epidermal growth factor receptor 2

Overview
Nameepidermal growth factor receptor 2 (AEE89452.1)
Smed IDSMED30029442
Length (bp)3956
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of epidermal growth factor receptor 2 (SMED30029442) t-SNE clustered cells

Violin plots show distribution of expression levels for epidermal growth factor receptor 2 (SMED30029442) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of epidermal growth factor receptor 2 (SMED30029442) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for epidermal growth factor receptor 2 (SMED30029442) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029442

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30029442h1SMcG0008454 dd_Smed_v4_10499_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30029442h1SMcG0008454 dd_Smed_v4_10499_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30029442h1SMcG0008454 dd_Smed_v4_10499_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30029442h1SMcG0008454 dd_Smed_v4_10499_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30029442h1SMcG0008454 dd_Smed_v4_10499_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30029442h1SMcG0008454 dd_Smed_v6_10499_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
gutSMED30029442h1SMcG0008454 HM777017smed_ncbi_20240424PMID:21458439
Fraguas et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of epidermal growth factor receptor 2 vs. Ensembl Human
Match: EGFR (epidermal growth factor receptor [Source:HGNC Symbol;Acc:HGNC:3236])

HSP 1 Score: 249.595 bits (636), Expect = 3.113e-67
Identity = 165/487 (33.88%), Postives = 254/487 (52.16%), Query Frame = 3
Query: 2088 CEKCNGYWSGDRCVKQCFPIALNLPR----NASCPYCNGNCVERC---TVTPNDPFQCGSCNFKRLYLDNHNKSCVSECPQ-------THKYKHKDGNLTDIICMTRSQWLSY--------QENPKFISKWSLIILSVITVFLISSVYIFFRYVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIR-ANRNIDIQEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPND 3479
            C  C     G  CV +C  +    PR    N+ C  C+  C+ +    T T   P  C  C     Y+D  +  CV  CP        T  +K+ D      +C     +              PK  S  + ++ +++ + +++     F     I +K++++ L      + E +    L      PN   L ++  T+       K +G+GAFG VY+G+W P  + ++      + VA+K +R A      +EI++EA VMASV + H  RL+GICL   +  LIT  +  G L  Y+R+HK  + S+ LL+W  QIA GM YLE R ++HRDLA RNVL+   + ++ITDFGLA ++   E    E    GG+VPI+W+ALE++L+ IY+H++DVWS+G+T+WE+ T+G +PYD +   EI+S L +G RL QP IC++D+Y +M +CW  +A+ RP F  L+   S   + P  YL I  D
Sbjct:  478 CVSCRNVSRGRECVDKCN-LLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAH---YIDGPH--CVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKIPSIATGMVGALLLLLVVALGIGLFMRRRHIVRKRTLRRL------LQERELVEPLTPSGEAPNQALLRILKETEFK---KIKVLGSGAFGTVYKGLWIPEGEKVK------IPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQ-LITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEE---KEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGD 939          

HSP 2 Score: 101.293 bits (251), Expect = 8.956e-21
Identity = 89/313 (28.43%), Postives = 131/313 (41.85%), Query Frame = 3
Query: 1044 DVFYMTAAILKNFTDIEHVIGEFHFTAQSFDKALGGITLPMLYKHLG---NVQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIMHTDLEFLGLRKLRRIF-GKFEVHDSPGLCYADTLNW------TGNILK--NNQFDPIYPPCNKPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRC---EDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQ-----NCTGPRPTNCIGGCRYFKENDECVKNCSR-----------KYFSFNKTCIKCHETCMENDKNQPLCTGESSILGLGGC 1889
            D   + A  +K+F +   + G+ H    +F       T P+  + L     V+ ITG L+I        +L   +NL+ IR    Q    +L ++  ++  LGLR L+ I  G   +  +  LCYA+T+NW      +G   K  +N+ +       + C + C  +GCWGP    C +CR       CVD+C   E EP         +++ +N +   C +CHP CL       CTG  P NCI  C ++ +   CVK C             KY      C  CH  C         CTG     GL GC
Sbjct:  302 DSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEP---------REFVENSE---CIQCHPECLPQAMNITCTGRGPDNCI-QCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYG------CTGP----GLEGC 591          

HSP 3 Score: 85.8853 bits (211), Expect = 4.591e-16
Identity = 77/251 (30.68%), Postives = 107/251 (42.63%), Query Frame = 2
Query:  158 HNCTHVEGNLVIQNVWPDQESGDLGFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQNSLALEKSEVSVYIDLLDEENSQYAIFPKLRVIANNSVYFKTKVKHKFLPQSIKWEELFENPKKQKLITYNKYMEHQCHSDCLRNDFPYCWSSSANHCQKQSKCVKEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNTKL--NPNFKLRVGYMCANSCP 904
            +NC  V GNL I  V   Q + DL FL +I EV G + +  N+++ I L NL++IRG                 +  ENS YA    L V++N   Y   K   K LP          N + QK           C   C       CW +   +CQK +K +       + C  + R G+     C  QC  GC GP+ SDC VC+K+ +   C + CPP  +Y+    ++  NP  K   G  C   CP
Sbjct:   56 NNCEVVLGNLEITYV---QRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGN----------------MYYENS-YA----LAVLSN---YDANKTGLKELP--------MRNLQGQK-----------CDPSCPNGS---CWGAGEENCQKLTKII-----CAQQCSGRCR-GKSPSDCCHNQCAAGCTGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCP 251          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Human
Match: EGFR (epidermal growth factor receptor [Source:HGNC Symbol;Acc:HGNC:3236])

HSP 1 Score: 250.366 bits (638), Expect = 3.314e-67
Identity = 165/487 (33.88%), Postives = 254/487 (52.16%), Query Frame = 3
Query: 2088 CEKCNGYWSGDRCVKQCFPIALNLPR----NASCPYCNGNCVERC---TVTPNDPFQCGSCNFKRLYLDNHNKSCVSECP-------QTHKYKHKDGNLTDIICMTRSQWLSY--------QENPKFISKWSLIILSVITVFLISSVYIFFRYVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIR-ANRNIDIQEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPND 3479
            C  C     G  CV +C  +    PR    N+ C  C+  C+ +    T T   P  C  C     Y+D  +  CV  CP        T  +K+ D      +C     +              PK  S  + ++ +++ + +++     F     I +K++++ L      + E +    L      PN   L ++  T+       K +G+GAFG VY+G+W P  + ++      + VA+K +R A      +EI++EA VMASV + H  RL+GICL   +  LIT  +  G L  Y+R+HK  + S+ LL+W  QIA GM YLE R ++HRDLA RNVL+   + ++ITDFGLA ++   E    E    GG+VPI+W+ALE++L+ IY+H++DVWS+G+T+WE+ T+G +PYD +   EI+S L +G RL QP IC++D+Y +M +CW  +A+ RP F  L+   S   + P  YL I  D
Sbjct:  478 CVSCRNVSRGRECVDKCN-LLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAH---YIDGPH--CVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKIPSIATGMVGALLLLLVVALGIGLFMRRRHIVRKRTLRRL------LQERELVEPLTPSGEAPNQALLRILKETEFK---KIKVLGSGAFGTVYKGLWIPEGEKVK------IPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQ-LITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEE---KEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGD 939          

HSP 2 Score: 101.293 bits (251), Expect = 9.258e-21
Identity = 89/313 (28.43%), Postives = 131/313 (41.85%), Query Frame = 3
Query: 1044 DVFYMTAAILKNFTDIEHVIGEFHFTAQSFDKALGGITLPMLYKHLG---NVQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIMHTDLEFLGLRKLRRIF-GKFEVHDSPGLCYADTLNW------TGNILK--NNQFDPIYPPCNKPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRC---EDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQ-----NCTGPRPTNCIGGCRYFKENDECVKNCSR-----------KYFSFNKTCIKCHETCMENDKNQPLCTGESSILGLGGC 1889
            D   + A  +K+F +   + G+ H    +F       T P+  + L     V+ ITG L+I        +L   +NL+ IR    Q    +L ++  ++  LGLR L+ I  G   +  +  LCYA+T+NW      +G   K  +N+ +       + C + C  +GCWGP    C +CR       CVD+C   E EP         +++ +N +   C +CHP CL       CTG  P NCI  C ++ +   CVK C             KY      C  CH  C         CTG     GL GC
Sbjct:  302 DSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEP---------REFVENSE---CIQCHPECLPQAMNITCTGRGPDNCI-QCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYG------CTGP----GLEGC 591          

HSP 3 Score: 85.8853 bits (211), Expect = 4.579e-16
Identity = 77/251 (30.68%), Postives = 107/251 (42.63%), Query Frame = 2
Query:  158 HNCTHVEGNLVIQNVWPDQESGDLGFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQNSLALEKSEVSVYIDLLDEENSQYAIFPKLRVIANNSVYFKTKVKHKFLPQSIKWEELFENPKKQKLITYNKYMEHQCHSDCLRNDFPYCWSSSANHCQKQSKCVKEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNTKL--NPNFKLRVGYMCANSCP 904
            +NC  V GNL I  V   Q + DL FL +I EV G + +  N+++ I L NL++IRG                 +  ENS YA    L V++N   Y   K   K LP          N + QK           C   C       CW +   +CQK +K +       + C  + R G+     C  QC  GC GP+ SDC VC+K+ +   C + CPP  +Y+    ++  NP  K   G  C   CP
Sbjct:   56 NNCEVVLGNLEITYV---QRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGN----------------MYYENS-YA----LAVLSN---YDANKTGLKELP--------MRNLQGQK-----------CDPSCPNGS---CWGAGEENCQKLTKII-----CAQQCSGRCR-GKSPSDCCHNQCAAGCTGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCP 251          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Human
Match: EGFR (epidermal growth factor receptor [Source:HGNC Symbol;Acc:HGNC:3236])

HSP 1 Score: 249.98 bits (637), Expect = 4.696e-67
Identity = 165/487 (33.88%), Postives = 254/487 (52.16%), Query Frame = 3
Query: 2088 CEKCNGYWSGDRCVKQCFPIALNLPR----NASCPYCNGNCVERC---TVTPNDPFQCGSCNFKRLYLDNHNKSCVSECP-------QTHKYKHKDGNLTDIICMTRSQWLSY--------QENPKFISKWSLIILSVITVFLISSVYIFFRYVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIR-ANRNIDIQEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPND 3479
            C  C     G  CV +C  +    PR    N+ C  C+  C+ +    T T   P  C  C     Y+D  +  CV  CP        T  +K+ D      +C     +              PK  S  + ++ +++ + +++     F     I +K++++ L      + E +    L      PN   L ++  T+       K +G+GAFG VY+G+W P  + ++      + VA+K +R A      +EI++EA VMASV + H  RL+GICL   +  LIT  +  G L  Y+R+HK  + S+ LL+W  QIA GM YLE R ++HRDLA RNVL+   + ++ITDFGLA ++   E    E    GG+VPI+W+ALE++L+ IY+H++DVWS+G+T+WE+ T+G +PYD +   EI+S L +G RL QP IC++D+Y +M +CW  +A+ RP F  L+   S   + P  YL I  D
Sbjct:  523 CVSCRNVSRGRECVDKCN-LLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAH---YIDGPH--CVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKIPSIATGMVGALLLLLVVALGIGLFMRRRHIVRKRTLRRL------LQERELVEPLTPSGEAPNQALLRILKETEFK---KIKVLGSGAFGTVYKGLWIPEGEKVK------IPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQ-LITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEE---KEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGD 984          

HSP 2 Score: 101.293 bits (251), Expect = 8.996e-21
Identity = 89/313 (28.43%), Postives = 131/313 (41.85%), Query Frame = 3
Query: 1044 DVFYMTAAILKNFTDIEHVIGEFHFTAQSFDKALGGITLPMLYKHLG---NVQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIMHTDLEFLGLRKLRRIF-GKFEVHDSPGLCYADTLNW------TGNILK--NNQFDPIYPPCNKPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRC---EDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQ-----NCTGPRPTNCIGGCRYFKENDECVKNCSR-----------KYFSFNKTCIKCHETCMENDKNQPLCTGESSILGLGGC 1889
            D   + A  +K+F +   + G+ H    +F       T P+  + L     V+ ITG L+I        +L   +NL+ IR    Q    +L ++  ++  LGLR L+ I  G   +  +  LCYA+T+NW      +G   K  +N+ +       + C + C  +GCWGP    C +CR       CVD+C   E EP         +++ +N +   C +CHP CL       CTG  P NCI  C ++ +   CVK C             KY      C  CH  C         CTG     GL GC
Sbjct:  347 DSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEP---------REFVENSE---CIQCHPECLPQAMNITCTGRGPDNCI-QCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYG------CTGP----GLEGC 636          

HSP 3 Score: 93.5893 bits (231), Expect = 1.790e-18
Identity = 76/258 (29.46%), Postives = 117/258 (45.35%), Query Frame = 2
Query:  158 HNCTHVEGNLVIQNVWPDQESGDLGFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQNSLALEKSEVSVYIDLLDEENSQYAIFP--KLRVIANNSVYFKTKVKHKFLPQSIKWEELFENPKKQKLITYNKYMEHQCH-SDCLRNDFP----YCWSSSANHCQKQSKCVKEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNTKL--NPNFKLRVGYMCANSCP 904
            +NC  V GNL I  V   Q + DL FL +I EV G + +  N+++ I L NL++IRG  ++  E S     +   D   +     P   L+ I + +V F        + +SI+W ++  +         N  M+ Q H   C + D       CW +   +CQK +K +       + C  + R G+     C  QC  GC GP+ SDC VC+K+ +   C + CPP  +Y+    ++  NP  K   G  C   CP
Sbjct:   56 NNCEVVLGNLEITYV---QRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRG--NMYYENSYALAVLSNYDANKTGLKELPMRNLQEILHGAVRFSNNPALCNV-ESIQWRDIVSSD-----FLSNMSMDFQNHLGSCQKCDPSCPNGSCWGAGEENCQKLTKII-----CAQQCSGRCR-GKSPSDCCHNQCAAGCTGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCP 296          

HSP 4 Score: 60.8474 bits (146), Expect = 1.825e-8
Identity = 67/279 (24.01%), Postives = 107/279 (38.35%), Query Frame = 3
Query: 1065 AILKNFTDIEHVIG--EFHFTAQSFDKALGGITLPMLYKHLGNVQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIM------HTDLEFLGLRKLRRIF-GKFEVHDSPGLCYADTLNW----TGNILKNNQFD--PIYPPCNKPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIGGCRYFKENDECVKNC----------------SRKYFSFNKTCIK 1808
            ++ + F + E V+G  E  +  +++D +            L  +Q + G ++I  + +       L+NL+ IR  +    S AL ++       T L+ L +R L+ I  G     ++P LC  +++ W    + + L N   D       C K CD  C +  CWG G   C           C  RC             K  +D      C  CH  C   CTGPR ++C+  CR F++   C   C                    +SF  TC+K
Sbjct:   50 SLQRMFNNCEVVLGNLEITYVQRNYDLSF-----------LKTIQEVAGYVLIALNTV---ERIPLENLQIIRGNMYYENSYALAVLSNYDANKTGLKELPMRNLQEILHGAVRFSNNPALCNVESIQWRDIVSSDFLSNMSMDFQNHLGSCQK-CDPSCPNGSCWGAGEENCQKLTKIICAQQCSGRCRG-----------KSPSD------C--CHNQCAAGCTGPRESDCL-VCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVK 293          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Human
Match: ERBB4 (erb-b2 receptor tyrosine kinase 4 [Source:HGNC Symbol;Acc:HGNC:3432])

HSP 1 Score: 249.21 bits (635), Expect = 1.135e-66
Identity = 137/376 (36.44%), Postives = 219/376 (58.24%), Query Frame = 3
Query: 2373 WLSYQENPKFISKWSLIILSVIT-VFLISSVYIFFR-YVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIRANRNIDIQ-EIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPNDSCLR 3491
            W  +   P+  ++  LI   VI  +F++  V + F  YV + + KK     + + + + EP     L    T PN  +L ++  T+L      K +G+GAFG VY+G+W P  + ++      + VA+K++          E M+EA +MAS+ H H +RL+G+CL   +  L+T  +  G L +Y+ +HK  + S+ LL+W  QIA GM YLE R ++HRDLA RNVL+     ++ITDFGLA ++   E ++ E    GG++PI+W+ALE +    ++H++DVWS+G+T+WE+ T+G +PYD +  REI   L +G RL QP IC++D+Y +M +CW  +A+ RP F+ L +  S   + P  YL I  D  ++
Sbjct:  612 WTGHSTLPQH-ARTPLIAAGVIGGLFILVIVGLTFAVYVRRKSIKKKRALRRFLETELVEP-----LTPSGTAPNQAQLRILKETELK---RVKVLGSGAFGTVYKGIWVPEGETVK------IPVAIKILNETTGPKANVEFMDEALIMASMDHPHLVRLLGVCLSPTIQ-LVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLL---EGDEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYLVIQGDDRMK 968          

HSP 2 Score: 108.997 bits (271), Expect = 3.621e-23
Identity = 79/258 (30.62%), Postives = 120/258 (46.51%), Query Frame = 2
Query:  161 NCTHVEGNLVIQNVWPDQESGDLGFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQNSLALEKSEVSVYIDLLDEEN--SQYAIFPKLRVIANNSVYFKTKVKHKFL--PQSIKWEELFENPKKQKLITYNKYMEH---QCHSDCLRNDFPYCWSSSANHCQKQSKCV-KEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNTKLNPNF--KLRVGYMCANSCP 904
            NC  V GNL I ++   + + DL FL S+ EVTG + +  N  + + L NL++IRG   L  ++  ++++++   + N   Q      L  I N  VY     ++KFL    +I W+++  NP    L   +        +CH  C       CW  + NHCQ  ++ V  E+ D    CY     G      C  +C GGC+GPK++DC  C  + +   CV  CP  F+Y+    +L  NF  K   G  C   CP
Sbjct:   29 NCEVVMGNLEITSI---EHNRDLSFLRSVREVTGYVLVALNQFRYLPLENLRIIRG-TKLYEDRYALAIFLNYRKDGNFGLQELGLKNLTEILNGGVYVD---QNKFLCYADTIHWQDIVRNPWPSNLTLVSTNGSSGCGRCHKSCTGR----CWGPTENHCQTLTRTVCAEQCDG--RCY-----GPYVSDCCHRECAGGCSGPKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCP 268          

HSP 3 Score: 80.4925 bits (197), Expect = 1.842e-14
Identity = 67/252 (26.59%), Postives = 100/252 (39.68%), Query Frame = 3
Query: 1188 VQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIMHTDLEFLGLRKLRRI-FGKFEVHDSPGLCYADTLNWTG--------NILKNNQFDPIYPPCNKPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLC------LQNCTGPRPTNCIGGCRYFKENDECVKNCSR----------KYFSFNKTCIKCHETCMENDKNQPLCTGESS 1868
            V+ ITG L I      + + +   NL  I   +  S  + L +    +  L  + L+ I  G   + D+  LCY  T+NWT          ++++N+           C+  C S GCWGPG   C +CR F     C++ C    G         ++ +  +  IC  C P C      L  C GP P NC   C +FK+   CV+ C            KY   ++ C  CH  C +       C G +S
Sbjct:  369 VREITGFLNIQSWPPNMTDFSVFSNLVTIGGRVLYSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFSTINQRIVIRDNRKAENCTAEGMVCNHLCSSDGCWGPGPDQCLSCRRFSRGRICIESCNLYDG---------EFREFENGSICVECDPQCEKMEDGLLTCHGPGPDNCT-KCSHFKDGPNCVEKCPDGLQGANSFIFKYADPDRECHPCHPNCTQG------CNGPTS 604          

HSP 4 Score: 59.3066 bits (142), Expect = 5.221e-8
Identity = 95/411 (23.11%), Postives = 151/411 (36.74%), Query Frame = 3
Query: 1065 AILKNFTDIEHVIGEFHFTAQSFDKALGGITLPMLYKHLGNVQYITGDLIIDGSNIVLKNLTFL--QNLKEIRHLLTQSASAALNIM-------HTDLEFLGLRKLRRIF-GKFEVHDSPGLCYADTLNWTGNILKNNQFDPIYPPCNKPCDSKCDSQG-----------CWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIGGCRYFKENDECVKNCSRKYFSFNKTCIKCHETCMENDKNQPLCTGESSILGLGGCSYCSKLIHKRDEKFYCYKDPCPRHYYLNKIDISEVMKRQKSKEIGICQPCLEPCLECSGNYTIYPTCEKCNGYWSGDRCVKQCFPIALNLPRNASCPYCNGNCVERCTVTPNDPF 2234
            A+ K + + E V+G    T+   ++ L           L +V+ +TG +++      L    +L  +NL+ IR         AL I        +  L+ LGL+ L  I  G   V  +  LCYADT++W  +I++N        P N    S   S G           CWGP  + C           C  RC                   Y   +   CH  C   C+GP+ T+C   C  F ++  CV  C +  F +N T  +     +E++ N     G          ++C K   K    F      C R    +K+++ E         I +C+PC + C +             C+G  +G     Q    + N+ +  +C   NGN +   T    DP+
Sbjct:   22 ALRKYYENCEVVMGNLEITSIEHNRDL---------SFLRSVREVTGYVLV-----ALNQFRYLPLENLRIIRGTKLYEDRYALAIFLNYRKDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYADTIHWQ-DIVRNPW------PSNLTLVSTNGSSGCGRCHKSCTGRCWGPTENHCQTLTRTVCAEQCDGRC-------------------YGPYVSDCCHRECAGGCSGPKDTDCF-ACMNFNDSGACVTQCPQT-FVYNPTTFQ-----LEHNFNAKYTYG----------AFCVK---KCPHNFVVDSSSCVRACPSSKMEVEE-------NGIKMCKPCTDICPKA------------CDGIGTGSLMSAQTVDSS-NIDKFINCTKINGNLIFLVTGIHGDPY 352          

HSP 5 Score: 56.225 bits (134), Expect = 4.703e-7
Identity = 33/84 (39.29%), Postives = 39/84 (46.43%), Query Frame = 3
Query: 1485 CDSKCDSQ-----GCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCI 1721
            CD +C+        C GPG   C  C  F+   NCV++C D  G     S I KY D   D  C  CHP C Q C GP   +CI
Sbjct:  529 CDPQCEKMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKCPD--GLQGANSFIFKYAD--PDRECHPCHPNCTQGCNGPTSHDCI 608          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Human
Match: ERBB4 (erb-b2 receptor tyrosine kinase 4 [Source:HGNC Symbol;Acc:HGNC:3432])

HSP 1 Score: 249.21 bits (635), Expect = 1.342e-66
Identity = 137/376 (36.44%), Postives = 219/376 (58.24%), Query Frame = 3
Query: 2373 WLSYQENPKFISKWSLIILSVIT-VFLISSVYIFFR-YVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIRANRNIDIQ-EIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPNDSCLR 3491
            W  +   P+  ++  LI   VI  +F++  V + F  YV + + KK     + + + + EP     L    T PN  +L ++  T+L      K +G+GAFG VY+G+W P  + ++      + VA+K++          E M+EA +MAS+ H H +RL+G+CL   +  L+T  +  G L +Y+ +HK  + S+ LL+W  QIA GM YLE R ++HRDLA RNVL+     ++ITDFGLA ++   E ++ E    GG++PI+W+ALE +    ++H++DVWS+G+T+WE+ T+G +PYD +  REI   L +G RL QP IC++D+Y +M +CW  +A+ RP F+ L +  S   + P  YL I  D  ++
Sbjct:  638 WTGHSTLPQH-ARTPLIAAGVIGGLFILVIVGLTFAVYVRRKSIKKKRALRRFLETELVEP-----LTPSGTAPNQAQLRILKETELK---RVKVLGSGAFGTVYKGIWVPEGETVK------IPVAIKILNETTGPKANVEFMDEALIMASMDHPHLVRLLGVCLSPTIQ-LVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLL---EGDEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYLVIQGDDRMK 994          

HSP 2 Score: 108.997 bits (271), Expect = 3.722e-23
Identity = 79/258 (30.62%), Postives = 120/258 (46.51%), Query Frame = 2
Query:  161 NCTHVEGNLVIQNVWPDQESGDLGFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQNSLALEKSEVSVYIDLLDEEN--SQYAIFPKLRVIANNSVYFKTKVKHKFL--PQSIKWEELFENPKKQKLITYNKYMEH---QCHSDCLRNDFPYCWSSSANHCQKQSKCV-KEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNTKLNPNF--KLRVGYMCANSCP 904
            NC  V GNL I ++   + + DL FL S+ EVTG + +  N  + + L NL++IRG   L  ++  ++++++   + N   Q      L  I N  VY     ++KFL    +I W+++  NP    L   +        +CH  C       CW  + NHCQ  ++ V  E+ D    CY     G      C  +C GGC+GPK++DC  C  + +   CV  CP  F+Y+    +L  NF  K   G  C   CP
Sbjct:   55 NCEVVMGNLEITSI---EHNRDLSFLRSVREVTGYVLVALNQFRYLPLENLRIIRG-TKLYEDRYALAIFLNYRKDGNFGLQELGLKNLTEILNGGVYVD---QNKFLCYADTIHWQDIVRNPWPSNLTLVSTNGSSGCGRCHKSCTGR----CWGPTENHCQTLTRTVCAEQCDG--RCY-----GPYVSDCCHRECAGGCSGPKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCP 294          

