFPNESEVDPDLINAGKETVTIFPGASFFSSDESFAMIR 407          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. TrEMBL
Match: A0A2A3EEM0 (Succinyl-CoA:3-ketoacid-coenzyme A transferase OS=Apis cerana cerana OX=94128 GN=APICC_06362 PE=3 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 1.098e-50
Identity = 95/160 (59.38%), Postives = 123/160 (76.88%), Query Frame = 1
Query:    1 MCKSANTTIVEVEQLVEIGEIDPDHIHIPGIYIDRILVGEKFEKRIEKKAYLGKKEKQETDPVKIKKA-KERERILRRVALELENGMYVNVGIGMPMQLARYIPQDMIVALQSENGILGIGQYPSESEIDPDLISAAKETVTLKPGGXXXXXXXXXXMIR 477
            MCK+A   I EVE++VEIG++DPD IH+PGIY+DRI+ G  +EKRIEK+       KQ   P K+  A K R+RI+RR ALE ++GMY N+GIG+PM    YIP+++ + LQSENGILG+G +P+ESE+DPDLI+A KETVT+ PG SFFSSD SF+MIR
Sbjct:  253 MCKAAKIAIAEVEEIVEIGQLDPDQIHLPGIYVDRIVKGLSYEKRIEKRF-----TKQNIKPKKVTPASKARDRIIRRAALEFKDGMYANLGIGIPMLACNYIPKNVKITLQSENGILGVGPFPNESEVDPDLINAGKETVTIFPGASFFSSDESFAMIR 407          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. TrEMBL
Match: A0A087ZSQ3 (Succinyl-CoA:3-ketoacid-coenzyme A transferase OS=Apis mellifera OX=7460 GN=LOC409157 PE=3 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 1.141e-50
Identity = 95/160 (59.38%), Postives = 123/160 (76.88%), Query Frame = 1
Query:    1 MCKSANTTIVEVEQLVEIGEIDPDHIHIPGIYIDRILVGEKFEKRIEKKAYLGKKEKQETDPVKIKKA-KERERILRRVALELENGMYVNVGIGMPMQLARYIPQDMIVALQSENGILGIGQYPSESEIDPDLISAAKETVTLKPGGXXXXXXXXXXMIR 477
            MCK+A   I EVE++VEIG++DPD IH+PGIY+DRI+ G  +EKRIEK+       KQ   P K+  A K R+RI+RR ALE ++GMY N+GIG+PM    YIP+++ + LQSENGILG+G +P+ESE+DPDLI+A KETVT+ PG SFFSSD SF+MIR
Sbjct:  253 MCKAAKIAIAEVEEIVEIGQLDPDQIHLPGIYVDRIIKGLSYEKRIEKRF-----TKQNIKPKKVTPASKARDRIIRRAALEFKDGMYANLGIGIPMLAYNYIPKNVKITLQSENGILGVGSFPNESEVDPDLINAGKETVTVFPGASFFSSDESFAMIR 407          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. TrEMBL
Match: A0A1W4XHZ3 (Succinyl-CoA:3-ketoacid-coenzyme A transferase OS=Agrilus planipennis OX=224129 GN=LOC108744374 PE=3 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 1.302e-50
Identity = 95/160 (59.38%), Postives = 127/160 (79.38%), Query Frame = 1
Query:    1 MCKSANTTIVEVEQLVEIGEIDPDHIHIPGIYIDRILVGEKFEKRIEKKAYLGKKEKQETDPVKIKKAKE-RERILRRVALELENGMYVNVGIGMPMQLARYIPQDMIVALQSENGILGIGQYPSESEIDPDLISAAKETVTLKPGGXXXXXXXXXXMIR 477
            M K+A  TI EVE++V +G+IDPDHIH+PGI++D+I++G  F+KRIE+     KKEK      K   A E RERI++RVALE +NGMY+N+GIGMPM  + +IP+++ V +QSENGILG+G+YP+E E+DPDLI+A KETVT+ PG SFFSSD+SF+MIR
Sbjct:  239 MAKAAKVTIAEVEEIVNVGDIDPDHIHLPGIFVDKIVLGPSFQKRIERVCI--KKEKSGESVAKKNPALEMRERIIKRVALEFKNGMYINLGIGMPMLASNFIPKNVDVIMQSENGILGLGEYPTEKELDPDLINAGKETVTVIPGASFFSSDDSFAMIR 396          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Cavefish
Match: oxct1b (succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial-like [Source:NCBI gene;Acc:103028178])