HSP 3 Score: 80.8777 bits (198), Expect = 1.712e-14
Identity = 67/252 (26.59%), Postives = 100/252 (39.68%), Query Frame = 3
Query: 1188 VQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIMHTDLEFLGLRKLRRI-FGKFEVHDSPGLCYADTLNWTG--------NILKNNQFDPIYPPCNKPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLC------LQNCTGPRPTNCIGGCRYFKENDECVKNCSR----------KYFSFNKTCIKCHETCMENDKNQPLCTGESS 1868
            V+ ITG L I      + + +   NL  I   +  S  + L +    +  L  + L+ I  G   + D+  LCY  T+NWT          ++++N+           C+  C S GCWGPG   C +CR F     C++ C    G         ++ +  +  IC  C P C      L  C GP P NC   C +FK+   CV+ C            KY   ++ C  CH  C +       C G +S
Sbjct:  395 VREITGFLNIQSWPPNMTDFSVFSNLVTIGGRVLYSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFSTINQRIVIRDNRKAENCTAEGMVCNHLCSSDGCWGPGPDQCLSCRRFSRGRICIESCNLYDG---------EFREFENGSICVECDPQCEKMEDGLLTCHGPGPDNCT-KCSHFKDGPNCVEKCPDGLQGANSFIFKYADPDRECHPCHPNCTQG------CNGPTS 630          

HSP 4 Score: 59.6918 bits (143), Expect = 4.999e-8
Identity = 95/411 (23.11%), Postives = 151/411 (36.74%), Query Frame = 3
Query: 1065 AILKNFTDIEHVIGEFHFTAQSFDKALGGITLPMLYKHLGNVQYITGDLIIDGSNIVLKNLTFL--QNLKEIRHLLTQSASAALNIM-------HTDLEFLGLRKLRRIF-GKFEVHDSPGLCYADTLNWTGNILKNNQFDPIYPPCNKPCDSKCDSQG-----------CWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIGGCRYFKENDECVKNCSRKYFSFNKTCIKCHETCMENDKNQPLCTGESSILGLGGCSYCSKLIHKRDEKFYCYKDPCPRHYYLNKIDISEVMKRQKSKEIGICQPCLEPCLECSGNYTIYPTCEKCNGYWSGDRCVKQCFPIALNLPRNASCPYCNGNCVERCTVTPNDPF 2234
            A+ K + + E V+G    T+   ++ L           L +V+ +TG +++      L    +L  +NL+ IR         AL I        +  L+ LGL+ L  I  G   V  +  LCYADT++W  +I++N        P N    S   S G           CWGP  + C           C  RC                   Y   +   CH  C   C+GP+ T+C   C  F ++  CV  C +  F +N T  +     +E++ N     G          ++C K   K    F      C R    +K+++ E         I +C+PC + C +             C+G  +G     Q    + N+ +  +C   NGN +   T    DP+
Sbjct:   48 ALRKYYENCEVVMGNLEITSIEHNRDL---------SFLRSVREVTGYVLV-----ALNQFRYLPLENLRIIRGTKLYEDRYALAIFLNYRKDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYADTIHWQ-DIVRNPW------PSNLTLVSTNGSSGCGRCHKSCTGRCWGPTENHCQTLTRTVCAEQCDGRC-------------------YGPYVSDCCHRECAGGCSGPKDTDCF-ACMNFNDSGACVTQCPQT-FVYNPTTFQ-----LEHNFNAKYTYG----------AFCVK---KCPHNFVVDSSSCVRACPSSKMEVEE-------NGIKMCKPCTDICPKA------------CDGIGTGSLMSAQTVDSS-NIDKFINCTKINGNLIFLVTGIHGDPY 378          

HSP 5 Score: 56.225 bits (134), Expect = 4.463e-7
Identity = 33/84 (39.29%), Postives = 39/84 (46.43%), Query Frame = 3
Query: 1485 CDSKCDSQ-----GCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCI 1721
            CD +C+        C GPG   C  C  F+   NCV++C D  G     S I KY D   D  C  CHP C Q C GP   +CI
Sbjct:  555 CDPQCEKMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKCPD--GLQGANSFIFKYAD--PDRECHPCHPNCTQGCNGPTSHDCI 634          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Celegans
Match: let-23 (Receptor tyrosine-protein kinase let-23 [Source:UniProtKB/Swiss-Prot;Acc:P24348])

HSP 1 Score: 332.413 bits (851), Expect = 2.235e-111
Identity = 276/985 (28.02%), Postives = 439/985 (44.57%), Query Frame = 3
Query:  906 EVDACIYSCNSLHFYRVDN---KCIRCQNSS---VCAXXXXXXXXXXXXXXXDVFYMTAAILKNFTDIE----HVIGEFHFTAQSFDKALGGITLPMLYKHLGNVQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIMH-TDLEFLGLRKLRRI-FGKFEVHDSPGLCYADTLNWTGNI------------LKNNQFDPIYPPCNKPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIGGCRY-------FKENDECVKNCSRKYFSFNK-TCIKCHETCMENDKNQPLCTGESSILGLGGCSYCSKLIHKRDEKFYCYKDPCPRH---------YYLNKIDISEVMKRQKSKEIGICQPCLEPCLECS--GNYTIYPTCEKCNGYW----SGDRCVKQCFPIALNLP--RNASCPYCNGNCVERCTVTPNDPFQCGSC-NFKRLYLDNHNKSCVSECPQTHKYKHKDGNLTDIICMTRSQWLSYQENPKFISKWSLIILSVITVFLISSVYIFFRYVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIRANRNIDIQEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPND------SCLRPMKKDKHRLLSQISYDFQVYPKLNNIYKQHSLDGTISTFV---GDYQDDIEGEPSLKRQSSGFSWSS 3683
            E D C+  C+  H Y       +C +C++SS   +C                   ++T   LKN    E    H+I E  FT +               K L  V+ ++  + I   N    +L FL+NL+ I      +   AL I    DLE L L  L+ I  G   +  +  LCY   ++W+  I            +  N+   +     + CD  C+ +GCWG     C  C+ +++V  CV++C D  GF  N +++K          C+RC P C + C G    +C+  CR+       F    ECV +C   +F   K  C KCH TC +N      CTG  S LG GGC  C   +   ++  +C +     +         YY++  D   V++         C+ C   C  CS  G   +   C   +  +    S   C+ QC   +  +P   N  C  C+  C +           C  C NF     D     CVSECP+   + +              + L Y    +      +II SV+  F +  ++I   Y       K +K    I   +  P+   I  +    PNM+R+ LIP+++L   ++ K +G GAFG V+ G++ P     +++    + VA+KV + +++    E++EEA  M  + H + L++IG C+  +   ++T +  LG+L  +L+ HK  L +R  + +  QIA GM YLE + ++HRDLATRNVL+     ++ITDFGL+ I++   D+   I I  G+V I+WLA+E      Y+H +DVW+FG+T WEI T+G+ PY  +    I ++L  GNRL+QP  CS DLYQ + RCW  +   RP FE L      F + P  +L   N       S     + ++ R +   + D Q+Y    ++    S   +++TF    GD  + ++   S + ++  F + S
Sbjct:  272 ENDVCVRHCSDGHHYDATKDVRECEKCRSSSCPKICTVDG---------------HLTNETLKNLEGCEQIDGHLIIEHAFTYEQL-------------KVLETVKIVSEYITIVQQNFY--DLKFLKNLQIIEGRKLHNVRWALAIYQCDDLEELSLNSLKLIKTGAVLIMKNHRLCYVSKIDWSSIITSKGKDNKPSLAIAENRDSKLCETEQRVCDKNCNKRGCWGKEPEDCLECKTWKSVGTCVEKC-DTKGFLRNQTSMK----------CERCSPEC-ETCNGLGELDCLT-CRHKTLYNSDFGNRMECVHDCPVSHFPTQKNVCEKCHPTCYDNG-----CTGPDSNLGYGGCKQCKYAVKYENDTIFCLQSSGMNNVCVENDLPNYYISTYDTEGVIETH-------CEKCSISCKTCSSAGRNVVQNKCVCKHVEYQPNPSERICMDQCPVNSFMVPDTNNTVCKKCHHECDQNYHCANGQSTGCQKCKNFTVFKGDI--AQCVSECPKNLPFSNP----------ANGECLDYDIASRQRKTRMVIIGSVLFGFAVMFLFILLVYWRCQRIGKKLK----IAEMVDMPELTPI--DASVRPNMSRICLIPSSELQTKLDKK-LGAGAFGTVFAGIYYP-----KRAKNVKIPVAIKVFQTDQS-QTDEMLEEATNMFRLRHDNLLKIIGFCMHDDGLKIVTIYRPLGNLQNFLKLHKENLGAREQVLYCYQIASGMQYLEKQRVVHRDLATRNVLVKKFNHVEITDFGLSKILKHDADS---ITIKSGKVAIKWLAIEIFSKHCYTHASDVWAFGVTCWEIITFGQSPYQGMSTDSIHNFLKDGNRLSQPPNCSQDLYQELLRCWMADPKSRPGFEILYERFKEFCKVPQLFLENSNKISESDLSAEERFQTERIREMFDGNIDPQMYFDQGSLPSMPSSPTSMATFTIPHGDLMNRMQSVNSSRYKTEPFDYGS 1173          

HSP 2 Score: 91.6633 bits (226), Expect = 2.235e-111
Identity = 77/271 (28.41%), Postives = 116/271 (42.80%), Query Frame = 2
Query:  152 GNHNCTHVEGNLVIQ-------NVWPDQESGDL---GFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQNSLALEKSEVSVYIDLLDEENSQYAIFPKLRVIANNSVYFKTKVKHKFLPQSIKWEELFENPKKQKLITYNKYME--------HQCHSDCLRNDFPYCWSSSANHCQKQSKCVKEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNTKL--NPNFKLRVGYMCANSCP 904
            GN   T +E N + +        V P  E   L    F  ++ E+ G + +   +I+ I  P L+VI G         + ++YI   D+ +    +  +LRVI N SV  +   K  ++   I W+EL  +P  QK+ T N +           +CH  C  ND   CW S  N CQ+  + V  K  +   C++   N       CD  C GGC G    +C  C KY     C+E CP   I++    +L  NP+ + + G  C   CP
Sbjct:   10 GNLEITWIEANEIKKWRESTNSTVDPKNEDSPLKSINFFDNLEEIRGSLIIYRANIQKISFPRLRVIYGDEVF----HDNALYIHKNDKVHE--VVMRELRVIRNGSVTIQDNPKMCYIGDKIDWKELLYDPDVQKVETTNSHQHCYQNGKSMAKCHESC--ND--KCWGSGDNDCQRVYRSVCPK--SCSQCFYS--NSTSSYECCDSACLGGCTGHGPKNCIACSKYELDGICIETCPSRKIFNHKTGRLVFNPDGRYQNGNHCVKECP 266          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Celegans
Match: let-23 (Receptor tyrosine-protein kinase let-23 [Source:UniProtKB/Swiss-Prot;Acc:P24348])

HSP 1 Score: 332.028 bits (850), Expect = 2.728e-111
Identity = 276/985 (28.02%), Postives = 439/985 (44.57%), Query Frame = 3
Query:  906 EVDACIYSCNSLHFYRVDN---KCIRCQNSS---VCAXXXXXXXXXXXXXXXDVFYMTAAILKNFTDIE----HVIGEFHFTAQSFDKALGGITLPMLYKHLGNVQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIMH-TDLEFLGLRKLRRI-FGKFEVHDSPGLCYADTLNWTGNI------------LKNNQFDPIYPPCNKPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIGGCRY-------FKENDECVKNCSRKYFSFNK-TCIKCHETCMENDKNQPLCTGESSILGLGGCSYCSKLIHKRDEKFYCYKDPCPRH---------YYLNKIDISEVMKRQKSKEIGICQPCLEPCLECS--GNYTIYPTCEKCNGYW----SGDRCVKQCFPIALNLP--RNASCPYCNGNCVERCTVTPNDPFQCGSC-NFKRLYLDNHNKSCVSECPQTHKYKHKDGNLTDIICMTRSQWLSYQENPKFISKWSLIILSVITVFLISSVYIFFRYVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIRANRNIDIQEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPND------SCLRPMKKDKHRLLSQISYDFQVYPKLNNIYKQHSLDGTISTFV---GDYQDDIEGEPSLKRQSSGFSWSS 3683
            E D C+  C+  H Y       +C +C++SS   +C                   ++T   LKN    E    H+I E  FT +               K L  V+ ++  + I   N    +L FL+NL+ I      +   AL I    DLE L L  L+ I  G   +  +  LCY   ++W+  I            +  N+   +     + CD  C+ +GCWG     C  C+ +++V  CV++C D  GF  N +++K          C+RC P C + C G    +C+  CR+       F    ECV +C   +F   K  C KCH TC +N      CTG  S LG GGC  C   +   ++  +C +     +         YY++  D   V++         C+ C   C  CS  G   +   C   +  +    S   C+ QC   +  +P   N  C  C+  C +           C  C NF     D     CVSECP+   + +              + L Y    +      +II SV+  F +  ++I   Y       K +K    I   +  P+   I  +    PNM+R+ LIP+++L   ++ K +G GAFG V+ G++ P     +++    + VA+KV + +++    E++EEA  M  + H + L++IG C+  +   ++T +  LG+L  +L+ HK  L +R  + +  QIA GM YLE + ++HRDLATRNVL+     ++ITDFGL+ I++   D+   I I  G+V I+WLA+E      Y+H +DVW+FG+T WEI T+G+ PY  +    I ++L  GNRL+QP  CS DLYQ + RCW  +   RP FE L      F + P  +L   N       S     + ++ R +   + D Q+Y    ++    S   +++TF    GD  + ++   S + ++  F + S
Sbjct:  333 ENDVCVRHCSDGHHYDATKDVRECEKCRSSSCPKICTVDG---------------HLTNETLKNLEGCEQIDGHLIIEHAFTYEQL-------------KVLETVKIVSEYITIVQQNFY--DLKFLKNLQIIEGRKLHNVRWALAIYQCDDLEELSLNSLKLIKTGAVLIMKNHRLCYVSKIDWSSIITSKGKDNKPSLAIAENRDSKLCETEQRVCDKNCNKRGCWGKEPEDCLECKTWKSVGTCVEKC-DTKGFLRNQTSMK----------CERCSPEC-ETCNGLGELDCLT-CRHKTLYNSDFGNRMECVHDCPVSHFPTQKNVCEKCHPTCYDNG-----CTGPDSNLGYGGCKQCKYAVKYENDTIFCLQSSGMNNVCVENDLPNYYISTYDTEGVIETH-------CEKCSISCKTCSSAGRNVVQNKCVCKHVEYQPNPSERICMDQCPVNSFMVPDTNNTVCKKCHHECDQNYHCANGQSTGCQKCKNFTVFKGDI--AQCVSECPKNLPFSNP----------ANGECLDYDIASRQRKTRMVIIGSVLFGFAVMFLFILLVYWRCQRIGKKLK----IAEMVDMPELTPI--DASVRPNMSRICLIPSSELQTKLDKK-LGAGAFGTVFAGIYYP-----KRAKNVKIPVAIKVFQTDQS-QTDEMLEEATNMFRLRHDNLLKIIGFCMHDDGLKIVTIYRPLGNLQNFLKLHKENLGAREQVLYCYQIASGMQYLEKQRVVHRDLATRNVLVKKFNHVEITDFGLSKILKHDADS---ITIKSGKVAIKWLAIEIFSKHCYTHASDVWAFGVTCWEIITFGQSPYQGMSTDSIHNFLKDGNRLSQPPNCSQDLYQELLRCWMADPKSRPGFEILYERFKEFCKVPQLFLENSNKISESDLSAEERFQTERIREMFDGNIDPQMYFDQGSLPSMPSSPTSMATFTIPHGDLMNRMQSVNSSRYKTEPFDYGS 1234          

HSP 2 Score: 92.0485 bits (227), Expect = 2.728e-111
Identity = 77/271 (28.41%), Postives = 116/271 (42.80%), Query Frame = 2
Query:  152 GNHNCTHVEGNLVIQ-------NVWPDQESGDL---GFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQNSLALEKSEVSVYIDLLDEENSQYAIFPKLRVIANNSVYFKTKVKHKFLPQSIKWEELFENPKKQKLITYNKYME--------HQCHSDCLRNDFPYCWSSSANHCQKQSKCVKEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNTKL--NPNFKLRVGYMCANSCP 904
            GN   T +E N + +        V P  E   L    F  ++ E+ G + +   +I+ I  P L+VI G         + ++YI   D+ +    +  +LRVI N SV  +   K  ++   I W+EL  +P  QK+ T N +           +CH  C  ND   CW S  N CQ+  + V  K  +   C++   N       CD  C GGC G    +C  C KY     C+E CP   I++    +L  NP+ + + G  C   CP
Sbjct:   71 GNLEITWIEANEIKKWRESTNSTVDPKNEDSPLKSINFFDNLEEIRGSLIIYRANIQKISFPRLRVIYGDEVF----HDNALYIHKNDKVHE--VVMRELRVIRNGSVTIQDNPKMCYIGDKIDWKELLYDPDVQKVETTNSHQHCYQNGKSMAKCHESC--ND--KCWGSGDNDCQRVYRSVCPK--SCSQCFYS--NSTSSYECCDSACLGGCTGHGPKNCIACSKYELDGICIETCPSRKIFNHKTGRLVFNPDGRYQNGNHCVKECP 327          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Celegans
Match: let-23 (Receptor tyrosine-protein kinase let-23 [Source:UniProtKB/Swiss-Prot;Acc:P24348])

HSP 1 Score: 331.643 bits (849), Expect = 2.891e-111
Identity = 276/985 (28.02%), Postives = 439/985 (44.57%), Query Frame = 3
Query:  906 EVDACIYSCNSLHFYRVDN---KCIRCQNSS---VCAXXXXXXXXXXXXXXXDVFYMTAAILKNFTDIE----HVIGEFHFTAQSFDKALGGITLPMLYKHLGNVQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIMH-TDLEFLGLRKLRRI-FGKFEVHDSPGLCYADTLNWTGNI------------LKNNQFDPIYPPCNKPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIGGCRY-------FKENDECVKNCSRKYFSFNK-TCIKCHETCMENDKNQPLCTGESSILGLGGCSYCSKLIHKRDEKFYCYKDPCPRH---------YYLNKIDISEVMKRQKSKEIGICQPCLEPCLECS--GNYTIYPTCEKCNGYW----SGDRCVKQCFPIALNLP--RNASCPYCNGNCVERCTVTPNDPFQCGSC-NFKRLYLDNHNKSCVSECPQTHKYKHKDGNLTDIICMTRSQWLSYQENPKFISKWSLIILSVITVFLISSVYIFFRYVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIRANRNIDIQEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPND------SCLRPMKKDKHRLLSQISYDFQVYPKLNNIYKQHSLDGTISTFV---GDYQDDIEGEPSLKRQSSGFSWSS 3683
            E D C+  C+  H Y       +C +C++SS   +C                   ++T   LKN    E    H+I E  FT +               K L  V+ ++  + I   N    +L FL+NL+ I      +   AL I    DLE L L  L+ I  G   +  +  LCY   ++W+  I            +  N+   +     + CD  C+ +GCWG     C  C+ +++V  CV++C D  GF  N +++K          C+RC P C + C G    +C+  CR+       F    ECV +C   +F   K  C KCH TC +N      CTG  S LG GGC  C   +   ++  +C +     +         YY++  D   V++         C+ C   C  CS  G   +   C   +  +    S   C+ QC   +  +P   N  C  C+  C +           C  C NF     D     CVSECP+   + +              + L Y    +      +II SV+  F +  ++I   Y       K +K    I   +  P+   I  +    PNM+R+ LIP+++L   ++ K +G GAFG V+ G++ P     +++    + VA+KV + +++    E++EEA  M  + H + L++IG C+  +   ++T +  LG+L  +L+ HK  L +R  + +  QIA GM YLE + ++HRDLATRNVL+     ++ITDFGL+ I++   D+   I I  G+V I+WLA+E      Y+H +DVW+FG+T WEI T+G+ PY  +    I ++L  GNRL+QP  CS DLYQ + RCW  +   RP FE L      F + P  +L   N       S     + ++ R +   + D Q+Y    ++    S   +++TF    GD  + ++   S + ++  F + S
Sbjct:  338 ENDVCVRHCSDGHHYDATKDVRECEKCRSSSCPKICTVDG---------------HLTNETLKNLEGCEQIDGHLIIEHAFTYEQL-------------KVLETVKIVSEYITIVQQNFY--DLKFLKNLQIIEGRKLHNVRWALAIYQCDDLEELSLNSLKLIKTGAVLIMKNHRLCYVSKIDWSSIITSKGKDNKPSLAIAENRDSKLCETEQRVCDKNCNKRGCWGKEPEDCLECKTWKSVGTCVEKC-DTKGFLRNQTSMK----------CERCSPEC-ETCNGLGELDCLT-CRHKTLYNSDFGNRMECVHDCPVSHFPTQKNVCEKCHPTCYDNG-----CTGPDSNLGYGGCKQCKYAVKYENDTIFCLQSSGMNNVCVENDLPNYYISTYDTEGVIETH-------CEKCSISCKTCSSAGRNVVQNKCVCKHVEYQPNPSERICMDQCPVNSFMVPDTNNTVCKKCHHECDQNYHCANGQSTGCQKCKNFTVFKGDI--AQCVSECPKNLPFSNP----------ANGECLDYDIASRQRKTRMVIIGSVLFGFAVMFLFILLVYWRCQRIGKKLK----IAEMVDMPELTPI--DASVRPNMSRICLIPSSELQTKLDKK-LGAGAFGTVFAGIYYP-----KRAKNVKIPVAIKVFQTDQS-QTDEMLEEATNMFRLRHDNLLKIIGFCMHDDGLKIVTIYRPLGNLQNFLKLHKENLGAREQVLYCYQIASGMQYLEKQRVVHRDLATRNVLVKKFNHVEITDFGLSKILKHDADS---ITIKSGKVAIKWLAIEIFSKHCYTHASDVWAFGVTCWEIITFGQSPYQGMSTDSIHNFLKDGNRLSQPPNCSQDLYQELLRCWMADPKSRPGFEILYERFKEFCKVPQLFLENSNKISESDLSAEERFQTERIREMFDGNIDPQMYFDQGSLPSMPSSPTSMATFTIPHGDLMNRMQSVNSSRYKTEPFDYGS 1239          

HSP 2 Score: 92.0485 bits (227), Expect = 2.891e-111
Identity = 77/271 (28.41%), Postives = 116/271 (42.80%), Query Frame = 2
Query:  152 GNHNCTHVEGNLVIQ-------NVWPDQESGDL---GFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQNSLALEKSEVSVYIDLLDEENSQYAIFPKLRVIANNSVYFKTKVKHKFLPQSIKWEELFENPKKQKLITYNKYME--------HQCHSDCLRNDFPYCWSSSANHCQKQSKCVKEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNTKL--NPNFKLRVGYMCANSCP 904
            GN   T +E N + +        V P  E   L    F  ++ E+ G + +   +I+ I  P L+VI G         + ++YI   D+ +    +  +LRVI N SV  +   K  ++   I W+EL  +P  QK+ T N +           +CH  C  ND   CW S  N CQ+  + V  K  +   C++   N       CD  C GGC G    +C  C KY     C+E CP   I++    +L  NP+ + + G  C   CP
Sbjct:   76 GNLEITWIEANEIKKWRESTNSTVDPKNEDSPLKSINFFDNLEEIRGSLIIYRANIQKISFPRLRVIYGDEVF----HDNALYIHKNDKVHE--VVMRELRVIRNGSVTIQDNPKMCYIGDKIDWKELLYDPDVQKVETTNSHQHCYQNGKSMAKCHESC--ND--KCWGSGDNDCQRVYRSVCPK--SCSQCFYS--NSTSSYECCDSACLGGCTGHGPKNCIACSKYELDGICIETCPSRKIFNHKTGRLVFNPDGRYQNGNHCVKECP 332          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Celegans
Match: let-23 (Receptor tyrosine-protein kinase let-23 [Source:UniProtKB/Swiss-Prot;Acc:P24348])

HSP 1 Score: 331.643 bits (849), Expect = 2.915e-111
Identity = 276/985 (28.02%), Postives = 439/985 (44.57%), Query Frame = 3
Query:  906 EVDACIYSCNSLHFYRVDN---KCIRCQNSS---VCAXXXXXXXXXXXXXXXDVFYMTAAILKNFTDIE----HVIGEFHFTAQSFDKALGGITLPMLYKHLGNVQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIMH-TDLEFLGLRKLRRI-FGKFEVHDSPGLCYADTLNWTGNI------------LKNNQFDPIYPPCNKPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIGGCRY-------FKENDECVKNCSRKYFSFNK-TCIKCHETCMENDKNQPLCTGESSILGLGGCSYCSKLIHKRDEKFYCYKDPCPRH---------YYLNKIDISEVMKRQKSKEIGICQPCLEPCLECS--GNYTIYPTCEKCNGYW----SGDRCVKQCFPIALNLP--RNASCPYCNGNCVERCTVTPNDPFQCGSC-NFKRLYLDNHNKSCVSECPQTHKYKHKDGNLTDIICMTRSQWLSYQENPKFISKWSLIILSVITVFLISSVYIFFRYVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIRANRNIDIQEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPND------SCLRPMKKDKHRLLSQISYDFQVYPKLNNIYKQHSLDGTISTFV---GDYQDDIEGEPSLKRQSSGFSWSS 3683
            E D C+  C+  H Y       +C +C++SS   +C                   ++T   LKN    E    H+I E  FT +               K L  V+ ++  + I   N    +L FL+NL+ I      +   AL I    DLE L L  L+ I  G   +  +  LCY   ++W+  I            +  N+   +     + CD  C+ +GCWG     C  C+ +++V  CV++C D  GF  N +++K          C+RC P C + C G    +C+  CR+       F    ECV +C   +F   K  C KCH TC +N      CTG  S LG GGC  C   +   ++  +C +     +         YY++  D   V++         C+ C   C  CS  G   +   C   +  +    S   C+ QC   +  +P   N  C  C+  C +           C  C NF     D     CVSECP+   + +              + L Y    +      +II SV+  F +  ++I   Y       K +K    I   +  P+   I  +    PNM+R+ LIP+++L   ++ K +G GAFG V+ G++ P     +++    + VA+KV + +++    E++EEA  M  + H + L++IG C+  +   ++T +  LG+L  +L+ HK  L +R  + +  QIA GM YLE + ++HRDLATRNVL+     ++ITDFGL+ I++   D+   I I  G+V I+WLA+E      Y+H +DVW+FG+T WEI T+G+ PY  +    I ++L  GNRL+QP  CS DLYQ + RCW  +   RP FE L      F + P  +L   N       S     + ++ R +   + D Q+Y    ++    S   +++TF    GD  + ++   S + ++  F + S
Sbjct:  345 ENDVCVRHCSDGHHYDATKDVRECEKCRSSSCPKICTVDG---------------HLTNETLKNLEGCEQIDGHLIIEHAFTYEQL-------------KVLETVKIVSEYITIVQQNFY--DLKFLKNLQIIEGRKLHNVRWALAIYQCDDLEELSLNSLKLIKTGAVLIMKNHRLCYVSKIDWSSIITSKGKDNKPSLAIAENRDSKLCETEQRVCDKNCNKRGCWGKEPEDCLECKTWKSVGTCVEKC-DTKGFLRNQTSMK----------CERCSPEC-ETCNGLGELDCLT-CRHKTLYNSDFGNRMECVHDCPVSHFPTQKNVCEKCHPTCYDNG-----CTGPDSNLGYGGCKQCKYAVKYENDTIFCLQSSGMNNVCVENDLPNYYISTYDTEGVIETH-------CEKCSISCKTCSSAGRNVVQNKCVCKHVEYQPNPSERICMDQCPVNSFMVPDTNNTVCKKCHHECDQNYHCANGQSTGCQKCKNFTVFKGDI--AQCVSECPKNLPFSNP----------ANGECLDYDIASRQRKTRMVIIGSVLFGFAVMFLFILLVYWRCQRIGKKLK----IAEMVDMPELTPI--DASVRPNMSRICLIPSSELQTKLDKK-LGAGAFGTVFAGIYYP-----KRAKNVKIPVAIKVFQTDQS-QTDEMLEEATNMFRLRHDNLLKIIGFCMHDDGLKIVTIYRPLGNLQNFLKLHKENLGAREQVLYCYQIASGMQYLEKQRVVHRDLATRNVLVKKFNHVEITDFGLSKILKHDADS---ITIKSGKVAIKWLAIEIFSKHCYTHASDVWAFGVTCWEIITFGQSPYQGMSTDSIHNFLKDGNRLSQPPNCSQDLYQELLRCWMADPKSRPGFEILYERFKEFCKVPQLFLENSNKISESDLSAEERFQTERIREMFDGNIDPQMYFDQGSLPSMPSSPTSMATFTIPHGDLMNRMQSVNSSRYKTEPFDYGS 1246          

HSP 2 Score: 92.0485 bits (227), Expect = 2.915e-111
Identity = 77/271 (28.41%), Postives = 116/271 (42.80%), Query Frame = 2
Query:  152 GNHNCTHVEGNLVIQ-------NVWPDQESGDL---GFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQNSLALEKSEVSVYIDLLDEENSQYAIFPKLRVIANNSVYFKTKVKHKFLPQSIKWEELFENPKKQKLITYNKYME--------HQCHSDCLRNDFPYCWSSSANHCQKQSKCVKEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNTKL--NPNFKLRVGYMCANSCP 904
            GN   T +E N + +        V P  E   L    F  ++ E+ G + +   +I+ I  P L+VI G         + ++YI   D+ +    +  +LRVI N SV  +   K  ++   I W+EL  +P  QK+ T N +           +CH  C  ND   CW S  N CQ+  + V  K  +   C++   N       CD  C GGC G    +C  C KY     C+E CP   I++    +L  NP+ + + G  C   CP
Sbjct:   83 GNLEITWIEANEIKKWRESTNSTVDPKNEDSPLKSINFFDNLEEIRGSLIIYRANIQKISFPRLRVIYGDEVF----HDNALYIHKNDKVHE--VVMRELRVIRNGSVTIQDNPKMCYIGDKIDWKELLYDPDVQKVETTNSHQHCYQNGKSMAKCHESC--ND--KCWGSGDNDCQRVYRSVCPK--SCSQCFYS--NSTSSYECCDSACLGGCTGHGPKNCIACSKYELDGICIETCPSRKIFNHKTGRLVFNPDGRYQNGNHCVKECP 339          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Celegans
Match: R151.1 (pep chromosome:WBcel235:III:7218813:7221186:1 gene:WBGene00020106.1 transcript:R151.1c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R151.1)

HSP 1 Score: 187.578 bits (475), Expect = 8.022e-51
Identity = 104/268 (38.81%), Postives = 160/268 (59.70%), Query Frame = 3
Query: 2652 IGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIRANR-NIDIQEIMEEAKVMASVC-HKHCLRLIGICLKYEMPCLITTFVELGSLDKYL---RKHK---STLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTL 3431
            IG GAFG V++G+ +  N  +       + VAVK ++AN  + + +E + E ++M +V  H + + + G C+  ++ C+I  +V  G L  YL   RK K   S + S+  LS+  QIA GM +LE  GIIHRDLA RN+L+   ++++I+DFG++            I +S G +P+RWL+ E + +  YS+K+DVW+FG+ LWEI T G  PY+ +  ++I + L +G RL QP  CS D+Y LM  CW   A DRPSF  ++S +
Sbjct:  195 IGEGAFGQVFKGILRGPNGQV-------IPVAVKQLKANAIDEEREEFVREIQMMQTVGQHDNIVTMYGYCMDEQLQCMIMEYVPYGDLKHYLQNMRKEKDSDSAIDSKEFLSFTNQIACGMAHLESVGIIHRDLAARNILVGTGKVLKISDFGMSR-------PGVYIKMSKGVIPLRWLSPEAIKDNTYSNKSDVWAFGVLLWEIATLGGFPYNNVADKDILNQLTEGMRLEQPAKCSDDMYILMKSCWNLKAEDRPSFLAILSKI 448          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Fly
Match: Egfr (gene:FBgn0003731 transcript:FBtr0071653)

HSP 1 Score: 341.273 bits (874), Expect = 6.500e-97
Identity = 247/858 (28.79%), Postives = 410/858 (47.79%), Query Frame = 3
Query: 1047 VFYMTAAILKNFTDIEHVIGEFHFTAQSFDK--------ALGGITLPMLYKHL---GNVQYITGDLIIDGSNIVLKNLTFLQNLKEIR-HLLTQSASAALNIMHTDLEFLGLRKLRRIF-GKFEVHDSPGLCYADTLNWTG-------NILKNNQFDPIYPPCNKP---CDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIGGCRYFKENDECVKNCSRKYFSFNKTCIKCHETCMENDKNQPLCTGESSILGLGGCSYCSKLIHKRD---EKFYCYKDPCPRHYYLNKIDISEVMKRQKSKEIGICQPCLEPCLECSGNYTIYP-TCEKCNGYWSGDRCVKQCFPIALNLPRNASC----PYCNGNCVERCTVTPNDPFQCGSC-NFKRL-------YLDNHNKSCVSECPQTHKYKHKDGNLTDIICMTRSQWLSYQENPKFISKWSLIILSVIT-VFLISSVYIF--FRYVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVK-VIRANRNIDIQEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPNDSCLR 3491
            V  + A  + +F +   + G      Q+F           +G   +P+  + L     V+ ITG L I+G++   +NL++ +NL+ I    L +S  AAL I+ + L  L +R L++I  G   +  +  LCY   + W          +  N         C K    C  +C+  GCWG G+  C  C+ F     C+  C    G+ +N          +D+  C+ CHP C + C G    +C   C + ++   CV  C +  ++    C +CH TC         CTG    +G+G C+ C+  I   D   ++     D CP  Y+   +   E    +      +C+ C   C  C+ NY  +   C KC  Y   ++C  +C            C    P CNG     CT    D   C SC NFK         Y+++   +C S+CP   ++ +         C       S   + K  +   + ++ +IT   L+ ++ I     Y+ +  QK   + +K   +     DS   L+      N+ +L ++   +L        +G GAFG VY+GVW P  ++++      + VA+K ++++      +E + EA +MASV H + L+L+ +C+  +M  LIT  + LG L  Y+R ++  + S+ LL+W  QIA GM+YLE + ++HRDLA RNVL+    +++ITDFGLA ++     + NE   +GG++PI+WLALE + N +++ K+DVW+FG+T+WE+ T+G+RP++ +  ++I   +  G +L QPEICS+D+Y  +  CW+ +A  RP+F+ L +  + F + P  YL IP D   R
Sbjct:  357 VTVLHAGNIDSFRNCTVIDGNIRILDQTFSGFQDVYANYTMGPRYIPLDPERLEVFSTVKEITGYLNIEGTHPQFRNLSYFRNLETIHGRQLMESMFAALAIVKSSLYSLEMRNLKQISSGSVVIQHNRDLCYVSNIRWPAIQKEPEQKVWVNENLRADL--CEKNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC----GYISNAY-------KFDNRTCKICHPEC-RTCNGAGADHC-QECVHVRDGQHCVSECPKNKYNDRGVCRECHATCDG-------CTGPKDTIGIGACTTCNLAIINNDATVKRCLLKDDKCPDGYFWEYVHPQEQGSLKPLAGRAVCRKCHPLCELCT-NYGYHEQVCSKCTHYKRREQCETECPADHYTDEEQRECFQCHPECNG-----CTGPGAD--DCKSCRNFKLFDANETGPYVNSTMFNCTSKCPLEMRHVNYQYTAIGPYCAA-----SPPRSSKITANLDVNMIFIITGAVLVPTICILCVVTYICRQKQKAKKETVKMTMALSGCEDSEP-LRPSNIGANLCKLRIVKDAELR---KGGVLGMGAFGRVYKGVWVPEGENVK------IPVAIKELLKSTGAESSEEFLREAYIMASVEHVNLLKLLAVCMSSQM-MLITQLMPLGCLLDYVRNNRDKIGSKALLNWSTQIAKGMSYLEEKRLVHRDLAARNVLVQTPSLVKITDFGLAKLLS---SDSNEYKAAGGKMPIKWLALECIRNRVFTSKSDVWAFGVTIWELLTFGQRPHENIPAKDIPDLIEVGLKLEQPEICSLDIYCTLLSCWHLDAAMRPTFKQLTTVFAEFARDPGRYLAIPGDKFTR 1165          

HSP 2 Score: 108.612 bits (270), Expect = 2.826e-23
Identity = 79/257 (30.74%), Postives = 114/257 (44.36%), Query Frame = 2
Query:  161 NCTHVEGNLVIQNVWPDQESGDLGFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQN--SLALEKSEVSVYIDLLDEENSQYAI-FPKLRVIANNSVYFKTKVKHKFLPQSIKWEELFENPKKQKL---ITYNKYMEHQCHSDCLRNDFPYCWSSSANHCQKQSKCVKEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNTKL--NPNFKLRVGYMCANSCPG 907
            NCT+V+GNL +   W   E+ DL FL +I EVTG I + +  +K ++ P L++IRG+   SL++E+ + ++++      +  Y +  P LR + N  V F        + ++I+W E+  N          T  +    +CH  C       CW     +CQK SK           CY     G      C   C GGC GP   DC  CK + +   C E CPP   Y+     L  NP  K   G  C   CPG
Sbjct:   79 NCTYVDGNLEL--TWLPNENLDLSFLDNIREVTGYILISHVDVKKVVFPKLQIIRGRTLFSLSVEEEKYALFVTY----SKMYTLEIPDLRDVLNGQVGFHNNYNLCHM-RTIQWSEIVSNGTDAYYNYDFTAPERECPKCHESCTHG----CWGEGPKNCQKFSKLTCSPQCAGGRCY-----GPKPRECCHLFCAGGCTGPTQKDCIACKNFFDEGVCKEECPPMRKYNPTTYVLETNPEGKYAYGATCVKECPG 319          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Fly
Match: Egfr (gene:FBgn0003731 transcript:FBtr0071654)

HSP 1 Score: 340.887 bits (873), Expect = 1.191e-96
Identity = 246/849 (28.98%), Postives = 404/849 (47.59%), Query Frame = 3
Query: 1044 DVFYMTAAILKNFTDIEHVIGEFHFTAQSFDKALGGITL-PMLYKHLGNVQYITGDLIIDGSNIVLKNLTFLQNLKEIR-HLLTQSASAALNIMHTDLEFLGLRKLRRIF-GKFEVHDSPGLCYADTLNWTG-------NILKNNQFDPIYPPCNKP---CDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIGGCRYFKENDECVKNCSRKYFSFNKTCIKCHETCMENDKNQPLCTGESSILGLGGCSYCSKLIHKRD---EKFYCYKDPCPRHYYLNKIDISEVMKRQKSKEIGICQPCLEPCLECSGNYTIYP-TCEKCNGYWSGDRCVKQCFPIALNLPRNASC----PYCNGNCVERCTVTPNDPFQCGSC-NFKRL-------YLDNHNKSCVSECPQTHKYKHKDGNLTDIICMTRSQWLSYQENPKFISKWSLIILSVIT-VFLISSVYIF--FRYVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVK-VIRANRNIDIQEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPNDSCLR 3491
            D F     I  N   ++     F     ++      I L P   +    V+ ITG L I+G++   +NL++ +NL+ I    L +S  AAL I+ + L  L +R L++I  G   +  +  LCY   + W          +  N         C K    C  +C+  GCWG G+  C  C+ F     C+  C    G+ +N          +D+  C+ CHP C + C G    +C   C + ++   CV  C +  ++    C +CH TC         CTG    +G+G C+ C+  I   D   ++     D CP  Y+   +   E    +      +C+ C   C  C+ NY  +   C KC  Y   ++C  +C            C    P CNG     CT    D   C SC NFK         Y+++   +C S+CP   ++ +         C       S   + K  +   + ++ +IT   L+ ++ I     Y+ +  QK   + +K   +     DS   L+      N+ +L ++   +L        +G GAFG VY+GVW P  ++++      + VA+K ++++      +E + EA +MASV H + L+L+ +C+  +M  LIT  + LG L  Y+R ++  + S+ LL+W  QIA GM+YLE + ++HRDLA RNVL+    +++ITDFGLA ++     + NE   +GG++PI+WLALE + N +++ K+DVW+FG+T+WE+ T+G+RP++ +  ++I   +  G +L QPEICS+D+Y  +  CW+ +A  RP+F+ L +  + F + P  YL IP D   R
Sbjct:  415 DSFRNCTVIDGNIRILDQTFSGFQDVYANYTMGPRYIPLDPERLEVFSTVKEITGYLNIEGTHPQFRNLSYFRNLETIHGRQLMESMFAALAIVKSSLYSLEMRNLKQISSGSVVIQHNRDLCYVSNIRWPAIQKEPEQKVWVNENLRADL--CEKNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC----GYISNAY-------KFDNRTCKICHPEC-RTCNGAGADHC-QECVHVRDGQHCVSECPKNKYNDRGVCRECHATCDG-------CTGPKDTIGIGACTTCNLAIINNDATVKRCLLKDDKCPDGYFWEYVHPQEQGSLKPLAGRAVCRKCHPLCELCT-NYGYHEQVCSKCTHYKRREQCETECPADHYTDEEQRECFQCHPECNG-----CTGPGAD--DCKSCRNFKLFDANETGPYVNSTMFNCTSKCPLEMRHVNYQYTAIGPYCAA-----SPPRSSKITANLDVNMIFIITGAVLVPTICILCVVTYICRQKQKAKKETVKMTMALSGCEDSEP-LRPSNIGANLCKLRIVKDAELR---KGGVLGMGAFGRVYKGVWVPEGENVK------IPVAIKELLKSTGAESSEEFLREAYIMASVEHVNLLKLLAVCMSSQM-MLITQLMPLGCLLDYVRNNRDKIGSKALLNWSTQIAKGMSYLEEKRLVHRDLAARNVLVQTPSLVKITDFGLAKLLS---SDSNEYKAAGGKMPIKWLALECIRNRVFTSKSDVWAFGVTIWELLTFGQRPHENIPAKDIPDLIEVGLKLEQPEICSLDIYCTLLSCWHLDAAMRPTFKQLTTVFAEFARDPGRYLAIPGDKFTR 1214          

HSP 2 Score: 108.612 bits (270), Expect = 2.534e-23
Identity = 79/257 (30.74%), Postives = 114/257 (44.36%), Query Frame = 2
Query:  161 NCTHVEGNLVIQNVWPDQESGDLGFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQN--SLALEKSEVSVYIDLLDEENSQYAI-FPKLRVIANNSVYFKTKVKHKFLPQSIKWEELFENPKKQKL---ITYNKYMEHQCHSDCLRNDFPYCWSSSANHCQKQSKCVKEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNTKL--NPNFKLRVGYMCANSCPG 907
            NCT+V+GNL +   W   E+ DL FL +I EVTG I + +  +K ++ P L++IRG+   SL++E+ + ++++      +  Y +  P LR + N  V F        + ++I+W E+  N          T  +    +CH  C       CW     +CQK SK           CY     G      C   C GGC GP   DC  CK + +   C E CPP   Y+     L  NP  K   G  C   CPG
Sbjct:  128 NCTYVDGNLEL--TWLPNENLDLSFLDNIREVTGYILISHVDVKKVVFPKLQIIRGRTLFSLSVEEEKYALFVTY----SKMYTLEIPDLRDVLNGQVGFHNNYNLCHM-RTIQWSEIVSNGTDAYYNYDFTAPERECPKCHESCTHG----CWGEGPKNCQKFSKLTCSPQCAGGRCY-----GPKPRECCHLFCAGGCTGPTQKDCIACKNFFDEGVCKEECPPMRKYNPTTYVLETNPEGKYAYGATCVKECPG 368          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Fly
Match: Abl (gene:FBgn0000017 transcript:FBtr0330130)

HSP 1 Score: 189.889 bits (481), Expect = 3.399e-48
Identity = 98/266 (36.84%), Postives = 154/266 (57.89%), Query Frame = 3
Query: 2652 IGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIRANRNIDIQEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKH-KSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQ 3446
            +G G +G VY  VWK          R    VAVK ++ +  + +++ +EEA +M  + H + ++LIG+C +     +IT F+  G+L  +LR   + TL +  LL    QIA GM+YLE R  IHRDLA RN L+ D +++++ DFGLA +++    +      +G + PI+W A E L    +S K+DVW+FG+ LWEI TYG  PY  +D+ ++   L +G R+ +P  C  ++Y LM +CW  +A DRP+F+++   L    Q
Sbjct:  377 LGGGQYGEVYEAVWK----------RYGNTVAVKTLKED-TMALKDFLEEAAIMKEMKHPNLVQLIGVCTREPPFYIITEFMSHGNLLDFLRSAGRETLDAVALLYMATQIASGMSYLESRNYIHRDLAARNCLVGDNKLVKVADFGLARLMR----DDTYTAHAGAKFPIKWTAPEGLAYNKFSTKSDVWAFGVLLWEIATYGMSPYPAIDLTDVYHKLDKGYRMERPPGCPPEVYDLMRQCWQWDATDRPTFKSIHHALEHMFQ 627          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Fly
Match: Abl (gene:FBgn0000017 transcript:FBtr0330135)

HSP 1 Score: 189.504 bits (480), Expect = 3.631e-48
Identity = 98/266 (36.84%), Postives = 154/266 (57.89%), Query Frame = 3
Query: 2652 IGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIRANRNIDIQEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKH-KSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQ 3446
            +G G +G VY  VWK          R    VAVK ++ +  + +++ +EEA +M  + H + ++LIG+C +     +IT F+  G+L  +LR   + TL +  LL    QIA GM+YLE R  IHRDLA RN L+ D +++++ DFGLA +++    +      +G + PI+W A E L    +S K+DVW+FG+ LWEI TYG  PY  +D+ ++   L +G R+ +P  C  ++Y LM +CW  +A DRP+F+++   L    Q
Sbjct:  377 LGGGQYGEVYEAVWK----------RYGNTVAVKTLKED-TMALKDFLEEAAIMKEMKHPNLVQLIGVCTREPPFYIITEFMSHGNLLDFLRSAGRETLDAVALLYMATQIASGMSYLESRNYIHRDLAARNCLVGDNKLVKVADFGLARLMR----DDTYTAHAGAKFPIKWTAPEGLAYNKFSTKSDVWAFGVLLWEIATYGMSPYPAIDLTDVYHKLDKGYRMERPPGCPPEVYDLMRQCWQWDATDRPTFKSIHHALEHMFQ 627          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Fly
Match: Abl (gene:FBgn0000017 transcript:FBtr0330131)

HSP 1 Score: 189.889 bits (481), Expect = 3.634e-48
Identity = 98/266 (36.84%), Postives = 154/266 (57.89%), Query Frame = 3
Query: 2652 IGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIRANRNIDIQEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKH-KSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQ 3446
            +G G +G VY  VWK          R    VAVK ++ +  + +++ +EEA +M  + H + ++LIG+C +     +IT F+  G+L  +LR   + TL +  LL    QIA GM+YLE R  IHRDLA RN L+ D +++++ DFGLA +++    +      +G + PI+W A E L    +S K+DVW+FG+ LWEI TYG  PY  +D+ ++   L +G R+ +P  C  ++Y LM +CW  +A DRP+F+++   L    Q
Sbjct:  395 LGGGQYGEVYEAVWK----------RYGNTVAVKTLKED-TMALKDFLEEAAIMKEMKHPNLVQLIGVCTREPPFYIITEFMSHGNLLDFLRSAGRETLDAVALLYMATQIASGMSYLESRNYIHRDLAARNCLVGDNKLVKVADFGLARLMR----DDTYTAHAGAKFPIKWTAPEGLAYNKFSTKSDVWAFGVLLWEIATYGMSPYPAIDLTDVYHKLDKGYRMERPPGCPPEVYDLMRQCWQWDATDRPTFKSIHHALEHMFQ 645          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Zebrafish
Match: si:ch73-383l1.1 (si:ch73-383l1.1 [Source:ZFIN;Acc:ZDB-GENE-121214-64])

HSP 1 Score: 242.662 bits (618), Expect = 3.638e-67
Identity = 123/310 (39.68%), Postives = 189/310 (60.97%), Query Frame = 3
Query: 2565 LQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIRANRNIDIQ-EIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPNDSCLR 3491
            L    T PN  +L ++  T+L      K +GTGAFG VY+G+W P  + ++      + VA+K++  +       E M+EA +MAS+ H H +RL+G+CL   +  L+T  +  G L  Y+ +H+  + S+ LL+W  QIA GM YLE R ++HRDLA RNVL+     I+ITDFGLA ++   E N+ E     G++PI+W+ALE +    ++H++DVWS+G+T+WE+ T+G +PYD +  REI   L +G RL QP IC++D+Y +M +CW  +A+ RP F+ L +  S   + P  YL I  D  ++
Sbjct:    5 LTPSGTAPNQAQLRILKETELK---RVKILGTGAFGTVYKGIWVPEGETVK------IPVAIKILNESTGPKANVEFMDEALIMASMEHPHLVRLLGVCLSPTI-QLVTQLMPHGCLLDYVHEHQDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHIKITDFGLARLL---ETNEKEYSADEGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDILEKGERLPQPPICTIDVYMVMVKCWMIDADSRPRFKELAAEFSRMARDPQRYLVIQGDDRMK 301          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Zebrafish
Match: si:ch73-383l1.1 (si:ch73-383l1.1 [Source:ZFIN;Acc:ZDB-GENE-121214-64])