HSP 1 Score: 169.474 bits (428), Expect = 2.051e-50
Identity = 89/159 (55.97%), Postives = 118/159 (74.21%), Query Frame = 1
Query:    1 MCKSANTTIVEVEQLVEIGEIDPDHIHIPGIYIDRILVGEKFEKRIEKKAYLGKKEKQETDPVKIKKAKERERILRRVALELENGMYVNVGIGMPMQLARYIPQDMIVALQSENGILGIGQYPSESEIDPDLISAAKETVTLKPGGXXXXXXXXXXMIR 477
            MCK+A  TIVEVE++V++G    + IH+PGIYIDR++ G  +EKRIEK+     +  Q+  P      K RERI+RR ALE E+GMY N+GIG+PM  + YI  ++ V LQSENGILG+G YP+ESE+DP+LI+A KETVT+ PG ++FSSD SF+MIR
Sbjct:  242 MCKAAKVTIVEVEEIVDVGSFPAEDIHVPGIYIDRVVKGTSYEKRIEKRIV---RSSQKEKPKAKDSDKTRERIIRRAALEFEDGMYANLGIGIPMLASNYINPEITVHLQSENGILGLGPYPTESEVDPELINAGKETVTVLPGAAYFSSDESFAMIR 397          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Cavefish
Match: oxct1a (succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial [Source:NCBI gene;Acc:103039388])

HSP 1 Score: 158.303 bits (399), Expect = 1.751e-46
Identity = 87/161 (54.04%), Postives = 116/161 (72.05%), Query Frame = 1
Query:    1 MCKSANTTIVEVEQLVEIGEIDPDHIHIPGIYIDRILVGEKFEKRIEKKAYLGKKEKQETDPVKIKKAKE--RERILRRVALELENGMYVNVGIGMPMQLARYIPQDMIVALQSENGILGIGQYPSESEIDPDLISAAKETVTLKPGGXXXXXXXXXXMIR 477
            MCK+A  TIVEVE++V++G    + +HIP +Y+ RI+ G  +EKRIE++      +K +T   K KK  +  RERI+RR ALE E+GMY N+GIG+PM  + +I  D+ V LQSENGILG+G YP+E E+D DLI+A KETVT+ PG S+FSSD SF MIR
Sbjct:  229 MCKAAKVTIVEVEEIVDVGTFAEEDVHIPSVYVHRIVKGNNYEKRIERRTV----KKAQTGTAKPKKDSDVVRERIVRRAALEFEDGMYANLGIGIPMLASNFIKPDISVYLQSENGILGLGPYPTEEEVDADLINAGKETVTVLPGASYFSSDESFGMIR 385          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Cavefish
Match: oxct1a (succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial [Source:NCBI gene;Acc:103039388])

HSP 1 Score: 158.303 bits (399), Expect = 2.435e-46
Identity = 87/161 (54.04%), Postives = 116/161 (72.05%), Query Frame = 1
Query:    1 MCKSANTTIVEVEQLVEIGEIDPDHIHIPGIYIDRILVGEKFEKRIEKKAYLGKKEKQETDPVKIKKAKE--RERILRRVALELENGMYVNVGIGMPMQLARYIPQDMIVALQSENGILGIGQYPSESEIDPDLISAAKETVTLKPGGXXXXXXXXXXMIR 477
            MCK+A  TIVEVE++V++G    + +HIP +Y+ RI+ G  +EKRIE++      +K +T   K KK  +  RERI+RR ALE E+GMY N+GIG+PM  + +I  D+ V LQSENGILG+G YP+E E+D DLI+A KETVT+ PG S+FSSD SF MIR
Sbjct:  229 MCKAAKVTIVEVEEIVDVGTFAEEDVHIPSVYVHRIVKGNNYEKRIERRTV----KKAQTGTAKPKKDSDVVRERIVRRAALEFEDGMYANLGIGIPMLASNFIKPDISVYLQSENGILGLGPYPTEEEVDADLINAGKETVTVLPGASYFSSDESFGMIR 385          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Sea Lamprey
Match: oxct1b (3-oxoacid CoA transferase 1b [Source:ZFIN;Acc:ZDB-GENE-060929-212])