HSP 1 Score: 246.899 bits (629), Expect = 6.466e-66
Identity = 130/358 (36.31%), Postives = 211/358 (58.94%), Query Frame = 3
Query: 2421 IILSVITVFLISSVYIFFRYVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIRANRNIDIQ-EIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPNDSCLR 3491
            +I  +  V +++  +  F     I +K++++  + + + + EP     L    T PN  +L ++  T+L      K +GTGAFG VY+G+W P  + ++      + VA+K++  +       E M+EA +MAS+ H H +RL+G+CL   +  L+T  +  G L  Y+ +H+  + S+ LL+W  QIA GM YLE R ++HRDLA RNVL+     I+ITDFGLA ++   E N+ E     G++PI+W+ALE +    ++H++DVWS+G+T+WE+ T+G +PYD +  REI   L +G RL QP IC++D+Y +M +CW  +A+ RP F+ L +  S   + P  YL I  D  ++
Sbjct:  646 VIGGMFVVVIVALGFAIFFRRKSIKKKRALR--RFLETELVEP-----LTPSGTAPNQAQLRILKETELK---RVKILGTGAFGTVYKGIWVPEGETVK------IPVAIKILNESTGPKANVEFMDEALIMASMEHPHLVRLLGVCLSPTIQ-LVTQLMPHGCLLDYVHEHQDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHIKITDFGLARLL---ETNEKEYSADEGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDILEKGERLPQPPICTIDVYMVMVKCWMIDADSRPRFKELAAEFSRMARDPQRYLVIQGDDRMK 983          

HSP 2 Score: 105.531 bits (262), Expect = 3.114e-22
Identity = 79/257 (30.74%), Postives = 119/257 (46.30%), Query Frame = 2
Query:  161 NCTHVEGNLVIQNVWPDQESGDLGFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQNSLALEKSEVSVYIDLLDEENSQYAI----FPKLRVIANNSVYFKTKVKHKFL--PQSIKWEELFENPKKQKLITYNKYMEHQCHSDCLRNDFPYCWSSSANHCQKQSKCV-KEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNTKL--NPNFKLRVGYMCANSCP 904
            NC  V GNL I ++   + + +L FL SI EVTG + +  N    + L NL++IRG     L +   S+ I L    +  + +       L  I N  VY     ++KFL    +I W+++ +NP+ + L+  +    + C   C R+    CW    + CQ  +K V  E+ D    C+     G      C  +C GGC GPK++DC  C  + +   CV  CP  F+Y+    +L  NPN K   G  C   CP
Sbjct:   54 NCEVVMGNLEITSI---ERNRNLSFLKSIREVTGYVLVALNQFDYLPLENLRIIRGTK---LYEGRYSLAIFLNYRRDGYFGLRQLGLRNLTEILNGGVYVD---QNKFLCHADTIHWQDIIKNPRSELLVVPSNNSGNTCRR-CHRSCNGRCWGPQEDQCQSLTKTVCAEQCDG--RCF-----GPYVSNCCHRECAGGCFGPKDTDCFACTNFNDSGACVTQCPQPFVYNPTTFQLEHNPNAKYTYGAFCVKKCP 293          

HSP 3 Score: 67.0106 bits (162), Expect = 1.611e-10
Identity = 67/249 (26.91%), Postives = 99/249 (39.76%), Query Frame = 3
Query: 1188 VQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIMH---TDLEFLGLRKLRRIFGKFEVHDSPGLCYADTLNWTGNILKNNQFDPIYP-----PCNKP---CDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCE----DEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIGGCRYFKENDECVKNCSR----------KYFSFNKTCIKCHETCMENDKNQPLCTG 1859
            V+ ITG L I      + +L+   NL  I      S  + L +     T L+F  LR++    G   + ++  LC+  T+NWT     + Q   I        C++    CD  C   GCWGPG + C +C+ F     CV  C     D   F   ++ ++       D  C++     L  C GP P +C+  C + K+   CV+ C            KY   N  C  CH  C +       CTG
Sbjct:  394 VREITGYLNIQSWPENMTDLSVFSNLVTIGGRTLYSGISLLILKQRWITSLQFQSLREISA--GNVYMTNNSQLCFYSTVNWTSLFRTSTQKAKIKDNRDPRECSQQRMVCDPLCSVSGCWGPGPNQCLSCKYFSRGRTCVRSCNLYNGDVREFANGSTCVEC------DSQCEKAEDKSL-TCHGPGPDHCV-KCLHLKDGPNCVEKCPDGLQGANSFIFKYPETNNECHPCHPNCTQG------CTG 626          

HSP 4 Score: 61.6178 bits (148), Expect = 6.867e-9
Identity = 35/85 (41.18%), Postives = 44/85 (51.76%), Query Frame = 3
Query: 1485 CDSKCD-----SQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIG 1724
            CDS+C+     S  C GPG   C  C   +   NCV++C D  G     S I KY +  ++  C  CHP C Q CTGPR  +CIG
Sbjct:  554 CDSQCEKAEDKSLTCHGPGPDHCVKCLHLKDGPNCVEKCPD--GLQGANSFIFKYPETNNE--CHPCHPNCTQGCTGPRIQDCIG 634          

HSP 5 Score: 57.7658 bits (138), Expect = 1.256e-7
Identity = 65/264 (24.62%), Postives = 104/264 (39.39%), Query Frame = 3
Query: 1065 AILKNFTDIEHVIGEFHFTAQSFDKALGGITLPMLYKHLGNVQYITGDLIIDGSNIVLKNLTFL--QNLKEIRHLLTQSASAALNIM-------HTDLEFLGLRKLRRIF-GKFEVHDSPGLCYADTLNWTGNILKNNQFDPIYPPCN------KPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIGGCRYFKENDECVKNCSRKYFSFNKTCIK 1808
             + K + + E V+G    T+   ++ L           L +++ +TG +++      L    +L  +NL+ IR         +L I        +  L  LGLR L  I  G   V  +  LC+ADT++W  +I+KN + + +  P N      + C   C+ + CWGP    C +         C  RC               Y  N        CH  C   C GP+ T+C   C  F ++  CV  C +  F +N T  +
Sbjct:   47 TLRKFYENCEVVMGNLEITSIERNRNL---------SFLKSIREVTGYVLV-----ALNQFDYLPLENLRIIRGTKLYEGRYSLAIFLNYRRDGYFGLRQLGLRNLTEILNGGVYVDQNKFLCHADTIHWQ-DIIKNPRSELLVVPSNNSGNTCRRCHRSCNGR-CWGPQEDQCQSLTKTVCAEQCDGRC------------FGPYVSNC-------CHRECAGGCFGPKDTDCF-ACTNFNDSGACVTQCPQP-FVYNPTTFQ 273          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Zebrafish
Match: egfra (epidermal growth factor receptor a (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian) [Source:ZFIN;Acc:ZDB-GENE-030918-1])

HSP 1 Score: 244.973 bits (624), Expect = 1.240e-65
Identity = 126/299 (42.14%), Postives = 188/299 (62.88%), Query Frame = 3
Query: 2586 PNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIR-ANRNIDIQEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPND 3479
            PN   L ++  T+       K +G+GAFG V++G+W P  ++++      + VA+KV+R A      +EIM+EA VMASV H H  RL+GICL   +  LIT  +  G L  Y+R++K  + S+ LL+W  QIA GM YLE R ++HRDLA RNVL+   + ++ITDFGLA ++   E    E    GG+VPI+W+ALE++ +  Y+H++DVWS+G+T+WE+ T+G +PYD +   EI   L +G RL QP IC++D+Y +M +CW  +A  RP F  L++  +   + P+ YL I  D
Sbjct:  698 PNQALLRILKETEFK---KIKVLGSGAFGTVHKGLWVPEGENVK------IPVAIKVLREATSPKANKEIMDEAYVMASVEHPHVCRLLGICLTSTVQ-LITQLMPYGCLLDYVRENKDRIGSQHLLNWCVQIAKGMNYLEERHLVHRDLAARNVLVKTPQHVKITDFGLAKLLNADE---KEYHADGGKVPIKWMALESIQHRTYTHQSDVWSYGVTVWELMTFGTKPYDGIPASEIAGVLEKGERLPQPPICTIDVYMIMVKCWMIDAESRPRFRELIAEFTKMARDPSRYLVIQGD 983          

HSP 2 Score: 93.9745 bits (232), Expect = 3.184e-39
Identity = 73/255 (28.63%), Postives = 117/255 (45.88%), Query Frame = 2
Query:  161 NCTHVEGNLVIQNVWPDQESGDLGFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQNSLALEKSEVSVYIDLLD--EENSQYAIFPKLRVIANNSVYFKTKVKHKFLPQSIKWEELFENPKKQKLITYN-KYMEH--QCHSDCLRNDFPYCWSSSANHCQKQSKCVKEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNTKLNPN--FKLRVGYMCANSCP 904
            NCT V  NL I ++    E  DL FL SI EV G + +  N++  I L NL++IRG +SL  +K  ++V ++  +  E+  +      L  I    V F     H     +I+W ++        ++++N  Y ++  +C   C       CW +  + CQ+ +K +       E C  + + G      C+E C  GC GP+ +DC  CK + +   C + CP   +YD    +L PN   K   G  C  +CP
Sbjct:   54 NCTVVLENLEITHI---TEKYDLSFLKSIQEVGGYVLIAVNTVSKIPLENLRIIRG-HSLYEDKFALAVLVNYNNSIEQGVKELPLTSLTEILKGGVRFNMN-NHLCNVGTIEWADILNMKSLPTIVSHNISYGKNCGKCDPSCFNGS---CWGTGPDKCQRMTKVI-----CAEQCSGRCK-GPRPIDCCNEHCAAGCTGPRPTDCLACKDFQDEGTCKDACPRLMLYDPNTHQLAPNPYGKYSFGATCIKTCP 294          

HSP 3 Score: 90.1225 bits (222), Expect = 3.184e-39
Identity = 96/360 (26.67%), Postives = 139/360 (38.61%), Query Frame = 3
Query:  900 VQEVDACIYSCNSLHFYRVDN----KCIRCQN--SSVCAXXXXXXXXXXXXXXXDVFYMTAAILKNFTDIEHVIGEFHFTAQSF--DKALGGITL-PMLYKHLGNVQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIMHTDLEFLGLRKLRRIF-GKFEVHDSPGLCYADTLNWTGNILKNNQ--------FDPIYPPC---NKPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRC---EDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCL-----QNCTGPRPTNCIGGCRYFKENDECVKNCSR-----------KYFSFNKTCIKCHETCMENDKNQPLCTG 1859
            V +  AC+ +C S   Y VD     KC RC+     VC       N +      +V  + A  + +F +   + G     + +F  D       L P     L  V+ ITG L+I      +++L+  +NL+ IR       + +  +  T +  LG+R LR I  G   +  +  LCY+   +W   + K+ Q         D     C   N  C+  C + GCWGPG  MC+ C  +    +CV  C     EP         ++Y  N     C  C P CL     Q C GP P  C   C  +K+   CV  C +           KY      C  CHE C +       CTG
Sbjct:  299 VTDHGACVRTC-SPGTYEVDEGGVRKCKRCEGLCPKVC-------NGLGMGPLANVLSINATNIDSFENCTKISGNVAILSTTFRGDPHTNTSGLDPAKLSVLSTVKEITGYLMIQLWPESMQSLSAFENLEVIRGRTKTQGTYSFAVTKTAITHLGMRSLREISDGDVSIVKNKNLCYSSPEHWK-RLFKSKQQSVKMIENMDAAT--CANQNSTCNEMCTADGCWGPGPTMCFGCEHYSRGKHCVASCNLLNGEP---------REYEVNK---TCMECDPECLLMNETQTCNGPGPDKCT-VCANYKDGPHCVHRCPQGVPGEKDTLIWKYADVTHVCQPCHENCTQG------CTG 628          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Zebrafish
Match: erbb4a (erb-b2 receptor tyrosine kinase 4a [Source:ZFIN;Acc:ZDB-GENE-030918-4])

HSP 1 Score: 242.662 bits (618), Expect = 6.307e-65
Identity = 165/518 (31.85%), Postives = 262/518 (50.58%), Query Frame = 3
Query: 2001 RQKSKEIGICQPCLEPCLECSGNYTIYP-TCEKCNGYWSGDRCVKQC---FPIALNLPRNASCPYCNGNCVER----CTVTPNDPFQCGSCNFKRLYLDNHNKSCVSECPQTHK------YKHKDGN----LTDIICMTRSQWLSYQENPKFISKWSLIILSVIT-VFLISSVYIFFR-YVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIRANRNIDIQ-EIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPNDSCLR 3491
            R+ SKE  IC P    C E +G +   P  C  C  +  G  CVK C   +         + C  C+  C +      T     P  C  C    L+L +   +CV +CP   +      +K+ + N         C         Q+    + +  LI   +I  +F+I  + +    Y+ + + KK     + + + + EP     L      PN  +L ++  T+L      K +G GAFG VY+G+W P  + ++      + VA+K++  +       E M+EA +MAS+ H H +RL+G+CL   +  L+T  +  G L  Y+ +H+  + S+ LL+W  QIA GM YLE R ++HRDLA RNVL+     I+ITDFGLA ++   E   N     GG++PI+W+ALE +    ++H++DVWS+G+T+WE+ T+G +PYD +  R+I   L +G RL QP IC++D+Y +M +CW  +A+ RP F+ L +  S   + P  YL I  D  ++
Sbjct:  289 RECSKEQKICDPL---CSE-AGCWGPGPDQCLSCKYFSRGKTCVKSCNLYYGDVREFANGSVCVECDSQCEKAGEKGLTCHGPGPDHCVKC----LHLKD-GPNCVEKCPDGLQGANSFIFKYAETNNECHPCHPNCTQGCTGPRIQDCVGILDRTPLIAAGLIGGLFVIVIIALGVAVYIRRKSIKKKRALRRFLETELVEP-----LTPSGAAPNQAQLRILKETELK---RVKILGAGAFGMVYKGIWVPEGETVK------IPVAIKILNESTGPKANVEFMDEALIMASMEHPHLVRLLGVCLSPTIQ-LVTQLMPHGCLLDYVHEHQDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHIKITDFGLARLLDTDEKEYNS---DGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTRDIPDILEKGERLPQPPICTIDVYMVMVKCWMIDADSRPRFKELAAEFSRMARDPQRYLVIQGDDRMK 779          

HSP 2 Score: 71.633 bits (174), Expect = 6.545e-12
Identity = 66/251 (26.29%), Postives = 100/251 (39.84%), Query Frame = 3
Query: 1188 VQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIMH---TDLEFLGLRKLRRIFGKFEVHDSPGLCYADTLNWTG--------NILKNNQFDPIYPPCNKPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQ------NCTGPRPTNCIGGCRYFKENDECVKNCSR----------KYFSFNKTCIKCHETCMENDKNQPLCTG 1859
            V+ ITG L +      + +L    NL  I      S  + L +     T L+F  LR++    G   + ++  LC+  T+NWT          ++KNN+         K CD  C   GCWGPG   C +C+ F     CV  C     +Y +   ++++ +     +C  C   C +       C GP P +C+  C + K+   CV+ C            KY   N  C  CH  C +       CTG
Sbjct:  190 VREITGFLNVQSWPENMTDLGVFSNLATIGGRSLYSGISLLILKQRWITSLQFQSLREISA--GNVYMTNNSQLCFYSTVNWTSLFRTSTQRALIKNNREPRECSKEQKICDPLCSEAGCWGPGPDQCLSCKYFSRGKTCVKSCNL---YYGD---VREFANG---SVCVECDSQCEKAGEKGLTCHGPGPDHCV-KCLHLKDGPNCVEKCPDGLQGANSFIFKYAETNNECHPCHPNCTQG------CTG 422          

HSP 3 Score: 63.929 bits (154), Expect = 1.436e-9
Identity = 34/85 (40.00%), Postives = 44/85 (51.76%), Query Frame = 3
Query: 1485 CDSKCDSQG-----CWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIG 1724
            CDS+C+  G     C GPG   C  C   +   NCV++C D  G     S I KY +  ++  C  CHP C Q CTGPR  +C+G
Sbjct:  350 CDSQCEKAGEKGLTCHGPGPDHCVKCLHLKDGPNCVEKCPD--GLQGANSFIFKYAETNNE--CHPCHPNCTQGCTGPRIQDCVG 430          

HSP 4 Score: 58.5362 bits (140), Expect = 6.463e-8
Identity = 26/65 (40.00%), Postives = 34/65 (52.31%), Query Frame = 2
Query:  716 CDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNTKL--NPNFKLRVGYMCANSCP 904
            C  +C GGC GPK++DC  C  + +   CV  CP  F+Y+    +L  NPN K   G  C   CP
Sbjct:   25 CHRECAGGCFGPKDTDCFACTNFNDSGACVTQCPQPFVYNPTTFQLEHNPNAKYTYGAFCVKKCP 89          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Zebrafish
Match: erbb4a (erb-b2 receptor tyrosine kinase 4a [Source:ZFIN;Acc:ZDB-GENE-030918-4])

HSP 1 Score: 242.276 bits (617), Expect = 1.562e-64
Identity = 165/518 (31.85%), Postives = 262/518 (50.58%), Query Frame = 3
Query: 2001 RQKSKEIGICQPCLEPCLECSGNYTIYP-TCEKCNGYWSGDRCVKQC---FPIALNLPRNASCPYCNGNCVER----CTVTPNDPFQCGSCNFKRLYLDNHNKSCVSECPQTHK------YKHKDGN----LTDIICMTRSQWLSYQENPKFISKWSLIILSVIT-VFLISSVYIFFR-YVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIRANRNIDIQ-EIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPNDSCLR 3491
            R+ SKE  IC P    C E +G +   P  C  C  +  G  CVK C   +         + C  C+  C +      T     P  C  C    L+L +   +CV +CP   +      +K+ + N         C         Q+    + +  LI   +I  +F+I  + +    Y+ + + KK     + + + + EP     L      PN  +L ++  T+L      K +G GAFG VY+G+W P  + ++      + VA+K++  +       E M+EA +MAS+ H H +RL+G+CL   +  L+T  +  G L  Y+ +H+  + S+ LL+W  QIA GM YLE R ++HRDLA RNVL+     I+ITDFGLA ++   E   N     GG++PI+W+ALE +    ++H++DVWS+G+T+WE+ T+G +PYD +  R+I   L +G RL QP IC++D+Y +M +CW  +A+ RP F+ L +  S   + P  YL I  D  ++
Sbjct:  467 RECSKEQKICDPL---CSE-AGCWGPGPDQCLSCKYFSRGKTCVKSCNLYYGDVREFANGSVCVECDSQCEKAGEKGLTCHGPGPDHCVKC----LHLKD-GPNCVEKCPDGLQGANSFIFKYAETNNECHPCHPNCTQGCTGPRIQDCVGILDRTPLIAAGLIGGLFVIVIIALGVAVYIRRKSIKKKRALRRFLETELVEP-----LTPSGAAPNQAQLRILKETELK---RVKILGAGAFGMVYKGIWVPEGETVK------IPVAIKILNESTGPKANVEFMDEALIMASMEHPHLVRLLGVCLSPTIQ-LVTQLMPHGCLLDYVHEHQDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHIKITDFGLARLLDTDEKEYNS---DGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTRDIPDILEKGERLPQPPICTIDVYMVMVKCWMIDADSRPRFKELAAEFSRMARDPQRYLVIQGDDRMK 957          

HSP 2 Score: 104.76 bits (260), Expect = 4.440e-22
Identity = 79/257 (30.74%), Postives = 118/257 (45.91%), Query Frame = 2
Query:  161 NCTHVEGNLVIQNVWPDQESGDLGFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQNSLALEKSEVSVYIDLLDEENSQYAI----FPKLRVIANNSVYFKTKVKHKFL--PQSIKWEELFENPKKQKLITYNKYMEHQCHSDCLRNDFPYCWSSSANHCQKQSKCV-KEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNTKL--NPNFKLRVGYMCANSCP 904
            NC  V GNL I ++   + + +L FL SI EVTG + +  N    + L NL++IRG     L +   S+ I L    +  + +       L  I N  VY     ++KFL    +I W ++ +NP+ + L+  +    + C   C R+    CW    + CQ  +K V  E+ D    C+     G      C  +C GGC GPK++DC  C  + +   CV  CP  F+Y+    +L  NPN K   G  C   CP
Sbjct:   28 NCEVVMGNLEITSI---ERNRNLSFLKSIREVTGYVLVALNQFDYLPLENLRIIRGTK---LYEGRYSLAIFLNYRRDGYFGLRQLGLKNLTEILNGGVYVD---QNKFLCHADTIHWHDIIKNPRSELLVVPSNNSGNTCRR-CHRSCNGRCWGHQEDQCQSLTKTVCAEQCDG--RCF-----GPYVSNCCHRECAGGCFGPKDTDCFACTNFNDSGACVTQCPQPFVYNPTTFQLEHNPNAKYTYGAFCVKKCP 267          

HSP 3 Score: 71.2478 bits (173), Expect = 8.074e-12
Identity = 66/251 (26.29%), Postives = 100/251 (39.84%), Query Frame = 3
Query: 1188 VQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIMH---TDLEFLGLRKLRRIFGKFEVHDSPGLCYADTLNWTG--------NILKNNQFDPIYPPCNKPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQ------NCTGPRPTNCIGGCRYFKENDECVKNCSR----------KYFSFNKTCIKCHETCMENDKNQPLCTG 1859
            V+ ITG L +      + +L    NL  I      S  + L +     T L+F  LR++    G   + ++  LC+  T+NWT          ++KNN+         K CD  C   GCWGPG   C +C+ F     CV  C     +Y +   ++++ +     +C  C   C +       C GP P +C+  C + K+   CV+ C            KY   N  C  CH  C +       CTG
Sbjct:  368 VREITGFLNVQSWPENMTDLGVFSNLATIGGRSLYSGISLLILKQRWITSLQFQSLREISA--GNVYMTNNSQLCFYSTVNWTSLFRTSTQRALIKNNREPRECSKEQKICDPLCSEAGCWGPGPDQCLSCKYFSRGKTCVKSCNL---YYGD---VREFANG---SVCVECDSQCEKAGEKGLTCHGPGPDHCV-KCLHLKDGPNCVEKCPDGLQGANSFIFKYAETNNECHPCHPNCTQG------CTG 600          

HSP 4 Score: 63.5438 bits (153), Expect = 1.716e-9
Identity = 34/85 (40.00%), Postives = 44/85 (51.76%), Query Frame = 3
Query: 1485 CDSKCDSQG-----CWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIG 1724
            CDS+C+  G     C GPG   C  C   +   NCV++C D  G     S I KY +  ++  C  CHP C Q CTGPR  +C+G
Sbjct:  528 CDSQCEKAGEKGLTCHGPGPDHCVKCLHLKDGPNCVEKCPD--GLQGANSFIFKYAETNNE--CHPCHPNCTQGCTGPRIQDCVG 608          

HSP 5 Score: 56.6102 bits (135), Expect = 2.531e-7
Identity = 91/407 (22.36%), Postives = 151/407 (37.10%), Query Frame = 3
Query: 1065 AILKNFTDIEHVIGEFHFTAQSFDKALGGITLPMLYKHLGNVQYITGDLIIDGSNIVLKNLTFL--QNLKEIRHLLTQSASAALNIM-------HTDLEFLGLRKLRRIF-GKFEVHDSPGLCYADTLNWTGNILKNNQFDPIYPPCN------KPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIGGCRYFKENDECVKNCSRKYFSFNKTCIKCHETCMENDKNQPLCTGESSILGLGGCSYCSKLIHKRDEKFYCYKDPCPRHYYLNKIDISEVMKRQKSKEIGICQPCLEPCLECSGNYTIYPTCEKCNGYWSGDRCVKQCFPIALNLPRNASCPYCNGNCVERCTVTPNDPFQ 2237
             + K + + E V+G    T+   ++ L           L +++ +TG +++      L    +L  +NL+ IR         +L I        +  L  LGL+ L  I  G   V  +  LC+ADT++W  +I+KN + + +  P N      + C   C+ + CWG     C +         C  RC               Y  N        CH  C   C GP+ T+C   C  F ++  CV  C +  F +N T  +     +E++ N     G          ++C K   K    F      C R    NK+++ E        +  +C PC + C +             C+G  +G   + Q    + N+ +  +C   NGN +   T    D F 
Sbjct:   21 TLRKFYENCEVVMGNLEITSIERNRNL---------SFLKSIREVTGYVLV-----ALNQFDYLPLENLRIIRGTKLYEGRYSLAIFLNYRRDGYFGLRQLGLKNLTEILNGGVYVDQNKFLCHADTIHWH-DIIKNPRSELLVVPSNNSGNTCRRCHRSCNGR-CWGHQEDQCQSLTKTVCAEQCDGRC------------FGPYVSNC-------CHRECAGGCFGPKDTDCF-ACTNFNDSGACVTQCPQP-FVYNPTTFQ-----LEHNPNAKYTYG----------AFCVK---KCPHNFVVDHSSCVRACPSNKMEVEE-------NQTKMCIPCTDICPKV------------CDGIGTGSLQMAQTVDSS-NIEKFVNCTKINGNLIFLITGIKGDMFH 352          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Xenopus
Match: gnb5 (guanine nucleotide binding protein (G protein), beta 5 [Source:Xenbase;Acc:XB-GENE-977853])