HSP 1 Score: 61.2326 bits (147), Expect = 2.132e-12
Identity = 23/47 (48.94%), Postives = 37/47 (78.72%), Query Frame = 1
Query:    1 MCKSANTTIVEVEQLVEIGEIDPDHIHIPGIYIDRILVGEKFEKRIE 141
            MCK+A  TI EVE++V++G   P+ +HIPGI++ R++ G+ ++KRIE
Sbjct:  172 MCKAAKCTIAEVEEIVDVGSFVPEDVHIPGIFVKRVIKGKSYQKRIE 218          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Nematostella
Match: EDO46906 (Succinyl-CoA:3-ketoacid-coenzyme A transferase [Source:UniProtKB/TrEMBL;Acc:A7RNT1])

HSP 1 Score: 149.828 bits (377), Expect = 1.728e-43
Identity = 83/159 (52.20%), Postives = 118/159 (74.21%), Query Frame = 1
Query:    1 MCKSANTTIVEVEQLVEIGEIDPDHIHIPGIYIDRILVGEKFEKRIEKKAYLGKKEKQETDPVKIKKAKERERILRRVALELENGMYVNVGIGMPMQLARYIPQDMIVALQSENGILGIGQYPSESEIDPDLISAAKETVTLKPGGXXXXXXXXXXMIR 477
            M K+A  TI EVE+++E GEI P+ +H+  +Y+DR++ G+K+EKRIE+   L K +  ++ P K   A+ RERI++R ALE ++GM+ N+GIGMPM  + +IP+ + V LQSENGI+G+G +P   + D DLI+A KETVT+ PGGSFFSSD SF+MIR
Sbjct:  234 MGKAAKVTIAEVEEIIESGEIPPEDVHLSCVYVDRVIKGKKYEKRIERLT-LTKDDVGDSKP-KSAAAEMRERIIKRAALEFKDGMFANLGIGMPMLASNFIPEGVTVQLQSENGIMGLGPFPRPGDEDGDLINAGKETVTVLPGGSFFSSDESFAMIR 390          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Medaka
Match: oxct1a (3-oxoacid CoA-transferase 1 [Source:NCBI gene;Acc:101163581])

HSP 1 Score: 146.747 bits (369), Expect = 6.647e-42
Identity = 90/161 (55.90%), Postives = 120/161 (74.53%), Query Frame = 1
Query:    1 MCKSANTTIVEVEQLVEIGEIDPDHIHIPGIYIDRILVGEKFEKRIEKKAYLGKKEKQETDPVKIKKAKE--RERILRRVALELENGMYVNVGIGMPMQLARYIPQDMIVALQSENGILGIGQYPSESEIDPDLISAAKETVTLKPGGXXXXXXXXXXMIR 477
            MCK+A TTIVEVE++VE+G    + IHIP IY++R++ G  +EKRIEK+     ++ QE  P K KK  +  RERI+RR ALE E+GMY N+GIG+PM  + +I  D+ V LQSENGILG+G YP++ E+D DLI+A KETVT+ PG ++FSSD SF+MIR
Sbjct:  243 MCKAAKTTIVEVEEVVEVGTFAAEDIHIPSIYVNRVVHGLSYEKRIEKRTV---RKGQEEKP-KPKKDSDIVRERIIRRAALEFEDGMYANLGIGIPMLASNFIKPDITVHLQSENGILGLGPYPTQDEVDADLINAGKETVTVLPGAAYFSSDESFAMIR 399          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Planmine SMEST
Match: SMESG000080424.1 (SMESG000080424.1)

HSP 1 Score: 296.59 bits (758), Expect = 1.111e-99
Identity = 158/159 (99.37%), Postives = 159/159 (100.00%), Query Frame = 1
Query:    1 MCKSANTTIVEVEQLVEIGEIDPDHIHIPGIYIDRILVGEKFEKRIEKKAYLGKKEKQETDPVKIKKAKERERILRRVALELENGMYVNVGIGMPMQLARYIPQDMIVALQSENGILGIGQYPSESEIDPDLISAAKETVTLKPGGXXXXXXXXXXMIR 477
            MCKSANTTIVEVEQLVEIGEIDPDHIHIPGIY+DRILVGEKFEKRIEKKAYLGKKEKQETDPVKIKKAKERERILRRVALELENGMYVNVGIGMPMQLARYIPQDMIVALQSENGILGIGQYPSESEIDPDLISAAKETVTLKPGGSFFSSDNSFSMIR
Sbjct:  240 MCKSANTTIVEVEQLVEIGEIDPDHIHIPGIYVDRILVGEKFEKRIEKKAYLGKKEKQETDPVKIKKAKERERILRRVALELENGMYVNVGIGMPMQLARYIPQDMIVALQSENGILGIGQYPSESEIDPDLISAAKETVTLKPGGSFFSSDNSFSMIR 398          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Planmine SMEST
Match: SMESG000080432.1 (SMESG000080432.1)