HSP 1 Score: 261.922 bits (668), Expect = 7.225e-71
Identity = 175/530 (33.02%), Postives = 281/530 (53.02%), Query Frame = 3
Query: 2058 CSGNYTIYP---TCEKCNGYWSGDRCVKQCFPIALNLPR----NASCPYCNGNCV-ERCTVTPN--DPFQCGSCNFKRLYLDNHNKSCVSECPQTHK-------YKHKDGNLTDIICMTRSQWLSYQENPKFISKWSLIILSVITVFLIS--------------SVYIFFRYVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIRANRNIDI-QEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPNDSCL---RPMKKDKHR-LLSQISYD 3539
            C GN    P    C +CNG+  G  C++ C  +    PR     + C  C+  C+ +  T+T N  +  QC  C     YLD  +  CV +CP   K       +K+ D    D IC   +   S+       S    I +S + V++++              ++ ++ R   ++ +K +++ L  +   + EP     L     IPN  ++ ++  T+L        +G+GAFG VY+G+W P  ++++      + VA+KV+R N +    +EI++EA VMA V   +  RL+GICL   +  L+T  +  G L  Y+R++K  + SR LL+W  QIA GMTYLE   ++HRDLA RNVL+     ++ITDFGLA ++   E    E    GG+VPI+W+ALE++L+  ++H++DVWS+G+T+WE+ T+G +PYD +  REI   L +G RL QP +C++D+Y +M +CW  ++  RP F  L+  LS   + P+ Y+ I N+  L    PM    +  LL ++  D
Sbjct:  481 CDGNKCWGPGPSQCVRCNGFLRGHDCIESCN-VLDGYPREHVNGSQCVPCHPQCLPQNGTLTCNGTEAHQCMECAH---YLDGED--CVEQCPSGVKGNSFVPIWKYPD---KDRICQLCNVNCSH-------SYVMFIGISTVQVYMVASIVISILIVITISTAIVLYIRRRKQLKKKHTMRRL--LQDELVEP-----LTPSGAIPNQAQMRILKETELK---KMMILGSGAFGTVYKGIWIPDGENIK------IPVAIKVLRENTSPKANKEILDEAYVMAGVGSPYVCRLLGICLTSTVQ-LVTQLMPYGCLLDYVRENKDRIASRDLLNWCVQIAKGMTYLEDVRLVHRDLAARNVLVKSPSHVKITDFGLARLLDVDE---TEYHADGGKVPIKWMALESILHRRFTHQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPVCTIDVYMIMVKCWMIDSEFRPKFRDLVGELSRMARDPSRYVVIENEEFLAQASPMTTQFYSALLQEVGMD 974          

HSP 2 Score: 89.3521 bits (220), Expect = 3.137e-17
Identity = 69/261 (26.44%), Postives = 115/261 (44.06%), Query Frame = 3
Query: 1056 MTAAILKNFTDIEHVIGEFHFTAQSF-------DKALGGITLPMLYKHLGNVQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIMHTDLEFLGLRKLRRIF-GKFEVHDSPGLCYADTLNWTGNILKNNQFDPIYPPCNKP---------CDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGI-CQRCHPLCL-QN----CTGPRPTNCIGGCRYFKENDECVKNC 1769
            + A+I+ +F     + G   F ++SF       +  L   +L +       ++ ITG + I+     LK+L   +NL+ I   + Q+ + +L + +  +  LGLR L  +  G   +  +P LC+ ++  W    L  N    I    NKP         C S+CD   CWGPG   C  C GF   ++C++ C          + +  Y   + +G  C  CHP CL QN    C G     C+  C ++ + ++CV+ C
Sbjct:  323 VNASIIHHFQGCTKIFGSLVFLSESFKPDPNKPNSVLNAQSLEVF----KTLEEITGYIYIESWPEELKSLNVFENLRVIHGRMLQNGAYSLVLRNLSISHLGLRSLTEVSSGLVLIEGNPDLCFLESAPWAS--LFRNPRQTILKTINKPQEAYQEGQNCFSRCDGNKCWGPGPSQCVRCNGFLRGHDCIESC----------NVLDGYPREHVNGSQCVPCHPQCLPQNGTLTCNGTEAHQCM-ECAHYLDGEDCVEQC 566          

HSP 3 Score: 67.0106 bits (162), Expect = 2.458e-10
Identity = 70/266 (26.32%), Postives = 109/266 (40.98%), Query Frame = 2
Query:  158 HNCTHVEGNLVIQNVWPDQESGDLGFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQNSLALEKSEVSVYIDLLDEENSQYAIFPKLRVIANNSV---YFKTKVKHKFLPQSIKWEELFENPKKQKLITYNK------------YMEHQCHSDCLRNDFPYCWSSSANHCQKQSKCVKEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGN--TKLNPNFKLRVGYMCANSCP 904
             +C  ++GNL I  +   +E  D+ FL  I EV G + + +N +  + L NL++IRG   L  E+  ++V   L + + S  A   K  VI  N+    +  T +    L Q +    L + P     I++               +  +C   C    FP   +S+  +    S C + K ++   C             C EQC  GC GPKNSDC  C  + +   C  +CPP   Y+     +  N   +   G  C  SCP
Sbjct:   30 RDCQVIQGNLEITYL---KEDNDVSFLKDIKEVQGYVLIAHNLLSYVPLENLRIIRG-TQLYQERYALAV---LSNSDPSGTAEILKGGVIMENNTQLCFQDTVLWADILSQILSRIMLLQIPPPYFQISHTGRNFMCFASGAGLAIRCECFVSC---SFPLPVTSTICN----SGCQRCKGNHSTHC-------------CHEQCAAGCTGPKNSDCLACLHFNHNGVCGLHCPPLRTYNPETYESVHNEGGRYTFGASCVTSCP 268          

HSP 4 Score: 55.0694 bits (131), Expect = 1.032e-6
Identity = 66/249 (26.51%), Postives = 105/249 (42.17%), Query Frame = 2
Query:  158 HNCTHVEGNLVI--QNVWPDQE-------SGDLGFLSSIIEVTGMIFMKN--NSIKDI-ILPNLKVIRGQNSLALEKSEVSVYIDLLDEENSQYAIFPKLRVIANNSVYFKTKVKHKFLPQSIKWEELFENPKKQKLITYNK----YMEHQ-CHSDCLRNDFPYCWSSSANHCQKQSKCVKEKVDNIEWCYFKMRNGEIDEGFCDEQC------------TGGCNGPKNSDCAVCKKYVNGNHCVEYCP 817
              CT + G+LV   ++  PD         +  L    ++ E+TG I++++    +K + +  NL+VI G+    L+    S+   +L   +  +     L  +++  V  +      FL +S  W  LF NP++  L T NK    Y E Q C S C  N    CW    + C + +  ++   D IE C   + +G   E     QC            T  CNG +   C  C  Y++G  CVE CP
Sbjct:  332 QGCTKIFGSLVFLSESFKPDPNKPNSVLNAQSLEVFKTLEEITGYIYIESWPEELKSLNVFENLRVIHGR---MLQNGAYSL---VLRNLSISHLGLRSLTEVSSGLVLIEGNPDLCFL-ESAPWASLFRNPRQTILKTINKPQEAYQEGQNCFSRCDGNK---CWGPGPSQCVRCNGFLRGH-DCIESC--NVLDGYPREHVNGSQCVPCHPQCLPQNGTLTCNGTEAHQCMECAHYLDGEDCVEQCP 567          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Xenopus
Match: gnb5 (guanine nucleotide binding protein (G protein), beta 5 [Source:Xenbase;Acc:XB-GENE-977853])

HSP 1 Score: 260.381 bits (664), Expect = 8.216e-71
Identity = 236/832 (28.37%), Postives = 369/832 (44.35%), Query Frame = 3
Query: 1215 IDGSNIVLKNL---TFLQNLKEIRHLLTQSASAALNIMHTD--LEFLGLRKLRR------IFGKFEVHDSPGLCYADTLNWTGNILKNNQFDPIYPPCNKPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRC---------HPLCLQNCTGPRPTNCIGGCRYFKEND-------------------------------ECVKNCSRKYFSFNKTCIKCHETCMENDKNQPLCTGESSILGLGGCSYCSKLIHKRDEKFYCYKDPCPRHYYLNKIDISEVMKRQKSKEIGICQPCLEPCLECSGNYTIYP---TCEKCNGYWSGDRCVKQCFPIALNLPR----NASCPYCNGNCV-ERCTVTPN--DPFQCGSCNFKRLYLDNHNKSCVSECPQTHK-------YKHKDGNLTDIICMTRSQWLSYQENPKFISKWSLIILSVITV-----------FLISSVYIFFRYVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIRANRNIDI-QEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNI 3470
            + G  ++  NL     L+NL+ IR         AL ++         GLR+LR       + G   + ++  LC+ DT+ W  +IL+ N                            MC+      A+     RCE     + + S     T    +  CQRC         H  C   CTGP+ ++C+  C +F  N                                 CV +C  KYF  N   I    T  E      L  G   +  L    + S   +             PR   L  I+  +    Q+       Q C      C GN    P    C +CNG+  G  C++ C  +    PR     + C  C+  C+ +  T+T N  +  QC  C     YLD  +  CV +CP   K       +K+ D    D IC   +   S+     FI   S ++  V  V            + +++ ++ R   ++ +K +++ L  +   + EP     L     IPN  ++ ++  T+L        +G+GAFG VY+G+W P  ++++      + VA+KV+R N +    +EI++EA VMA V   +  RL+GICL   +  L+T  +  G L  Y+R++K  + SR LL+W  QIA GMTYLE   ++HRDLA RNVL+     ++ITDFGLA ++   E    E    GG+VPI+W+ALE++L+  ++H++DVWS+G+T+WE+ T+G +PYD +  REI   L +G RL QP +C++D+Y +M +CW  ++  RP F  L+  LS   + P+ Y+ I
Sbjct:   59 VQGYVLIAHNLLSYVPLENLRIIRGTQLYQERYALAVLSNSDPSGTAGLRELRMKNLTEILKGGVIMENNTQLCFQDTVLWA-DILRRN---------------------------FMCFASGAGLAI-----RCE----CFVSCSFPLPVTSTICNSGCQRCKGNHSTHCCHEQCAAGCTGPKNSDCLA-CLHFNHNGVCGLHCPPLRTYNPETYESVHNEGGRYTFGASCVTSCPCKYFLLN--IIGHKATFQEVSSGLVLIEGNPDLCFLESAPWASLFRN-------------PRQTILKTINKPQEACDQEG------QNCFS---RCDGNKCWGPGPSQCVRCNGFLRGHDCIESC-NVLDGYPREHVNGSQCVPCHPQCLPQNGTLTCNGTEAHQCMECAH---YLDGED--CVEQCPSGVKGNSFVPIWKYPD---KDRICQLCNVNCSH-SYVMFIG-ISTVLYQVYMVASIVISILIVITISTAIVLYIRRRKQLKKKHTMRRL--LQDELVEP-----LTPSGAIPNQAQMRILKETELK---KMMILGSGAFGTVYKGIWIPDGENIK------IPVAIKVLRENTSPKANKEILDEAYVMAGVGSPYVCRLLGICLTSTVQ-LVTQLMPYGCLLDYVRENKDRIASRDLLNWCVQIAKGMTYLEDVRLVHRDLAARNVLVKSPSHVKITDFGLARLLDVDE---TEYHADGGKVPIKWMALESILHRRFTHQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPVCTIDVYMIMVKCWMIDSEFRPKFRDLVGELSRMARDPSRYVVI 797          

HSP 2 Score: 68.1662 bits (165), Expect = 1.020e-10
Identity = 70/255 (27.45%), Postives = 107/255 (41.96%), Query Frame = 2
Query:  161 NCTHVEGNLVIQNVWPDQESGDLGFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQNSLALEKSEVSVYIDLLDEENSQYAIFPKLRVIANNSVYFKTKVKHKFLPQSIKWEELFENPKKQKLITYNKYMEHQCHSDCLRNDFPYCWSSSAN---HCQKQSKCVKEKVDNIEWCYFKMRN--GEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIY--DRGNTKLNPNFKLRVGYMCANSCP 904
            +C  ++GNL I  +   +E  D+ FL  I EV G + + +N +  + L NL++IRG   L  E+  ++V   L + + S  A   +LR+              K L + +K   + EN       T   + +    +D LR +F  C++S A     C+    C          C    +   G      C EQC  GC GPKNSDC  C  + +   C  +CPP   Y  +   +  N   +   G  C  SCP
Sbjct:   31 DCQVIQGNLEITYL---KEDNDVSFLKDIKEVQGYVLIAHNLLSYVPLENLRIIRG-TQLYQERYALAV---LSNSDPSGTAGLRELRM--------------KNLTEILKGGVIMENN------TQLCFQDTVLWADILRRNF-MCFASGAGLAIRCECFVSCSFPLPVTSTICNSGCQRCKGNHSTHCCHEQCAAGCTGPKNSDCLACLHFNHNGVCGLHCPPLRTYNPETYESVHNEGGRYTFGASCVTSCP 257          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Xenopus
Match: gnb5 (guanine nucleotide binding protein (G protein), beta 5 [Source:Xenbase;Acc:XB-GENE-977853])

HSP 1 Score: 261.536 bits (667), Expect = 8.803e-71
Identity = 175/519 (33.72%), Postives = 280/519 (53.95%), Query Frame = 3
Query: 2058 CSGNYTIYP---TCEKCNGYWSGDRCVKQCFPIALNLPR----NASCPYCNGNCV-ERCTVTPN--DPFQCGSCNFKRLYLDNHNKSCVSECPQTHK-------YKHKDGNLTDIICMTRSQWLSYQENPKFISKWSLIILSVITVFLI---SSVYIFFRYVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIRANRNIDI-QEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPNDSCL---RPMKKDKHR-LLSQISYD 3539
            C GN    P    C +CNG+  G  C++ C  +    PR     + C  C+  C+ +  T+T N  +  QC  C     YLD  +  CV +CP   K       +K+ D    D IC   +   S+  N      W L  + +  + +I   +++ ++ R   ++ +K +++ L  +   + EP     L     IPN  ++ ++  T+L        +G+GAFG VY+G+W P  ++++      + VA+KV+R N +    +EI++EA VMA V   +  RL+GICL   +  L+T  +  G L  Y+R++K  + SR LL+W  QIA GMTYLE   ++HRDLA RNVL+     ++ITDFGLA ++   E    E    GG+VPI+W+ALE++L+  ++H++DVWS+G+T+WE+ T+G +PYD +  REI   L +G RL QP +C++D+Y +M +CW  ++  RP F  L+  LS   + P+ Y+ I N+  L    PM    +  LL ++  D
Sbjct:  507 CDGNKCWGPGPSQCVRCNGFLRGHDCIESCN-VLDGYPREHVNGSQCVPCHPQCLPQNGTLTCNGTEAHQCMECAH---YLDGED--CVEQCPSGVKGNSFVPIWKYPD---KDRICQLCNVNCSHSCNQLDERVWRLTSIVISILIVITISTAIVLYIRRRKQLKKKHTMRRL--LQDELVEP-----LTPSGAIPNQAQMRILKETELK---KMMILGSGAFGTVYKGIWIPDGENIK------IPVAIKVLRENTSPKANKEILDEAYVMAGVGSPYVCRLLGICLTSTVQ-LVTQLMPYGCLLDYVRENKDRIASRDLLNWCVQIAKGMTYLEDVRLVHRDLAARNVLVKSPSHVKITDFGLARLLDVDE---TEYHADGGKVPIKWMALESILHRRFTHQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPVCTIDVYMIMVKCWMIDSEFRPKFRDLVGELSRMARDPSRYVVIENEEFLAQASPMTTQFYSALLQEVGMD 996          

HSP 2 Score: 89.3521 bits (220), Expect = 3.770e-17
Identity = 74/291 (25.43%), Postives = 123/291 (42.27%), Query Frame = 3
Query: 1056 MTAAILKNFTDIEHVIGEFHFTAQSF-------DKALGGITLPMLYKHLGNVQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIMHTDLEFLGLRKLRRIF-GKFEVHDSPGLCYADTLNWTGNILKNNQFDPIYPPCNKP----------CDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGI-CQRCHPLCL-QN----CTGPRPTNCIGGCRYFKENDECVKNCSR-----------KYFSFNKTCIKCHETC 1823
            + A+I+ +F     + G   F ++SF       +  L   +L +       ++ ITG + I+     LK+L   +NL+ I   + Q+ + +L + +  +  LGLR L  +  G   +  +P LC+ ++  W    L  N    I    NKP          C S+CD   CWGPG   C  C GF   ++C++ C          + +  Y   + +G  C  CHP CL QN    C G     C+  C ++ + ++CV+ C             KY   ++ C  C+  C
Sbjct:  348 VNASIIHHFQGCTKIFGSLVFLSESFKPDPNKPNSVLNAQSLEVFK----TLEEITGYIYIESWPEELKSLNVFENLRVIHGRMLQNGAYSLVLRNLSISHLGLRSLTEVSSGLVLIEGNPDLCFLESAPWAS--LFRNPRQTILKTINKPQEACDQEGQNCFSRCDGNKCWGPGPSQCVRCNGFLRGHDCIESC----------NVLDGYPREHVNGSQCVPCHPQCLPQNGTLTCNGTEAHQCM-ECAHYLDGEDCVEQCPSGVKGNSFVPIWKYPDKDRICQLCNVNC 621          

HSP 3 Score: 75.485 bits (184), Expect = 6.105e-13
Identity = 69/268 (25.75%), Postives = 108/268 (40.30%), Query Frame = 2
Query:  158 HNCTHVEGNLVIQNVWPDQESGDLGFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQNSLALEKSEVSVYIDLLDEENSQYAIFPKLRV-----IANNSVYFKTKVKHKFLPQSIKWEELFENPKKQK-LITYNKYMEHQCHSDCLRNDFP-----YCWSSSANHCQK------QSKCVKEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGN--TKLNPNFKLRVGYMCANSCP 904
             +C  ++GNL I  +   +E  D+ FL  I EV G + + +N +  + L NL++IRG   L  E+  ++V   L + + S  A   +LR+     I    V  +   +  F   ++ W ++      Q+  +         C   C     P     +CW     +CQ        S C + K ++   C             C EQC  GC GPKNSDC  C  + +   C  +CPP   Y+     +  N   +   G  C  SCP
Sbjct:   49 RDCQVIQGNLEITYL---KEDNDVSFLKDIKEVQGYVLIAHNLLSYVPLENLRIIRG-TQLYQERYALAV---LSNSDPSGTAGLRELRMKNLTEILKGGVIMENNTQLCF-QDTVLWADILSQSNSQRNEVVLGSSNRPTCSPGC--GSLPSGKSGFCWGEGQEYCQILTSTICNSGCQRCKGNHSTHC-------------CHEQCAAGCTGPKNSDCLACLHFNHNGVCGLHCPPLRTYNPETYESVHNEGGRYTFGASCVTSCP 293          

HSP 4 Score: 53.1434 bits (126), Expect = 3.647e-6
Identity = 64/250 (25.60%), Postives = 103/250 (41.20%), Query Frame = 2
Query:  158 HNCTHVEGNLVI--QNVWPDQE-------SGDLGFLSSIIEVTGMIFMKN--NSIKDI-ILPNLKVIRGQNSLALEKSEVSVYIDLLDEENSQYAIFPKLRVIANNSVYFKTKVKHKFLPQSIKWEELFENPKKQKLITYNKYME------HQCHSDCLRNDFPYCWSSSANHCQKQSKCVKEKVDNIEWCYFKMRNGEIDEGFCDEQC------------TGGCNGPKNSDCAVCKKYVNGNHCVEYCP 817
              CT + G+LV   ++  PD         +  L    ++ E+TG I++++    +K + +  NL+VI G+    L+    S+   +L   +  +     L  +++  V  +      FL +S  W  LF NP++  L T NK  E        C S C  N    CW    + C + +  ++   D IE C   + +G   E     QC            T  CNG +   C  C  Y++G  CVE CP
Sbjct:  357 QGCTKIFGSLVFLSESFKPDPNKPNSVLNAQSLEVFKTLEEITGYIYIESWPEELKSLNVFENLRVIHGR---MLQNGAYSL---VLRNLSISHLGLRSLTEVSSGLVLIEGNPDLCFL-ESAPWASLFRNPRQTILKTINKPQEACDQEGQNCFSRCDGNK---CWGPGPSQCVRCNGFLRGH-DCIESC--NVLDGYPREHVNGSQCVPCHPQCLPQNGTLTCNGTEAHQCMECAHYLDGEDCVEQCP 593          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Xenopus
Match: gnb5 (guanine nucleotide binding protein (G protein), beta 5 [Source:Xenbase;Acc:XB-GENE-977853])

HSP 1 Score: 261.536 bits (667), Expect = 1.077e-70
Identity = 175/519 (33.72%), Postives = 280/519 (53.95%), Query Frame = 3
Query: 2058 CSGNYTIYP---TCEKCNGYWSGDRCVKQCFPIALNLPR----NASCPYCNGNCV-ERCTVTPN--DPFQCGSCNFKRLYLDNHNKSCVSECPQTHK-------YKHKDGNLTDIICMTRSQWLSYQENPKFISKWSLIILSVITVFLI---SSVYIFFRYVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIRANRNIDI-QEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPNDSCL---RPMKKDKHR-LLSQISYD 3539
            C GN    P    C +CNG+  G  C++ C  +    PR     + C  C+  C+ +  T+T N  +  QC  C     YLD  +  CV +CP   K       +K+ D    D IC   +   S+  N      W L  + +  + +I   +++ ++ R   ++ +K +++ L  +   + EP     L     IPN  ++ ++  T+L        +G+GAFG VY+G+W P  ++++      + VA+KV+R N +    +EI++EA VMA V   +  RL+GICL   +  L+T  +  G L  Y+R++K  + SR LL+W  QIA GMTYLE   ++HRDLA RNVL+     ++ITDFGLA ++   E    E    GG+VPI+W+ALE++L+  ++H++DVWS+G+T+WE+ T+G +PYD +  REI   L +G RL QP +C++D+Y +M +CW  ++  RP F  L+  LS   + P+ Y+ I N+  L    PM    +  LL ++  D
Sbjct:  514 CDGNKCWGPGPSQCVRCNGFLRGHDCIESCN-VLDGYPREHVNGSQCVPCHPQCLPQNGTLTCNGTEAHQCMECAH---YLDGED--CVEQCPSGVKGNSFVPIWKYPD---KDRICQLCNVNCSHSCNQLDERVWRLTSIVISILIVITISTAIVLYIRRRKQLKKKHTMRRL--LQDELVEP-----LTPSGAIPNQAQMRILKETELK---KMMILGSGAFGTVYKGIWIPDGENIK------IPVAIKVLRENTSPKANKEILDEAYVMAGVGSPYVCRLLGICLTSTVQ-LVTQLMPYGCLLDYVRENKDRIASRDLLNWCVQIAKGMTYLEDVRLVHRDLAARNVLVKSPSHVKITDFGLARLLDVDE---TEYHADGGKVPIKWMALESILHRRFTHQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPVCTIDVYMIMVKCWMIDSEFRPKFRDLVGELSRMARDPSRYVVIENEEFLAQASPMTTQFYSALLQEVGMD 1003          

HSP 2 Score: 89.3521 bits (220), Expect = 3.717e-17
Identity = 69/262 (26.34%), Postives = 115/262 (43.89%), Query Frame = 3
Query: 1056 MTAAILKNFTDIEHVIGEFHFTAQSF-------DKALGGITLPMLYKHLGNVQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIMHTDLEFLGLRKLRRIF-GKFEVHDSPGLCYADTLNWTGNILKNNQFDPIYPPCNKP----------CDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGI-CQRCHPLCL-QN----CTGPRPTNCIGGCRYFKENDECVKNC 1769
            + A+I+ +F     + G   F ++SF       +  L   +L +       ++ ITG + I+     LK+L   +NL+ I   + Q+ + +L + +  +  LGLR L  +  G   +  +P LC+ ++  W    L  N    I    NKP          C S+CD   CWGPG   C  C GF   ++C++ C          + +  Y   + +G  C  CHP CL QN    C G     C+  C ++ + ++CV+ C
Sbjct:  355 VNASIIHHFQGCTKIFGSLVFLSESFKPDPNKPNSVLNAQSLEVFK----TLEEITGYIYIESWPEELKSLNVFENLRVIHGRMLQNGAYSLVLRNLSISHLGLRSLTEVSSGLVLIEGNPDLCFLESAPWAS--LFRNPRQTILKTINKPQEACDQEGQNCFSRCDGNKCWGPGPSQCVRCNGFLRGHDCIESC----------NVLDGYPREHVNGSQCVPCHPQCLPQNGTLTCNGTEAHQCM-ECAHYLDGEDCVEQC 599          

HSP 3 Score: 75.0998 bits (183), Expect = 7.887e-13
Identity = 69/268 (25.75%), Postives = 108/268 (40.30%), Query Frame = 2
Query:  158 HNCTHVEGNLVIQNVWPDQESGDLGFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQNSLALEKSEVSVYIDLLDEENSQYAIFPKLRV-----IANNSVYFKTKVKHKFLPQSIKWEELFENPKKQK-LITYNKYMEHQCHSDCLRNDFP-----YCWSSSANHCQK------QSKCVKEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGN--TKLNPNFKLRVGYMCANSCP 904
             +C  ++GNL I  +   +E  D+ FL  I EV G + + +N +  + L NL++IRG   L  E+  ++V   L + + S  A   +LR+     I    V  +   +  F   ++ W ++      Q+  +         C   C     P     +CW     +CQ        S C + K ++   C             C EQC  GC GPKNSDC  C  + +   C  +CPP   Y+     +  N   +   G  C  SCP
Sbjct:   56 RDCQVIQGNLEITYL---KEDNDVSFLKDIKEVQGYVLIAHNLLSYVPLENLRIIRG-TQLYQERYALAV---LSNSDPSGTAGLRELRMKNLTEILKGGVIMENNTQLCF-QDTVLWADILSQSNSQRNEVVLGSSNRPTCSPGC--GSLPSGKSGFCWGEGQEYCQILTSTICNSGCQRCKGNHSTHC-------------CHEQCAAGCTGPKNSDCLACLHFNHNGVCGLHCPPLRTYNPETYESVHNEGGRYTFGASCVTSCP 300          

HSP 4 Score: 53.1434 bits (126), Expect = 4.251e-6
Identity = 64/250 (25.60%), Postives = 103/250 (41.20%), Query Frame = 2
Query:  158 HNCTHVEGNLVI--QNVWPDQE-------SGDLGFLSSIIEVTGMIFMKN--NSIKDI-ILPNLKVIRGQNSLALEKSEVSVYIDLLDEENSQYAIFPKLRVIANNSVYFKTKVKHKFLPQSIKWEELFENPKKQKLITYNKYME------HQCHSDCLRNDFPYCWSSSANHCQKQSKCVKEKVDNIEWCYFKMRNGEIDEGFCDEQC------------TGGCNGPKNSDCAVCKKYVNGNHCVEYCP 817
              CT + G+LV   ++  PD         +  L    ++ E+TG I++++    +K + +  NL+VI G+    L+    S+   +L   +  +     L  +++  V  +      FL +S  W  LF NP++  L T NK  E        C S C  N    CW    + C + +  ++   D IE C   + +G   E     QC            T  CNG +   C  C  Y++G  CVE CP
Sbjct:  364 QGCTKIFGSLVFLSESFKPDPNKPNSVLNAQSLEVFKTLEEITGYIYIESWPEELKSLNVFENLRVIHGR---MLQNGAYSL---VLRNLSISHLGLRSLTEVSSGLVLIEGNPDLCFL-ESAPWASLFRNPRQTILKTINKPQEACDQEGQNCFSRCDGNK---CWGPGPSQCVRCNGFLRGH-DCIESC--NVLDGYPREHVNGSQCVPCHPQCLPQNGTLTCNGTEAHQCMECAHYLDGEDCVEQCP 600          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Xenopus
Match: gnb5 (guanine nucleotide binding protein (G protein), beta 5 [Source:Xenbase;Acc:XB-GENE-977853])

HSP 1 Score: 261.536 bits (667), Expect = 1.545e-70
Identity = 173/526 (32.89%), Postives = 280/526 (53.23%), Query Frame = 3
Query: 2058 CSGNYTIYP---TCEKCNGYWSGDRCVKQCFPIALNLPR----NASCPYCNGNCV-ERCTVTPN--DPFQCGSCNFKRLYLDNHNKSCVSECPQ---------THKYKHKDG--NLTDIICMTRSQWLSYQENPKFISKWSLIILSVITVFLI------SSVYIFFRYVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIRANRNIDI-QEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPNDSCL---RPMKKDKHR-LLSQISYD 3539
            C GN    P    C +CNG+  G  C++ C  +    PR     + C  C+  C+ +  T+T N  +  QC  C     YLD  +  CV +CP            KY  KD    L ++ C      L  +  P       + +++ I + ++      +++ ++ R   ++ +K +++ L  +   + EP     L     IPN  ++ ++  T+L        +G+GAFG VY+G+W P  ++++      + VA+KV+R N +    +EI++EA VMA V   +  RL+GICL   +  L+T  +  G L  Y+R++K  + SR LL+W  QIA GMTYLE   ++HRDLA RNVL+     ++ITDFGLA ++   E    E    GG+VPI+W+ALE++L+  ++H++DVWS+G+T+WE+ T+G +PYD +  REI   L +G RL QP +C++D+Y +M +CW  ++  RP F  L+  LS   + P+ Y+ I N+  L    PM    +  LL ++  D
Sbjct:  515 CDGNKCWGPGPSQCVRCNGFLRGHDCIESCN-VLDGYPREHVNGSQCVPCHPQCLPQNGTLTCNGTEAHQCMECAH---YLDGED--CVEQCPSGVKGNSFVPIWKYPDKDRICQLCNVNCSHSCNQLDERGCPILPDNSQVYMVASIVISILIVITISTAIVLYIRRRKQLKKKHTMRRL--LQDELVEP-----LTPSGAIPNQAQMRILKETELK---KMMILGSGAFGTVYKGIWIPDGENIK------IPVAIKVLRENTSPKANKEILDEAYVMAGVGSPYVCRLLGICLTSTVQ-LVTQLMPYGCLLDYVRENKDRIASRDLLNWCVQIAKGMTYLEDVRLVHRDLAARNVLVKSPSHVKITDFGLARLLDVDE---TEYHADGGKVPIKWMALESILHRRFTHQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPVCTIDVYMIMVKCWMIDSEFRPKFRDLVGELSRMARDPSRYVVIENEEFLAQASPMTTQFYSALLQEVGMD 1014          

HSP 2 Score: 89.3521 bits (220), Expect = 3.503e-17
Identity = 69/262 (26.34%), Postives = 115/262 (43.89%), Query Frame = 3
Query: 1056 MTAAILKNFTDIEHVIGEFHFTAQSF-------DKALGGITLPMLYKHLGNVQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIMHTDLEFLGLRKLRRIF-GKFEVHDSPGLCYADTLNWTGNILKNNQFDPIYPPCNKP----------CDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGI-CQRCHPLCL-QN----CTGPRPTNCIGGCRYFKENDECVKNC 1769
            + A+I+ +F     + G   F ++SF       +  L   +L +       ++ ITG + I+     LK+L   +NL+ I   + Q+ + +L + +  +  LGLR L  +  G   +  +P LC+ ++  W    L  N    I    NKP          C S+CD   CWGPG   C  C GF   ++C++ C          + +  Y   + +G  C  CHP CL QN    C G     C+  C ++ + ++CV+ C
Sbjct:  356 VNASIIHHFQGCTKIFGSLVFLSESFKPDPNKPNSVLNAQSLEVFK----TLEEITGYIYIESWPEELKSLNVFENLRVIHGRMLQNGAYSLVLRNLSISHLGLRSLTEVSSGLVLIEGNPDLCFLESAPWAS--LFRNPRQTILKTINKPQEACDQEGQNCFSRCDGNKCWGPGPSQCVRCNGFLRGHDCIESC----------NVLDGYPREHVNGSQCVPCHPQCLPQNGTLTCNGTEAHQCM-ECAHYLDGEDCVEQC 600          

HSP 3 Score: 73.559 bits (179), Expect = 2.253e-12
Identity = 69/270 (25.56%), Postives = 110/270 (40.74%), Query Frame = 2
Query:  158 HNCTHVEGNLVIQNVWPDQESGDLGFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQNSLALEKSEVSVYIDLLDEENSQYAIFPKLRV-----IANNSVYFKTKVKHKFLPQSIKWEELFENPKKQK---LITYNKYMEHQCHSDCLRNDFP-----YCWSSSANHCQK------QSKCVKEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGN--TKLNPNFKLRVGYMCANSCP 904
             +C  ++GNL I  +   +E  D+ FL  I EV G + + +N +  + L NL++IRG   L  E+  ++V   L + + S  A   +LR+     I    V  +   +  F   ++ W ++      Q+   ++  +      C   C     P     +CW     +CQ        S C + K ++   C             C EQC  GC GPKNSDC  C  + +   C  +CPP   Y+     +  N   +   G  C  SCP
Sbjct:   55 RDCQVIQGNLEITYL---KEDNDVSFLKDIKEVQGYVLIAHNLLSYVPLENLRIIRG-TQLYQERYALAV---LSNSDPSGTAGLRELRMKNLTEILKGGVIMENNTQLCF-QDTVLWADILSQSNSQRNEVVLGSSNRQCPTCSPGC--GSLPSGKSGFCWGEGQEYCQILTSTICNSGCQRCKGNHSTHC-------------CHEQCAAGCTGPKNSDCLACLHFNHNGVCGLHCPPLRTYNPETYESVHNEGGRYTFGASCVTSCP 301          

HSP 4 Score: 52.7582 bits (125), Expect = 5.199e-6
Identity = 64/250 (25.60%), Postives = 103/250 (41.20%), Query Frame = 2
Query:  158 HNCTHVEGNLVI--QNVWPDQE-------SGDLGFLSSIIEVTGMIFMKN--NSIKDI-ILPNLKVIRGQNSLALEKSEVSVYIDLLDEENSQYAIFPKLRVIANNSVYFKTKVKHKFLPQSIKWEELFENPKKQKLITYNKYME------HQCHSDCLRNDFPYCWSSSANHCQKQSKCVKEKVDNIEWCYFKMRNGEIDEGFCDEQC------------TGGCNGPKNSDCAVCKKYVNGNHCVEYCP 817
              CT + G+LV   ++  PD         +  L    ++ E+TG I++++    +K + +  NL+VI G+    L+    S+ +  L   +  +     L  +++  V  +      FL +S  W  LF NP++  L T NK  E        C S C   D   CW    + C + +  ++   D IE C   + +G   E     QC            T  CNG +   C  C  Y++G  CVE CP
Sbjct:  365 QGCTKIFGSLVFLSESFKPDPNKPNSVLNAQSLEVFKTLEEITGYIYIESWPEELKSLNVFENLRVIHGR---MLQNGAYSLVLRNL---SISHLGLRSLTEVSSGLVLIEGNPDLCFL-ESAPWASLFRNPRQTILKTINKPQEACDQEGQNCFSRC---DGNKCWGPGPSQCVRCNGFLRGH-DCIESC--NVLDGYPREHVNGSQCVPCHPQCLPQNGTLTCNGTEAHQCMECAHYLDGEDCVEQCP 601          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Mouse
Match: Egfr (epidermal growth factor receptor [Source:MGI Symbol;Acc:MGI:95294])

HSP 1 Score: 259.996 bits (663), Expect = 2.040e-70
Identity = 167/489 (34.15%), Postives = 256/489 (52.35%), Query Frame = 3
Query: 2088 CEKCNGYWSGDRCVKQCFPIALNLPR----NASCPYCNGNCVERC---TVTPNDPFQCGSCNFKRLYLDNHNKSCVSECP-------QTHKYKHKDGNLTDIICMTRSQW----------LSYQENPKFISKWSLIILSVITVFLISSVYIFFRYVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIR-ANRNIDIQEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPND 3479
            C  C     G  CV++C  I    PR    N+ C  C+  C+ +    T T   P  C  C     Y+D  +  CV  CP        T  +K+ D N    +C     +            +   PK  S  + I+  ++ + +++     F     I +K++++ L      + E +    L      PN   L ++  T+       K +G+GAFG VY+G+W P  + ++      + VA+K +R A      +EI++EA VMASV + H  RL+GICL   +  LIT  +  G L  Y+R+HK  + S+ LL+W  QIA GM YLE R ++HRDLA RNVL+   + ++ITDFGLA ++   E    E    GG+VPI+W+ALE++L+ IY+H++DVWS+G+T+WE+ T+G +PYD +   +I+S L +G RL QP IC++D+Y +M +CW  +A+ RP F  L+   S   + P  YL I  D
Sbjct:  523 CVSCQNVSRGRECVEKCN-ILEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAH---YIDGPH--CVKTCPAGIMGENNTLVWKYADANNVCHLCHANCTYGCAGPGLQGCEVWPSGPKIPSIATGIVGGLLFIVVVALGIGLFMRRRHIVRKRTLRRL------LQERELVEPLTPSGEAPNQAHLRILKETEFK---KIKVLGSGAFGTVYKGLWIPEGEKVK------IPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQ-LITQLMPYGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEE---KEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASDISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELILEFSKMARDPQRYLVIQGD 986          

HSP 2 Score: 102.449 bits (254), Expect = 2.902e-21
Identity = 88/313 (28.12%), Postives = 129/313 (41.21%), Query Frame = 3
Query: 1044 DVFYMTAAILKNFTDIEHVIGEFHFTAQSFDKALGGITLPMLYKHL---GNVQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIMHTDLEFLGLRKLRRIF-GKFEVHDSPGLCYADTLNW--------TGNILKNNQFDPIYPPCNKPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRC---EDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQ-----NCTGPRPTNCIGGCRYFKENDECVKNCSR-----------KYFSFNKTCIKCHETCMENDKNQPLCTGESSILGLGGC 1889
            D   + A  +K+F     + G+ H    +F       T P+  + L     V+ ITG L+I        +L   +NL+ IR    Q    +L ++  ++  LGLR L+ I  G   +  +  LCYA+T+NW            + NN+ +      N  C+  C S+GCWGP    C +C+       CV++C   E EP         +++ +N +   C +CHP CL       CTG  P NCI  C ++ +   CVK C             KY   N  C  CH  C         C G     GL GC
Sbjct:  347 DTLSINATNIKHFKYCTAISGDLHILPVAFKGDSFTRTPPLDPRELEILKTVKEITGFLLIQAWPDNWTDLHAFENLEIIRGRTKQHGQFSLAVVGLNITSLGLRSLKEISDGDVIISGNRNLCYANTINWKKLFGTPNQKTKIMNNRAEKDCKAVNHVCNPLCSSEGCWGPEPRDCVSCQNVSRGRECVEKCNILEGEP---------REFVENSE---CIQCHPECLPQAMNITCTGRGPDNCI-QCAHYIDGPHCVKTCPAGIMGENNTLVWKYADANNVCHLCHANCTYG------CAGP----GLQGC 636          

HSP 3 Score: 94.7449 bits (234), Expect = 5.877e-19
Identity = 80/266 (30.08%), Postives = 121/266 (45.49%), Query Frame = 2
Query:  158 HNCTHVEGNLVIQNVWPDQESGDLGFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRG----QNSLALEKSEVSVY------IDLLDEENSQYAIFPKLRVIANNSVYFKTKVKHKFLPQSIKWEELFENPKKQKLITYNKYMEHQCH-SDCLRNDFP----YCWSSSANHCQKQSKCVKEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNTKL--NPNFKLRVGYMCANSCP 904
            +NC  V GNL I  V   Q + DL FL +I EV G + +  N+++ I L NL++IRG    +N+ AL  + +S Y      +  L   N Q  +   +R  +NN +             +I+W ++ +N     +   N  M+ Q H S C + D       CW     +CQK +K +       + C  + R G      C  QC  GC GP+ SDC VC+K+ +   C + CPP  +Y+    ++  NP  K   G  C   CP
Sbjct:   56 NNCEVVLGNLEITYV---QRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNALYENTYAL--AILSNYGTNRTGLRELPMRNLQEILIGAVR-FSNNPILCNM--------DTIQWRDIVQN-----VFMSNMSMDLQSHPSSCPKCDPSCPNGSCWGGGEENCQKLTKIICA-----QQCSHRCR-GRSPSDCCHNQCAAGCTGPRESDCLVCQKFQDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCP 296          

HSP 4 Score: 57.3806 bits (137), Expect = 1.396e-7
Identity = 60/238 (25.21%), Postives = 89/238 (37.39%), Query Frame = 3
Query: 1179 LGNVQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIM------HTDLEFLGLRKLRRIF-GKFEVHDSPGLCYADTLNWTGNI----LKNNQFDPIYPPCNKP-CDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIGGCRYFKENDECVKNC----------------SRKYFSFNKTCIK 1808
            L  +Q + G ++I  + +       L+NL+ IR       + AL I+       T L  L +R L+ I  G     ++P LC  DT+ W   +    + N   D    P + P CD  C +  CWG G   C           C  RC             +  +D      C  CH  C   CTGPR ++C+  C+ F++   C   C                    +SF  TC+K
Sbjct:   79 LKTIQEVAGYVLIALNTV---ERIPLENLQIIRGNALYENTYALAILSNYGTNRTGLRELPMRNLQEILIGAVRFSNNPILCNMDTIQWRDIVQNVFMSNMSMDLQSHPSSCPKCDPSCPNGSCWGGGEENCQKLTKIICAQQCSHRCRG-----------RSPSD------C--CHNQCAAGCTGPRESDCL-VCQKFQDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVK 293          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Mouse
Match: Erbb2 (erb-b2 receptor tyrosine kinase 2 [Source:MGI Symbol;Acc:MGI:95410])

HSP 1 Score: 251.136 bits (640), Expect = 1.939e-67
Identity = 165/488 (33.81%), Postives = 259/488 (53.07%), Query Frame = 3
Query: 2088 CEKCNGYWSGDRCVKQCFPIALNLPR----NASCPYCNGNC-----VERCTVTPNDPFQCGSCNFKRLYLDNHNKSCVSECPQ----------THKYKHKDG--NLTDIICMTRSQWLSYQENP--KFISKWSLIILSVITVFLISSVYIFFRYVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIRANRNIDI-QEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPND 3479
            C  C+ +  G  CV++C  +   LPR       C  C+  C      E C  +  D  QC +C     Y D+   SCV+ CP             KY  ++G      I C      L  +  P  +  S  + II +V+ V L   + +    + K  ++K  KY   +   + E +    L     +PN  ++ ++  T+L      K +G+GAFG VY+G+W P  ++++      + VA+KV+R N +    +EI++EA VMA V   +  RL+GICL   +  L+T  +  G L  ++R+H+  L S+ LL+W  QIA GM+YLE   ++HRDLA RNVL+     ++ITDFGLA ++   E    E    GG+VPI+W+ALE++L   ++H++DVWS+G+T+WE+ T+G +PYD +  REI   L +G RL QP IC++D+Y +M +CW  ++  RP F  L+S  S   + P  ++ I N+
Sbjct:  529 CVNCSQFLRGQECVEECR-VWKGLPREYVRGKHCLPCHPECQPQNSSETCYGSEAD--QCEACAH---YKDS--SSCVARCPSGVKPDLSYMPIWKYPDEEGICQPCPINCTHSCVDLDERGCPAEQRASPVTFIIATVVGVLLFLIIVVVIGILIKRRRQKIRKY--TMRRLLQETELVEPLTPSGAVPNQAQMRILKETELR---KLKVLGSGAFGTVYKGIWIPDGENVK------IPVAIKVLRENTSPKANKEILDEAYVMAGVGSPYVSRLLGICLTSTVQ-LVTQLMPYGCLLDHVREHRGRLGSQDLLNWCVQIAKGMSYLEEVRLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDE---TEYHADGGKVPIKWMALESILRRRFTHQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWMIDSECRPRFRELVSEFSRMARDPQRFVVIQNE 993          

HSP 2 Score: 87.8113 bits (216), Expect = 7.009e-17
Identity = 68/257 (26.46%), Postives = 106/257 (41.25%), Query Frame = 3
Query: 1056 MTAAILKNFTDIEHVIGEFHFTAQSFDKALGGITLPMLYKHLG---NVQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIMHTDLEFLGLRKLRRI-FGKFEVHDSPGLCYADTLNWTGNILKNNQFDPIYPPCNKP----------CDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCL-----QNCTGPRPTNCIGGCRYFKENDECVKNC 1769
            +T+  ++ F   + + G   F  +SFD        P+  +HL     ++ ITG L I       ++L+  QNL+ IR  +    + +L +    +  LGLR LR +  G   +H +  LC+ +T+ W  + L  N    +    N+P          C+S C    CWGPG   C NC  F     CV+ C    G        ++Y        C  CHP C      + C G     C   C ++K++  CV  C
Sbjct:  357 ITSDNIQEFAGCKKIFGSLAFLPESFDGNPSSGVAPLKPEHLQVFETLEEITGYLYISAWPESFQDLSVFQNLRVIRGRILHDGAYSLTLQGLGIHSLGLRSLRELGSGLALIHRNTHLCFVNTVPW--DQLFRNPHQALLHSGNRPEEACGLEGLVCNSLCARGHCWGPGPTQCVNCSQFLRGQECVEECRVWKGL------PREYVRGKH---CLPCHPECQPQNSSETCYGSEADQC-EACAHYKDSSSCVARC 601          

HSP 3 Score: 72.4034 bits (176), Expect = 4.525e-12
Identity = 67/269 (24.91%), Postives = 105/269 (39.03%), Query Frame = 2
Query:  158 HNCTHVEGNLVIQNVWPDQESGDLGFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQNSLALEKSEVSVYIDLLDEENSQYAIFPK-----LRVIANNSV--YFKTKVKHKFLPQ-----SIKWEELFENPKKQKLITYNKYMEHQCHSDCLRNDFPYCWSSSANHCQK------QSKCVKEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIY--DRGNTKLNPNFKLRVGYMCANSCP 904
              C  V+GNL +  +     +  L FL  I EV G + + +N +K + L  L+++RG   L  +K  ++V +D  D  ++     P      LR +   S+    K  V  +  PQ      + W+++     +   +  +      C          +CW  S   CQ        S C + K             G +    C EQC  GC GPK+SDC  C  + +   C  +CP    Y  D   + LNP  +   G  C  +CP
Sbjct:   51 QGCQVVQGNLELTYL---PANASLSFLQDIQEVQGYMLIAHNRVKHVPLQRLRIVRG-TQLFEDKYALAV-LDNRDPLDNVTTAAPGRTPEGLRELQLRSLTEILKGGVLIRGNPQLCYQDMVLWKDVLRKNNQLAPVDMDTNRSRACPPCAPTCKDNHCWGESPEDCQILTGTICTSGCARCK-------------GRLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALITYNTDTFESMLNPEGRYTFGASCVTTCP 301          

HSP 4 Score: 55.4546 bits (132), Expect = 5.679e-7
Identity = 48/171 (28.07%), Postives = 64/171 (37.43%), Query Frame = 3
Query: 1275 RHLLTQSASAALNIMHTDLEFLGLRKLRRIF-GKFEVHDSPGLCYADTLNWTGNILKNNQFDPIYPPCNK-----PCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIGGCRYFKENDECVKNC 1769
            R  L    +AA       L  L LR L  I  G   +  +P LCY D + W   + KNNQ  P+    N+     PC   C    CWG     C    G      C  RC+            +  TD         CH  C   CTGP+ ++C+  C +F  +  C  +C
Sbjct:  120 RDPLDNVTTAAPGRTPEGLRELQLRSLTEILKGGVLIRGNPQLCYQDMVLWKDVLRKNNQLAPVDMDTNRSRACPPCAPTCKDNHCWGESPEDCQILTGTICTSGCA-RCKG-----------RLPTDC--------CHEQCAAGCTGPKHSDCL-ACLHFNHSGICELHC 269          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Mouse
Match: Erbb4 (erb-b2 receptor tyrosine kinase 4 [Source:MGI Symbol;Acc:MGI:104771])