HSP 1 Score: 260.766 bits (665), Expect = 8.822e-86
Identity = 132/159 (83.02%), Postives = 147/159 (92.45%), Query Frame = 1
Query:    1 MCKSANTTIVEVEQLVEIGEIDPDHIHIPGIYIDRILVGEKFEKRIEKKAYLGKKEKQETDPVKIKKAKERERILRRVALELENGMYVNVGIGMPMQLARYIPQDMIVALQSENGILGIGQYPSESEIDPDLISAAKETVTLKPGGXXXXXXXXXXMIR 477
            MCK+AN TIVEVEQL+EIGEIDPDH+H+PGIY+DRILVGEKFEKRIEKK Y  +  KQETDP+KIK+AKERERI+RRVALEL+NGMYVNVGIGMPMQLA YIP DMIV LQSENGILGIGQYP ESEID DLI+A KETVT++PGGS+FSSDNSF+MIR
Sbjct:  226 MCKAANITIVEVEQLIEIGEIDPDHVHVPGIYVDRILVGEKFEKRIEKKVYTERTGKQETDPIKIKRAKERERIMRRVALELKNGMYVNVGIGMPMQLANYIPNDMIVTLQSENGILGIGQYPKESEIDADLINAGKETVTIRPGGSYFSSDNSFAMIR 384          
The following BLAST results are available for this feature:
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
OXCT14.508e-4653.133-oxoacid CoA-transferase 1 [Source:HGNC Symbol;Ac... [more]
OXCT11.143e-4453.133-oxoacid CoA-transferase 1 [Source:HGNC Symbol;Ac... [more]
OXCT23.217e-4052.833-oxoacid CoA-transferase 2 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
C05C10.34.817e-3746.54Probable succinyl-CoA:3-ketoacid coenzyme A transf... [more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
SCOT3.906e-4651.57gene:FBgn0035298 transcript:FBtr0333431[more]
SCOT1.017e-4551.57gene:FBgn0035298 transcript:FBtr0072843[more]
SCOT1.215e-4551.57gene:FBgn0035298 transcript:FBtr0072844[more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
oxct1b1.260e-5258.493-oxoacid CoA transferase 1b [Source:ZFIN;Acc:ZDB-... [more]
oxct1a3.212e-4755.283-oxoacid CoA transferase 1a [Source:ZFIN;Acc:ZDB-... [more]
oxct1a3.251e-4145.923-oxoacid CoA transferase 1a [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mettl186.965e-4052.17methyltransferase like 18 [Source:Xenbase;Acc:XB-G... [more]
mettl181.036e-3952.17methyltransferase like 18 [Source:Xenbase;Acc:XB-G... [more]
mettl181.053e-3952.17methyltransferase like 18 [Source:Xenbase;Acc:XB-G... [more]
mettl181.091e-3952.17methyltransferase like 18 [Source:Xenbase;Acc:XB-G... [more]
mettl181.131e-3952.17methyltransferase like 18 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Oxct16.880e-4554.093-oxoacid CoA transferase 1 [Source:MGI Symbol;Acc... [more]
Oxct19.966e-4554.093-oxoacid CoA transferase 1 [Source:MGI Symbol;Acc... [more]
Oxct2b9.891e-3849.383-oxoacid CoA transferase 2B [Source:MGI Symbol;Ac... [more]
Oxct2a1.720e-3748.773-oxoacid CoA transferase 2A [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q29551|SCOT1_PIG5.641e-4655.35Succinyl-CoA:3-ketoacid coenzyme A transferase 1, ... [more]
sp|Q9W058|SCOT_DROME1.218e-4451.57Succinyl-CoA:3-ketoacid-coenzyme A transferase, mi... [more]
sp|B2GV06|SCOT1_RAT1.304e-4454.66Succinyl-CoA:3-ketoacid coenzyme A transferase 1, ... [more]
sp|Q54JD9|SCOT_DICDI3.883e-4452.83Probable succinyl-CoA:3-ketoacid coenzyme A transf... [more]
sp|P55809|SCOT1_HUMAN5.487e-4453.13Succinyl-CoA:3-ketoacid coenzyme A transferase 1, ... [more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0M9A4574.989e-5259.38Succinyl-CoA:3-ketoacid-coenzyme A transferase OS=... [more]
V9IHA72.855e-5159.38Succinyl-CoA:3-ketoacid-coenzyme A transferase OS=... [more]
A0A2A3EEM01.098e-5059.38Succinyl-CoA:3-ketoacid-coenzyme A transferase OS=... [more]
A0A087ZSQ31.141e-5059.38Succinyl-CoA:3-ketoacid-coenzyme A transferase OS=... [more]
A0A1W4XHZ31.302e-5059.38Succinyl-CoA:3-ketoacid-coenzyme A transferase OS=... [more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
oxct1b2.051e-5055.97succinyl-CoA:3-ketoacid coenzyme A transferase 1, ... [more]
oxct1a1.751e-4654.04succinyl-CoA:3-ketoacid coenzyme A transferase 1, ... [more]
oxct1a2.435e-4654.04succinyl-CoA:3-ketoacid coenzyme A transferase 1, ... [more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
oxct1b2.132e-1248.943-oxoacid CoA transferase 1b [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO469061.728e-4352.20Succinyl-CoA:3-ketoacid-coenzyme A transferase [S... [more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
oxct1a6.647e-4255.903-oxoacid CoA-transferase 1 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000080424.11.111e-9999.37SMESG000080424.1[more]
SMESG000080432.18.822e-8683.02SMESG000080432.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029450 ID=SMED30029450|Name=Succinyl-CoA:3-ketoacid-coenzyme A transferase|organism=Schmidtea mediterranea sexual|type=transcript|length=479bp
ATGTGCAAATCTGCGAATACTACAATTGTAGAGGTAGAACAGCTTGTTGA
GATCGGAGAAATTGATCCAGATCACATTCATATTCCTGGGATTTATATTG
ACCGAATTTTAGTTGGAGAAAAATTTGAAAAGAGAATCGAGAAGAAAGCT
TATTTAGGGAAAAAAGAGAAACAAGAGACTGATCCAGTTAAAATAAAAAA
GGCAAAAGAACGAGAAAGAATTCTGAGAAGGGTTGCTCTTGAATTAGAAA
ACGGAATGTATGTTAATGTAGGCATTGGAATGCCTATGCAATTAGCACGT
TACATTCCACAAGATATGATAGTTGCGTTGCAGAGTGAAAATGGAATATT
AGGTATTGGGCAATACCCATCAGAAAGCGAGATTGATCCTGATCTTATTA
GTGCTGCAAAAGAAACCGTCACACTAAAACCCGGAGGATCATTTTTTTCG
TCTGACAATAGTTTTTCAATGATTAGAGG
back to top

protein sequence of SMED30029450-orf-1

>SMED30029450-orf-1 ID=SMED30029450-orf-1|Name=SMED30029450-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=159bp
MCKSANTTIVEVEQLVEIGEIDPDHIHIPGIYIDRILVGEKFEKRIEKKA
YLGKKEKQETDPVKIKKAKERERILRRVALELENGMYVNVGIGMPMQLAR
YIPQDMIVALQSENGILGIGQYPSESEIDPDLISAAKETVTLKPGGSFFS
SDNSFSMIR
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000035Category 3 cell
PLANA:0000421tail
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR037171NagB/RpiA_transferase-like
IPR004165CoA_trans_fam_I
IPR004164CoA_transf_AS
Vocabulary: molecular function
TermDefinition
GO:0008410CoA-transferase activity
GO:00082603-oxoacid CoA-transferase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0008152metabolic process
GO:0046952ketone body catabolic process
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.40.1080.10coord: 66..159
e-value: 5.8E-35
score: 122.6
NoneNo IPR availableGENE3DG3DSA:3.40.1080.10coord: 1..49
e-value: 2.0E-16
score: 61.9
IPR004165Coenzyme A transferase family IPFAMPF01144CoA_transcoord: 73..156
e-value: 2.5E-12
score: 46.6
coord: 4..37
e-value: 5.4E-8
score: 32.5
IPR004165Coenzyme A transferase family IPANTHERPTHR13707KETOACID-COENZYME A TRANSFERASEcoord: 1..159
IPR004164Coenzyme A transferase active sitePROSITEPS01274COA_TRANSF_2coord: 110..118
IPR037171NagB/RpiA transferase-likeSUPERFAMILYSSF100950NagB/RpiA/CoA transferase-likecoord: 1..115