HSP 1 Score: 249.21 bits (635), Expect = 1.042e-66
Identity = 136/376 (36.17%), Postives = 214/376 (56.91%), Query Frame = 3
Query: 2373 WLSYQENPKFISKWSLIILSVIT--VFLISSVYIFFRYVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIRANRNIDIQ-EIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPNDSCLR 3491
            W  +   P+  ++  LI   VI     L+     F  YV + + KK     + + + + EP     L    T PN  +L ++  T+L      K +G+GAFG VY+G+W P  + ++      + VA+K++          E M+EA +MAS+ H H +RL+G+CL   +  L+T  +  G L  Y+ +HK  + S+ LL+W  QIA GM YLE R ++HRDLA RNVL+     ++ITDFGLA ++   E ++ E    GG++PI+W+ALE +    ++H++DVWS+G+T+WE+ T+G +PYD +  REI   L +G RL QP IC++D+Y +M +CW  +A+ RP F+ L +  S   + P  YL I  D  ++
Sbjct:  638 WTGHSTLPQH-ARTPLIAAGVIGGLFILVIMALTFAVYVRRKSIKKKRALRRFLETELVEP-----LTPSGTAPNQAQLRILKETELK---RVKVLGSGAFGTVYKGIWVPEGETVK------IPVAIKILNETTGPKANVEFMDEALIMASMDHPHLVRLLGVCLSPTIQ-LVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLL---EGDEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYLVIQGDDRMK 994          

HSP 2 Score: 110.153 bits (274), Expect = 1.296e-23
Identity = 81/258 (31.40%), Postives = 122/258 (47.29%), Query Frame = 2
Query:  161 NCTHVEGNLVIQNVWPDQESGDLGFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQNSLALEKSEVSVYIDLLDEEN--SQYAIFPKLRVIANNSVYFKTKVKHKFL--PQSIKWEELFENP--KKQKLITYNKYME-HQCHSDCLRNDFPYCWSSSANHCQKQSKCV-KEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNTKLNPNF--KLRVGYMCANSCP 904
            NC  V GNL I ++   + + DL FL SI EVTG + +  N  + + L NL++IRG   L  ++  ++++++   + N   Q      L  I N  VY     ++KFL    +I W+++  NP      L++ N      +CH  C       CW  + NHCQ  ++ V  E+ D    CY     G      C  +C GGC+GPK++DC  C  + +   CV  CP  F+Y+    +L  NF  K   G  C   CP
Sbjct:   55 NCEVVMGNLEITSI---EHNRDLSFLRSIREVTGYVLVALNQFRYLPLENLRIIRG-TKLYEDRYALAIFLNYRKDGNFGLQELGLKNLTEILNGGVYVD---QNKFLCYADTIHWQDIVRNPWPSNMTLVSTNGSSGCGRCHKSCTGR----CWGPTENHCQTLTRTVCAEQCDG--RCY-----GPYVSDCCHRECAGGCSGPKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCP 294          

HSP 3 Score: 75.8702 bits (185), Expect = 3.470e-13
Identity = 65/252 (25.79%), Postives = 99/252 (39.29%), Query Frame = 3
Query: 1188 VQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIMHTDLEFLGLRKLRRI-FGKFEVHDSPGLCYADTLNWTG--------NILKNNQFDPIYPPCNKPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLC------LQNCTGPRPTNCIGGCRYFKENDECVKNCSR----------KYFSFNKTCIKCHETCMENDKNQPLCTGESS 1868
            V+ ITG L I      + + +   NL  I   +  S  + L +    +  L  + L+ I  G   + D+  LCY  T+NWT          ++++N+           C+  C + GCWGPG   C +CR F     C++ C    G         ++ +  +  IC  C   C      L  C GP P NC   C +FK+   CV+ C            KY   ++ C  CH  C +       C G +S
Sbjct:  395 VREITGFLNIQSWPPNMTDFSVFSNLVTIGGRVLYSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFSTINQRIVIRDNRRAENCTAEGMVCNHLCSNDGCWGPGPDQCLSCRRFSRGKICIESCNLYDG---------EFREFENGSICVECDSQCEKMEDGLLTCHGPGPDNCT-KCSHFKDGPNCVEKCPDGLQGANSFIFKYADQDRECHPCHPNCTQG------CNGPTS 630          

HSP 4 Score: 59.6918 bits (143), Expect = 3.049e-8
Identity = 94/411 (22.87%), Postives = 151/411 (36.74%), Query Frame = 3
Query: 1065 AILKNFTDIEHVIGEFHFTAQSFDKALGGITLPMLYKHLGNVQYITGDLIIDGSNIVLKNLTFL--QNLKEIRHLLTQSASAALNIM-------HTDLEFLGLRKLRRIF-GKFEVHDSPGLCYADTLNWTGNILKNNQFDPIYPPCNKPCDSKCDSQG-----------CWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIGGCRYFKENDECVKNCSRKYFSFNKTCIKCHETCMENDKNQPLCTGESSILGLGGCSYCSKLIHKRDEKFYCYKDPCPRHYYLNKIDISEVMKRQKSKEIGICQPCLEPCLECSGNYTIYPTCEKCNGYWSGDRCVKQCFPIALNLPRNASCPYCNGNCVERCTVTPNDPF 2234
            A+ K + + E V+G    T+   ++ L           L +++ +TG +++      L    +L  +NL+ IR         AL I        +  L+ LGL+ L  I  G   V  +  LCYADT++W  +I++N        P N    S   S G           CWGP  + C           C  RC                   Y   +   CH  C   C+GP+ T+C   C  F ++  CV  C +  F +N T  +     +E++ N     G          ++C K   K    F      C R    +K+++ E         I +C+PC + C +             C+G  +G     Q    + N+ +  +C   NGN +   T    DP+
Sbjct:   48 ALRKYYENCEVVMGNLEITSIEHNRDL---------SFLRSIREVTGYVLV-----ALNQFRYLPLENLRIIRGTKLYEDRYALAIFLNYRKDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYADTIHWQ-DIVRNPW------PSNMTLVSTNGSSGCGRCHKSCTGRCWGPTENHCQTLTRTVCAEQCDGRC-------------------YGPYVSDCCHRECAGGCSGPKDTDCF-ACMNFNDSGACVTQCPQT-FVYNPTTFQ-----LEHNFNAKYTYG----------AFCVK---KCPHNFVVDSSSCVRACPSSKMEVEE-------NGIKMCKPCTDICPKA------------CDGIGTGSLMSAQTVDSS-NIDKFINCTKINGNLIFLVTGIHGDPY 378          

HSP 5 Score: 58.151 bits (139), Expect = 8.061e-8
Identity = 34/84 (40.48%), Postives = 40/84 (47.62%), Query Frame = 3
Query: 1485 CDSKCDSQ-----GCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCI 1721
            CDS+C+        C GPG   C  C  F+   NCV++C D  G     S I KY D   D  C  CHP C Q C GP   +CI
Sbjct:  555 CDSQCEKMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKCPD--GLQGANSFIFKYADQ--DRECHPCHPNCTQGCNGPTSHDCI 634          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Mouse
Match: Erbb4 (erb-b2 receptor tyrosine kinase 4 [Source:MGI Symbol;Acc:MGI:104771])

HSP 1 Score: 248.825 bits (634), Expect = 1.241e-66
Identity = 136/376 (36.17%), Postives = 214/376 (56.91%), Query Frame = 3
Query: 2373 WLSYQENPKFISKWSLIILSVIT--VFLISSVYIFFRYVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIRANRNIDIQ-EIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPNDSCLR 3491
            W  +   P+  ++  LI   VI     L+     F  YV + + KK     + + + + EP     L    T PN  +L ++  T+L      K +G+GAFG VY+G+W P  + ++      + VA+K++          E M+EA +MAS+ H H +RL+G+CL   +  L+T  +  G L  Y+ +HK  + S+ LL+W  QIA GM YLE R ++HRDLA RNVL+     ++ITDFGLA ++   E ++ E    GG++PI+W+ALE +    ++H++DVWS+G+T+WE+ T+G +PYD +  REI   L +G RL QP IC++D+Y +M +CW  +A+ RP F+ L +  S   + P  YL I  D  ++
Sbjct:  638 WTGHSTLPQH-ARTPLIAAGVIGGLFILVIMALTFAVYVRRKSIKKKRALRRFLETELVEP-----LTPSGTAPNQAQLRILKETELK---RVKVLGSGAFGTVYKGIWVPEGETVK------IPVAIKILNETTGPKANVEFMDEALIMASMDHPHLVRLLGVCLSPTIQ-LVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLL---EGDEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYLVIQGDDRMK 994          

HSP 2 Score: 109.768 bits (273), Expect = 1.646e-23
Identity = 81/258 (31.40%), Postives = 122/258 (47.29%), Query Frame = 2
Query:  161 NCTHVEGNLVIQNVWPDQESGDLGFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQNSLALEKSEVSVYIDLLDEEN--SQYAIFPKLRVIANNSVYFKTKVKHKFL--PQSIKWEELFENP--KKQKLITYNKYME-HQCHSDCLRNDFPYCWSSSANHCQKQSKCV-KEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNTKLNPNF--KLRVGYMCANSCP 904
            NC  V GNL I ++   + + DL FL SI EVTG + +  N  + + L NL++IRG   L  ++  ++++++   + N   Q      L  I N  VY     ++KFL    +I W+++  NP      L++ N      +CH  C       CW  + NHCQ  ++ V  E+ D    CY     G      C  +C GGC+GPK++DC  C  + +   CV  CP  F+Y+    +L  NF  K   G  C   CP
Sbjct:   55 NCEVVMGNLEITSI---EHNRDLSFLRSIREVTGYVLVALNQFRYLPLENLRIIRG-TKLYEDRYALAIFLNYRKDGNFGLQELGLKNLTEILNGGVYVD---QNKFLCYADTIHWQDIVRNPWPSNMTLVSTNGSSGCGRCHKSCTGR----CWGPTENHCQTLTRTVCAEQCDG--RCY-----GPYVSDCCHRECAGGCSGPKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCP 294          

HSP 3 Score: 75.8702 bits (185), Expect = 3.575e-13
Identity = 65/252 (25.79%), Postives = 99/252 (39.29%), Query Frame = 3
Query: 1188 VQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIMHTDLEFLGLRKLRRI-FGKFEVHDSPGLCYADTLNWTG--------NILKNNQFDPIYPPCNKPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLC------LQNCTGPRPTNCIGGCRYFKENDECVKNCSR----------KYFSFNKTCIKCHETCMENDKNQPLCTGESS 1868
            V+ ITG L I      + + +   NL  I   +  S  + L +    +  L  + L+ I  G   + D+  LCY  T+NWT          ++++N+           C+  C + GCWGPG   C +CR F     C++ C    G         ++ +  +  IC  C   C      L  C GP P NC   C +FK+   CV+ C            KY   ++ C  CH  C +       C G +S
Sbjct:  395 VREITGFLNIQSWPPNMTDFSVFSNLVTIGGRVLYSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFSTINQRIVIRDNRRAENCTAEGMVCNHLCSNDGCWGPGPDQCLSCRRFSRGKICIESCNLYDG---------EFREFENGSICVECDSQCEKMEDGLLTCHGPGPDNCT-KCSHFKDGPNCVEKCPDGLQGANSFIFKYADQDRECHPCHPNCTQG------CNGPTS 630          

HSP 4 Score: 59.6918 bits (143), Expect = 3.067e-8
Identity = 94/411 (22.87%), Postives = 151/411 (36.74%), Query Frame = 3
Query: 1065 AILKNFTDIEHVIGEFHFTAQSFDKALGGITLPMLYKHLGNVQYITGDLIIDGSNIVLKNLTFL--QNLKEIRHLLTQSASAALNIM-------HTDLEFLGLRKLRRIF-GKFEVHDSPGLCYADTLNWTGNILKNNQFDPIYPPCNKPCDSKCDSQG-----------CWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIGGCRYFKENDECVKNCSRKYFSFNKTCIKCHETCMENDKNQPLCTGESSILGLGGCSYCSKLIHKRDEKFYCYKDPCPRHYYLNKIDISEVMKRQKSKEIGICQPCLEPCLECSGNYTIYPTCEKCNGYWSGDRCVKQCFPIALNLPRNASCPYCNGNCVERCTVTPNDPF 2234
            A+ K + + E V+G    T+   ++ L           L +++ +TG +++      L    +L  +NL+ IR         AL I        +  L+ LGL+ L  I  G   V  +  LCYADT++W  +I++N        P N    S   S G           CWGP  + C           C  RC                   Y   +   CH  C   C+GP+ T+C   C  F ++  CV  C +  F +N T  +     +E++ N     G          ++C K   K    F      C R    +K+++ E         I +C+PC + C +             C+G  +G     Q    + N+ +  +C   NGN +   T    DP+
Sbjct:   48 ALRKYYENCEVVMGNLEITSIEHNRDL---------SFLRSIREVTGYVLV-----ALNQFRYLPLENLRIIRGTKLYEDRYALAIFLNYRKDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYADTIHWQ-DIVRNPW------PSNMTLVSTNGSSGCGRCHKSCTGRCWGPTENHCQTLTRTVCAEQCDGRC-------------------YGPYVSDCCHRECAGGCSGPKDTDCF-ACMNFNDSGACVTQCPQT-FVYNPTTFQ-----LEHNFNAKYTYG----------AFCVK---KCPHNFVVDSSSCVRACPSSKMEVEE-------NGIKMCKPCTDICPKA------------CDGIGTGSLMSAQTVDSS-NIDKFINCTKINGNLIFLVTGIHGDPY 378          

HSP 5 Score: 58.151 bits (139), Expect = 9.126e-8
Identity = 34/84 (40.48%), Postives = 40/84 (47.62%), Query Frame = 3
Query: 1485 CDSKCDSQ-----GCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCI 1721
            CDS+C+        C GPG   C  C  F+   NCV++C D  G     S I KY D   D  C  CHP C Q C GP   +CI
Sbjct:  555 CDSQCEKMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKCPD--GLQGANSFIFKYADQ--DRECHPCHPNCTQGCNGPTSHDCI 634          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Mouse
Match: Erbb3 (erb-b2 receptor tyrosine kinase 3 [Source:MGI Symbol;Acc:MGI:95411])

HSP 1 Score: 221.09 bits (562), Expect = 6.948e-58
Identity = 125/369 (33.88%), Postives = 212/369 (57.45%), Query Frame = 3
Query: 2400 FISKWSLII---LSVITVFLI-SSVYIFFRYVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLL--LIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVI--RANRNIDIQEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPNDS 3482
             +SK  L+I   + +  +FLI    ++++R     N++   +YL+   S          ++        N++L  +   T+L      K +G+G FG V++G+W P  + ++      + V +KVI  ++ R    Q + +    + S+ H H +RL+G+C    +  L+T ++ LGSL  ++R+H+ TL  + LL+WG QIA GM YLE   ++HRDLA RNV+L     +Q+ DFG+A ++    D+K +++ S  + PI+W+ALE++  G Y+H++DVWS+G+T+WE+ T+G  PY  L + EI   L +G RLAQP+IC++D+Y +M +CW  + N RP+F+ L +  +   + P  YL I   S
Sbjct:  636 LMSKPHLVIAVTVGLTVIFLILGGSFLYWRGRRIQNKRAMRRYLERGES----------IEPLDPSEKANKVLARIFKETELR---KLKVLGSGVFGTVHKGIWIPEGESIK------IPVCIKVIEDKSGRQ-SFQAVTDHMLAVGSLDHAHIVRLLGLCPGSSLQ-LVTQYLPLGSLLDHVRQHRETLGPQLLLNWGVQIAKGMYYLEEHSMVHRDLALRNVMLKSPSQVQVADFGVADLL--PPDDK-QLLHSEAKTPIKWMALESIHFGKYTHQSDVWSYGVTVWELMTFGAEPYAGLRLAEIPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKELANEFTRMARDPPRYLVIKRAS 980          

HSP 2 Score: 97.4413 bits (241), Expect = 8.002e-20
Identity = 72/253 (28.46%), Postives = 114/253 (45.06%), Query Frame = 2
Query:  164 CTHVEGNLVIQNVWPDQESGDLGFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQNSLALEKSEVSVYIDLLDEENSQYAI----FPKLRVIANNSVYFKTKVKHKFLPQSIKWEELFENPKKQKLITYNKYMEHQCHSDCLRNDFPYCWSSSANHCQKQSKCVKEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNTKL--NPNFKLRVGYMCANSCP 904
            C  V GNL I        + DL FL  I EVTG + +  N    + LPNL+V+RG     +   + ++++ L    NS +A+    F +L  I    VY +   K   +  +I W ++   P  + ++  N      CH  C       CW      CQ  +K +     N   C+     G      C ++C GGC+GP+++DC  C+ + +   CV  CP   +Y++   +L  NP+ K + G +C  SCP
Sbjct:   56 CEVVMGNLEIVLT---GHNADLSFLQWIREVTGYVLVAMNEFSVLPLPNLRVVRGTQ---VYDGKFAIFVMLNYNTNSSHALRQLRFTQLTEILLGGVYIEKNDKLCHM-DTIDWRDIVRVPDAEIVVKNNGGNCPPCHEVCKGR----CWGPGPEDCQILTKTICAPQCNGR-CF-----GPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPAPLVYNKLTFQLEPNPHIKYQYGGVCVASCP 291          

HSP 3 Score: 79.337 bits (194), Expect = 2.762e-14
Identity = 72/262 (27.48%), Postives = 104/262 (39.69%), Query Frame = 3
Query: 1185 NVQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIM-HTDLEFLGLRKLRRI-FGKFEVHDSPGLCYADTLNWTGNILKNNQFDPIYPPCNKP----------CDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRC---EDEPGFYTNTSAIKKYTDNYDDGICQRCHPLC-----LQNCTGPRPTNCIGGCRYFKENDECVKNCSR----------KYFSFNKTCIKCHETCMENDKNQPL--CTGESSIL 1874
             V+ ITG L I      + N +   NL  I      +   +L IM + ++  LG R L+ I  G+  +  +  LCY  +LNWT  +L+    + +    N+P          CD  C S GCWGPG   C +CR +     CV  C   + EP  + +            +  C  CHP C        C G     C   C +F++   CV +C            KY      C  CHE C +  K   L  C G++ +L
Sbjct:  389 TVREITGYLNIQSWPPHMHNFSVFSNLTTIGGRSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRVYISANQQLCYHHSLNWT-RLLRGPAEERLDIKYNRPLGECVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSREGVCVTHCNVLQGEPREFVH------------EAHCFSCHPECQPMEGTSTCNGSGSDAC-ARCAHFRDGPHCVNSCPHGILGAKGPIYKYPDAQNECRPCHENCTQGCKGPELQDCLGQAEVL 636          

HSP 4 Score: 53.5286 bits (127), Expect = 2.150e-6
Identity = 52/205 (25.37%), Postives = 79/205 (38.54%), Query Frame = 3
Query: 1179 LGNVQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIMHTDLEFLGLRKLRRIFGKFEVHDSPGLCYADTLNW--------TGNILKNNQFDPIYPPCNKPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIGGCRYFKENDECVKNC 1769
            L N++ + G  + DG   +   L +  N     H L Q            L F  L ++  + G   +  +  LC+ DT++W           ++KNN  +   PPC++ C  +C     WGPG   C           C  RC     F  N +              Q CH  C   C+GP+ T+C   CR+F ++  CV  C
Sbjct:   99 LPNLRVVRGTQVYDGKFAIFVMLNYNTNSS---HALRQ------------LRFTQLTEI--LLGGVYIEKNDKLCHMDTIDWRDIVRVPDAEIVVKNNGGN--CPPCHEVCKGRC-----WGPGPEDCQILTKTICAPQCNGRC-----FGPNPN--------------QCCHDECAGGCSGPQDTDCF-ACRHFNDSGACVPRC 259          
BLAST of epidermal growth factor receptor 2 vs. UniProt/SwissProt
Match: sp|P24348|LET23_CAEEL (Receptor tyrosine-protein kinase let-23 OS=Caenorhabditis elegans OX=6239 GN=let-23 PE=1 SV=3)

HSP 1 Score: 332.028 bits (850), Expect = 2.869e-110
Identity = 276/985 (28.02%), Postives = 439/985 (44.57%), Query Frame = 3
Query:  906 EVDACIYSCNSLHFYRVDN---KCIRCQNSS---VCAXXXXXXXXXXXXXXXDVFYMTAAILKNFTDIE----HVIGEFHFTAQSFDKALGGITLPMLYKHLGNVQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIMH-TDLEFLGLRKLRRI-FGKFEVHDSPGLCYADTLNWTGNI------------LKNNQFDPIYPPCNKPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIGGCRY-------FKENDECVKNCSRKYFSFNK-TCIKCHETCMENDKNQPLCTGESSILGLGGCSYCSKLIHKRDEKFYCYKDPCPRH---------YYLNKIDISEVMKRQKSKEIGICQPCLEPCLECS--GNYTIYPTCEKCNGYW----SGDRCVKQCFPIALNLP--RNASCPYCNGNCVERCTVTPNDPFQCGSC-NFKRLYLDNHNKSCVSECPQTHKYKHKDGNLTDIICMTRSQWLSYQENPKFISKWSLIILSVITVFLISSVYIFFRYVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIRANRNIDIQEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPND------SCLRPMKKDKHRLLSQISYDFQVYPKLNNIYKQHSLDGTISTFV---GDYQDDIEGEPSLKRQSSGFSWSS 3683
            E D C+  C+  H Y       +C +C++SS   +C                   ++T   LKN    E    H+I E  FT +               K L  V+ ++  + I   N    +L FL+NL+ I      +   AL I    DLE L L  L+ I  G   +  +  LCY   ++W+  I            +  N+   +     + CD  C+ +GCWG     C  C+ +++V  CV++C D  GF  N +++K          C+RC P C + C G    +C+  CR+       F    ECV +C   +F   K  C KCH TC +N      CTG  S LG GGC  C   +   ++  +C +     +         YY++  D   V++         C+ C   C  CS  G   +   C   +  +    S   C+ QC   +  +P   N  C  C+  C +           C  C NF     D     CVSECP+   + +              + L Y    +      +II SV+  F +  ++I   Y       K +K    I   +  P+   I  +    PNM+R+ LIP+++L   ++ K +G GAFG V+ G++ P     +++    + VA+KV + +++    E++EEA  M  + H + L++IG C+  +   ++T +  LG+L  +L+ HK  L +R  + +  QIA GM YLE + ++HRDLATRNVL+     ++ITDFGL+ I++   D+   I I  G+V I+WLA+E      Y+H +DVW+FG+T WEI T+G+ PY  +    I ++L  GNRL+QP  CS DLYQ + RCW  +   RP FE L      F + P  +L   N       S     + ++ R +   + D Q+Y    ++    S   +++TF    GD  + ++   S + ++  F + S
Sbjct:  333 ENDVCVRHCSDGHHYDATKDVRECEKCRSSSCPKICTVDG---------------HLTNETLKNLEGCEQIDGHLIIEHAFTYEQL-------------KVLETVKIVSEYITIVQQNFY--DLKFLKNLQIIEGRKLHNVRWALAIYQCDDLEELSLNSLKLIKTGAVLIMKNHRLCYVSKIDWSSIITSKGKDNKPSLAIAENRDSKLCETEQRVCDKNCNKRGCWGKEPEDCLECKTWKSVGTCVEKC-DTKGFLRNQTSMK----------CERCSPEC-ETCNGLGELDCLT-CRHKTLYNSDFGNRMECVHDCPVSHFPTQKNVCEKCHPTCYDNG-----CTGPDSNLGYGGCKQCKYAVKYENDTIFCLQSSGMNNVCVENDLPNYYISTYDTEGVIETH-------CEKCSISCKTCSSAGRNVVQNKCVCKHVEYQPNPSERICMDQCPVNSFMVPDTNNTVCKKCHHECDQNYHCANGQSTGCQKCKNFTVFKGDI--AQCVSECPKNLPFSNP----------ANGECLDYDIASRQRKTRMVIIGSVLFGFAVMFLFILLVYWRCQRIGKKLK----IAEMVDMPELTPI--DASVRPNMSRICLIPSSELQTKLDKK-LGAGAFGTVFAGIYYP-----KRAKNVKIPVAIKVFQTDQS-QTDEMLEEATNMFRLRHDNLLKIIGFCMHDDGLKIVTIYRPLGNLQNFLKLHKENLGAREQVLYCYQIASGMQYLEKQRVVHRDLATRNVLVKKFNHVEITDFGLSKILKHDADS---ITIKSGKVAIKWLAIEIFSKHCYTHASDVWAFGVTCWEIITFGQSPYQGMSTDSIHNFLKDGNRLSQPPNCSQDLYQELLRCWMADPKSRPGFEILYERFKEFCKVPQLFLENSNKISESDLSAEERFQTERIREMFDGNIDPQMYFDQGSLPSMPSSPTSMATFTIPHGDLMNRMQSVNSSRYKTEPFDYGS 1234          

HSP 2 Score: 92.0485 bits (227), Expect = 2.869e-110
Identity = 77/271 (28.41%), Postives = 116/271 (42.80%), Query Frame = 2
Query:  152 GNHNCTHVEGNLVIQ-------NVWPDQESGDL---GFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQNSLALEKSEVSVYIDLLDEENSQYAIFPKLRVIANNSVYFKTKVKHKFLPQSIKWEELFENPKKQKLITYNKYME--------HQCHSDCLRNDFPYCWSSSANHCQKQSKCVKEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNTKL--NPNFKLRVGYMCANSCP 904
            GN   T +E N + +        V P  E   L    F  ++ E+ G + +   +I+ I  P L+VI G         + ++YI   D+ +    +  +LRVI N SV  +   K  ++   I W+EL  +P  QK+ T N +           +CH  C  ND   CW S  N CQ+  + V  K  +   C++   N       CD  C GGC G    +C  C KY     C+E CP   I++    +L  NP+ + + G  C   CP
Sbjct:   71 GNLEITWIEANEIKKWRESTNSTVDPKNEDSPLKSINFFDNLEEIRGSLIIYRANIQKISFPRLRVIYGDEVF----HDNALYIHKNDKVHE--VVMRELRVIRNGSVTIQDNPKMCYIGDKIDWKELLYDPDVQKVETTNSHQHCYQNGKSMAKCHESC--ND--KCWGSGDNDCQRVYRSVCPK--SCSQCFYS--NSTSSYECCDSACLGGCTGHGPKNCIACSKYELDGICIETCPSRKIFNHKTGRLVFNPDGRYQNGNHCVKECP 327          
BLAST of epidermal growth factor receptor 2 vs. UniProt/SwissProt
Match: sp|P0CY46|EGFR_APIME (Epidermal growth factor receptor OS=Apis mellifera OX=7460 GN=Egfr PE=2 SV=1)

HSP 1 Score: 380.948 bits (977), Expect = 3.481e-110
Identity = 251/827 (30.35%), Postives = 409/827 (49.46%), Query Frame = 3
Query: 1074 KNFTDIEHVIGEFHFTAQSFDKALGGITLPMLYKHLGNVQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIMHTDLEFLGLRKLRRIF-GKFEVHDSPGLCYADTLNWT--------GNILKNNQFDPIYPPCNKPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIGGCRYFKENDECVKNCSRKYFSFNKTCIKCHETCMENDKNQPLCTGESSILGLGGCSYCSKLIHKRDEKFYCY--KDPCPRHYYLNKIDISEVMKRQKSKEIGICQPCLEPCLECSGNYTIYPTCEKCNGYWSGDRCVKQCFPIALNLPRNASCPYCNGNCVERCTVTPNDPFQCGSCNFKRLYLDNHNKS------CVSECPQTHKYKHKDGNL-TDIICMTRSQWLSYQE-NPKFISKWSLIILSVITVFLISSVYIFFRYVNKINQKKSVKYLKAIYS-NIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIRANRNIDI-QEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPNDSCLR 3491
            ++F   +HV   F F  + ++K       P   +    ++ ITG L I G +   KNL++ +NL+ I         A+L ++ T L   GL  L++I+ G   + ++  LCYA ++NWT         ++L NN+ +         CD +C  +GCWGPG   C +C+ F    +C+  C   PG Y             D+  C+ CH  C  +C GP   +C   C++ ++   CV  C    ++ N  C  CH  C+        C G  + +G  GC  C K I        C   K+ CP  YY   +   E    +      +C+ C   C +C+G       C++C  Y  G++C  +C P       N  C  C   C  R    P  P QC  C   ++Y+D           C   C  T +Y HK  N  ++  C   +  L   E  P  ++  ++  L+ +   +++++ ++F  V    ++ +VK   A+   + +EP     L+     PN+ +L +I   ++        +G GAFG VY+GVW P  ++++      + VA+KV+      +  +E ++EA +MASV H + L+L+ +C+  +M  L+T  + LG L  ++R+ K  + S+ LL+W  QIA GM YLE R ++HRDLA RNVL+     ++ITDFGLA ++   + N+ +   +GG++PI+WLALE + + +++HK+DVW+FG+T+WE+ TYG RPY+ +  R +   L +G RL QP IC++D+Y +M +CW  +A  RPSF+ L    +   + P  YL I  D  +R
Sbjct:  213 QSFQGFQHVYRNFSF-GKRYEK-----MHPDKLEVFSTLKEITGFLNIQGDHKDFKNLSYFRNLEVIGGRTLTEYFASLYVVKTSLVSFGLSSLKKIYSGSIAILENKNLCYAQSINWTRIKKSSEHESLLSNNRNESECIKDGLVCDEQCSDEGCWGPGPAQCLSCKNFILGNDCLQDCT-APGIY-----------QADEKTCKVCHEECDGSCIGPNTDHC-KKCKHARDGPFCVPECPASKYNDNGVCKSCHGNCVGG------CEGPENNIGPNGCHSCDKAILNDHVPEGCLQKKESCPDGYYYEWVSPLEQGPLKPLASKAVCRKCHSRCKKCTGYGFHEHVCQECTKYKRGEQCEDEC-PADYFADANKLCIPCFSEC--RGCFGPG-PNQCYKCRNYKIYIDEDTDGNTTSFNCTETC--TPEYPHKIFNPDSEPYCSLETAGLIENELQPAILAGVAVFALAFL---VVAAIIMYFWRVRAKAKENTVKMTMALTGLDDNEP-----LRPTGVKPNLAKLRIIKEEEMR---KGGILGYGAFGNVYKGVWVPEGENVK------IPVAIKVLHDGTGANTSKEFLDEAYIMASVEHPNLLQLLAVCMTSQM-MLVTQLMPLGCLLDFVRRFKDKIGSKALLNWCTQIARGMAYLEERRLVHRDLAARNVLVQTPNCVKITDFGLAKLL---DINEEQYKAAGGKMPIKWLALECIQHRVFTHKSDVWAFGVTIWEVLTYGGRPYENVPARNVPELLEKGERLPQPAICTIDVYMIMIKCWMLDAESRPSFKELAEDFAKMSRDPGRYLAIKGDKYMR 987          

HSP 2 Score: 64.6994 bits (156), Expect = 5.751e-9
Identity = 42/143 (29.37%), Postives = 58/143 (40.56%), Query Frame = 2
Query:  482 QSIKWEELFENPKKQKLITYNKYMEHQCHSDCLRNDFPYCWSSSANHCQKQSKCVKEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNT--KLNPNFKLRVGYMCANSCP 904
            ++I WEE+   P       YN     +  + C ++    CW     +CQK SK      +    C+     G      C   C GGC GPK SDC  CK + +   C + CPP   Y+      + NP+ K   G  C   CP
Sbjct:   11 RTINWEEIITGPSAMYSYVYNFTSPERACTPCDKSCEQGCWGEGPENCQKYSK-----TNCSPQCWQGRCFGPNPRECCHLFCAGGCTGPKQSDCIACKNFFDDGVCTQECPPMQKYNPTTYSWEPNPDGKYAYGATCVRRCP 148          
BLAST of epidermal growth factor receptor 2 vs. UniProt/SwissProt
Match: sp|P04412|EGFR_DROME (Epidermal growth factor receptor OS=Drosophila melanogaster OX=7227 GN=Egfr PE=1 SV=3)

HSP 1 Score: 338.576 bits (867), Expect = 8.011e-95
Identity = 245/849 (28.86%), Postives = 403/849 (47.47%), Query Frame = 3
Query: 1044 DVFYMTAAILKNFTDIEHVIGEFHFTAQSFDKALGGITL-PMLYKHLGNVQYITGDLIIDGSNIVLKNLTFLQNLKEIR-HLLTQSASAALNIMHTDLEFLGLRKLRRIF-GKFEVHDSPGLCYADTLNWTG-------NILKNNQFDPIYPPCNKP---CDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIGGCRYFKENDECVKNCSRKYFSFNKTCIKCHETCMENDKNQPLCTGESSILGLGGCSYCSKLIHKRD---EKFYCYKDPCPRHYYLNKIDISEVMKRQKSKEIGICQPCLEPCLECSGNYTIYP-TCEKCNGYWSGDRCVKQCFPIALNLPRNASC----PYCNGNCVERCTVTPNDPFQCGSC-NFKRL-------YLDNHNKSCVSECPQTHKYKHKDGNLTDIICMTRSQWLSYQENPKFISKWSLIILSVIT-VFLISSVYIF--FRYVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVK-VIRANRNIDIQEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPNDSCLR 3491
            D F     I  N   ++     F     ++      I L P   +    V+ ITG L I+G++   +NL++ +NL+ I    L +S  AAL I+ + L  L +R L++I  G   +  +  LCY   + W          +  N         C K    C  +C+  GCWG G+  C  C+ F     C+  C    G+ +N          +D+  C+ CHP C + C G    +C   C + ++   CV  C +  ++    C +CH TC         CTG    +G+G C+ C+  I   D   ++     D CP  Y+   +   E    +      +C+ C   C  C+ NY  +   C KC  Y   ++C  +C            C    P CNG     CT    D   C SC NFK         Y+++   +C S+CP   ++ +         C       S   + K  +   + ++ +IT   L+ ++ I     Y+ +  QK   + +K   +     DS   L+      N+ +L ++   +L        +G GAFG VY+GVW P  ++++      + VA+K ++++      +E + EA +MAS  H + L+L+ +C+  +M  LIT  + LG L  Y+R ++  + S+ LL+W  QIA GM+YLE + ++HRDLA RNVL+    +++ITDFGLA ++     + NE   +GG++PI+WLALE + N +++ K+DVW+FG+T+WE+ T+G+RP++ +  ++I   +  G +L QPEICS+D+Y  +  CW+ +A  RP+F+ L +  + F + P  YL IP D   R
Sbjct:  415 DSFRNCTVIDGNIRILDQTFSGFQDVYANYTMGPRYIPLDPERREVFSTVKEITGYLNIEGTHPQFRNLSYFRNLETIHGRQLMESMFAALAIVKSSLYSLEMRNLKQISSGSVVIQHNRDLCYVSNIRWPAIQKEPEQKVWVNENLRADL--CEKNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADC----GYISNAY-------KFDNRTCKICHPEC-RTCNGAGADHC-QECVHVRDGQHCVSECPKNKYNDRGVCRECHATCDG-------CTGPKDTIGIGACTTCNLAIINNDATVKRCLLKDDKCPDGYFWEYVHPQEQGSLKPLAGRAVCRKCHPLCELCT-NYGYHEQVCSKCTHYKRREQCETECPADHYTDEEQRECFQRHPECNG-----CTGPGAD--DCKSCRNFKLFDANETGPYVNSTMFNCTSKCPLEMRHVNYQYTAIGPYCAA-----SPPRSSKITANLDVNMIFIITGAVLVPTICILCVVTYICRQKQKAKKETVKMTMALSGCEDSEP-LRPSNIGANLCKLRIVKDAELR---KGGVLGMGAFGRVYKGVWVPEGENVK------IPVAIKELLKSTGAESSEEFLREAYIMASEEHVNLLKLLAVCMSSQM-MLITQLMPLGCLLDYVRNNRDKIGSKALLNWSTQIAKGMSYLEEKRLVHRDLAARNVLVQTPSLVKITDFGLAKLLS---SDSNEYKAAGGKMPIKWLALECIRNRVFTSKSDVWAFGVTIWELLTFGQRPHENIPAKDIPDLIEVGLKLEQPEICSLDIYCTLLSCWHLDAAMRPTFKQLTTVFAEFARDPGRYLAIPGDKFTR 1214          

HSP 2 Score: 104.76 bits (260), Expect = 3.988e-21
Identity = 78/257 (30.35%), Postives = 113/257 (43.97%), Query Frame = 2
Query:  161 NCTHVEGNLVIQNVWPDQESGDLGFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQN--SLALEKSEVSVYIDLLDEENSQYAI-FPKLRVIANNSVYFKTKVKHKFLPQSIKWEELFENPKKQKL---ITYNKYMEHQCHSDCLRNDFPYCWSSSANHCQKQSKCVKEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNTKL--NPNFKLRVGYMCANSCPG 907
            NCT+V+GNL +   W   E+ DL FL +I EVTG I + +  +K ++ P L++IRG+   SL++E+ + ++++      +  Y +  P LR + N  V F        + ++I+W E+  N          T  +    +CH  C       CW     +CQK SK           CY     G      C   C GGC GP   DC  CK + +     E CPP   Y+     L  NP  K   G  C   CPG
Sbjct:  128 NCTYVDGNLKL--TWLPNENLDLSFLDNIREVTGYILISHVDVKKVVFPKLQIIRGRTLFSLSVEEEKYALFVTY----SKMYTLEIPDLRDVLNGQVGFHNNYNLCHM-RTIQWSEIVSNGTDAYYNYDFTAPERECPKCHESCTHG----CWGEGPKNCQKFSKLTCSPQCAGGRCY-----GPKPRECCHLFCAGGCTGPTQKDCIACKNFFDEAVSKEECPPMRKYNPTTYVLETNPEGKYAYGATCVKECPG 368          
BLAST of epidermal growth factor receptor 2 vs. UniProt/SwissProt
Match: sp|P11273|ERBB_AVIEU (Tyrosine-protein kinase transforming protein erbB OS=Avian erythroblastosis virus (strain ts167) OX=103898 GN=V-ERBB PE=3 SV=1)

HSP 1 Score: 248.825 bits (634), Expect = 5.329e-70
Identity = 141/353 (39.94%), Postives = 213/353 (60.34%), Query Frame = 3
Query: 2424 ILSVITVFLISSVYIFFRYVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIR-ANRNIDIQEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPND 3479
            +L ++ V L   +Y+  R+   I +K++++ L      + E +    L      PN   L ++  T+       K +G GAFG VY+G+W P      + ++ ++ VA+K +R A      +EI++EA VMASV + H  RL+GICL   +  LIT  +  G L  Y+R+HK  + S+ LL+W  QIA GM YLE R ++HRDLA RNVL+   + ++ITDFGLA   Q   D K E    GG+VPI+W+ALE++L+ IY+H++DVWS+G+T+WE+ T+G +PYD +   EI+S L +G RL QP IC++D+Y +M +CW  +A+ RP F  L++  S   + P  YL I  D
Sbjct:   74 LLCLVVVGLGIGLYLRRRH---IVRKRTLRRL------LQERELVEPLTPSGEAPNQAHLRILKETEFK---KVKVLGFGAFGTVYKGLWIP------EGEKVTIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQ-LITQLMPYGCLLDYIREHKDNIGSQYLLNWCVQIAKGMNYLEERHMVHRDLAARNVLVKTPQHVKITDFGLAK--QLGADEK-EYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSVLEKGERLPQPPICTIDVYMIMVKCWMSDADSRPKFRELIAEFSKMARDPPRYLVIQGD 404          
BLAST of epidermal growth factor receptor 2 vs. UniProt/SwissProt
Match: sp|P00535|ERBB_AVIER (Tyrosine-protein kinase transforming protein erbB OS=Avian erythroblastosis virus (strain ES4) OX=79685 GN=V-ERBB PE=3 SV=1)

HSP 1 Score: 250.366 bits (638), Expect = 7.795e-70
Identity = 138/353 (39.09%), Postives = 213/353 (60.34%), Query Frame = 3
Query: 2424 ILSVITVFLISSVYIFFRYVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIR-ANRNIDIQEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPND 3479
            +L ++ V L   +Y+  R+   I +K++++ L      + E +    L      PN   L ++  T+       K +G+GAFG +Y+G+W P  + ++      + VA+K +R A      +EI++EA VMASV + H  RL+GICL   +  LIT  +  G L  Y+R+HK  + S+ LL+W  QIA GM YLE R ++HRDLA RNVL+   + ++ITDFGLA ++   E    E    GG+VPI+W+ALE++L+ IY+H++DVWS+G+T+WE+ T+G +PYD +   EI+S L +G RL QP IC++D+Y +M +CW  +A+ RP F  L++  S   + P  YL I  D
Sbjct:   74 LLCLVVVGLGIGLYLRRRH---IVRKRTLRRL------LQERELVEPLTPSGEAPNQAHLRILKETEFK---KVKVLGSGAFGTIYKGLWIPEGEKVK------IPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQ-LITQLMPYGCLLDYIREHKDNIGSQYLLNWCVQIAKGMNYLEERRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGADE---KEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSVLEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIAEFSKMARDPPRYLVIQGD 404          
BLAST of epidermal growth factor receptor 2 vs. TrEMBL
Match: A0A1B1ACY2 (Receptor protein-tyrosine kinase OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1998.79 bits (5177), Expect = 0.000e+0
Identity = 982/985 (99.70%), Postives = 983/985 (99.80%), Query Frame = 3
Query:  900 VQEVDACIYSCNSLHFYRVDNKCIRCQNSSVCAXXXXXXXXXXXXXXXDVFYMTAAILKNFTDIEHVIGEFHFTAQSFDKALGGITLPMLYKHLGNVQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIMHTDLEFLGLRKLRRIFGKFEVHDSPGLCYADTLNWTGNILKNNQFDPIYPPCNKPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIGGCRYFKENDECVKNCSRKYFSFNKTCIKCHETCMENDKNQPLCTGESSILGLGGCSYCSKLIHKRDEKFYCYKDPCPRHYYLNKIDISEVMKRQKSKEIGICQPCLEPCLECSGNYTIYPTCEKCNGYWSGDRCVKQCFPIALNLPRNASCPYCNGNCVERCTVTPNDPFQCGSCNFKRLYLDNHNKS--CVSECPQTHKYKHKDGNLTDIICMTRSQWLSYQENPKFISKWSLIILSVITVFLISSVYIFFRYVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIRANRNIDIQEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPNDSCLRPMKKDKHRLLSQISYDFQVYPKLNNIYKQHSLDGTISTFVGDYQDDIEGEPSLKRQSSGFSWSSKQTRSSQEIDKRLFYFRQHSAVSEDLEENDNFCRSDEQEESDSEYLEPKKIENFK 3848
            +QEVDACIYSCNSLHFYRVDNKCIRCQNSSVCAKKEFNINKIINEENEDVFYMTAAILKNFTDIEHVIGEFHFTAQSFDKALGGITLPMLYKHLGNVQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIMHTDLEFLGLRKLRRIFGKFEVHDSPGLCYADTLNWTGNILKNNQFDPIYPPCNKPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIGGCRYFKENDECVKNCSRKYFSFNKTCIKCHETCMENDKNQPLCTGESSILGLGGCSYCSKLIHKRDEKFYCYKDPCPRHYYLNKIDISEVMKRQKSKEIGICQPCLEPCLECSGNYTIYPTCEKCNGYWSGDRCVKQCFPIALNLPRNASCPYCNGNCVERCTVTPNDPFQCGSCNFKRLYLDNHNKS  CVSECPQTHKYKHKDGNLTDIICMTRSQWLSYQENPKFISKWSLIILSVITVFLISSVYIFFRYVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIRANRNIDIQEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPNDSCLRPMKKDKHRLLSQISYDFQVYPKLNNIYKQHSLDGTISTFVGDYQDDIEGEPSLKRQSSGFSWSSKQTRSSQEIDKRLFYFRQHSAVSEDLEENDNFCRSDEQEESDSEYLEPKKIENFK
Sbjct:  312 LQEVDACIYSCNSLHFYRVDNKCIRCQNSSVCAKKEFNINKIINEENEDVFYMTAAILKNFTDIEHVIGEFHFTAQSFDKALGGITLPMLYKHLGNVQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIMHTDLEFLGLRKLRRIFGKFEVHDSPGLCYADTLNWTGNILKNNQFDPIYPPCNKPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIGGCRYFKENDECVKNCSRKYFSFNKTCIKCHETCMENDKNQPLCTGESSILGLGGCSYCSKLIHKRDEKFYCYKDPCPRHYYLNKIDISEVMKRQKSKEIGICQPCLEPCLECSGNYTIYPTCEKCNGYWSGDRCVKQCFPIALNLPRNASCPYCNGNCVERCTVTPNDPFQCGSCNFKRLYLDNHNKSFQCVSECPQTHKYKHKDGNLTDIICMTRSQWLSYQENPKFISKWSLIILSVITVFLISSVYIFFRYVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIRANRNIDIQEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPNDSCLRPMKKDKHRLLSQISYDFQVYPKLNNIYKQHSLDGTISTFVGDYQDDIEGEPSLKRQSSGFSWSSKQTRSSQEIDKRLFYFRQHSAVSEDLEENDNFCRSDEQEESDSEYLEPKKIENFK 1296          

HSP 2 Score: 583.563 bits (1503), Expect = 0.000e+0
Identity = 294/308 (95.45%), Postives = 294/308 (95.45%), Query Frame = 2
Query:   23 MGFVCNXXXXXXXXESSLAIRQFDEEYPGVTICESSMTSG--------------ELGGNHNCTHVEGNLVIQNVWPDQESGDLGFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQNSLALEKSEVSVYIDLLDEENSQYAIFPKLRVIANNSVYFKTKVKHKFLPQSIKWEELFENPKKQKLITYNKYMEHQCHSDCLRNDFPYCWSSSANHCQKQSKCVKEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNTKLNPNFKLRVGYMCANSCP 904
            MGFVCNIIVVIILLESSLAIRQFDEEYPGVTICESSMTSG              ELGGNHNCTHVEGNLVIQNVWPDQESGDLGFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQNSLALEKSEVSVYIDLLDEENSQYAIFPKLRVIANNSVYFKTKVKHKFLPQSIKWEELFENPKKQKLITYNKYMEHQCHSDCLRNDFPYCWSSSANHCQKQSKCVKEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNTKLNPNFKLRVGYMCANSCP
Sbjct:    1 MGFVCNIIVVIILLESSLAIRQFDEEYPGVTICESSMTSGFQYFMPHSLMFLKGELGGNHNCTHVEGNLVIQNVWPDQESGDLGFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQNSLALEKSEVSVYIDLLDEENSQYAIFPKLRVIANNSVYFKTKVKHKFLPQSIKWEELFENPKKQKLITYNKYMEHQCHSDCLRNDFPYCWSSSANHCQKQSKCVKEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNTKLNPNFKLRVGYMCANSCP 308          
BLAST of epidermal growth factor receptor 2 vs. TrEMBL
Match: F6KBQ4 (Epidermal growth factor receptor 2 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=egfr-2 PE=2 SV=1)

HSP 1 Score: 1548.49 bits (4008), Expect = 0.000e+0
Identity = 750/757 (99.08%), Postives = 751/757 (99.21%), Query Frame = 3
Query: 1584 CEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIGGCRYFKENDECVKNCSRKYFSFNKTCIKCHETCMENDKNQPLCTGESSILGLGGCSYCSKLIHKRDEKFYCYKDPCPRHYYLNKIDISEVMKRQKSKEIGICQPCLEPCLECSGNYTIYPTCEKCNGYWSGDRCVKQCFPIALNLPRNASCPYCNGNCVERCTVTPNDPFQCGSCNFKRLYLDNHNKS--CVSECPQTHKYKHKDGNLTDIICMTRSQWLSYQENPKFISKWSLIILSVITVFLISSVYIFFRYVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIRANRNIDIQEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPNDSCLRPMKKDKHRLLSQISYDFQVYPKLNNIYKQHSLDGTISTFVGDYQDDIEGEPSLKRQSSGFSWSSKQTRSSQEIDKRLFYFRQHSAVSEDLEENDNFCRSDEQEESDSEYLEPKKIENFK 3848
            CEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIGGCRYFKENDECVKNCSRKYFSFNKTCIKCHETCMENDKNQPLCTGESSILGLGGCSYCSKLIHKRDEKFYCYKDPCPRHYYL+KIDISEVMKRQKSKEIGICQPCLEPCLECSGNYTIYPTCEKCNGYWSGDRCVKQCFPIALNLPRNASCPYCNGNCVERCTVTPNDPFQCGSCNFKRLYLDNHNKS  CVSECPQTHKY HKDGNLTDIICMTRSQWLSYQENPKFISKWSLIILSVITVFLISSVYIFFRYVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIRANRNIDIQEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLI TFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNV LNDLEIIQITDFGLAHIVQC EDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPNDSCLRPMKKDKHRLLSQISYDFQVYPKLNNIYKQHSLDGTISTFVGDYQDDIEGEPSLKRQSSGFSWSSKQTRSSQEIDKRLFYFRQHSAVSEDLEENDNFCRSDEQEESDSEYLEPKKIENFK
Sbjct:    1 CEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIGGCRYFKENDECVKNCSRKYFSFNKTCIKCHETCMENDKNQPLCTGESSILGLGGCSYCSKLIHKRDEKFYCYKDPCPRHYYLDKIDISEVMKRQKSKEIGICQPCLEPCLECSGNYTIYPTCEKCNGYWSGDRCVKQCFPIALNLPRNASCPYCNGNCVERCTVTPNDPFQCGSCNFKRLYLDNHNKSFQCVSECPQTHKYXHKDGNLTDIICMTRSQWLSYQENPKFISKWSLIILSVITVFLISSVYIFFRYVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIRANRNIDIQEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLIXTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVXLNDLEIIQITDFGLAHIVQCPEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPNDSCLRPMKKDKHRLLSQISYDFQVYPKLNNIYKQHSLDGTISTFVGDYQDDIEGEPSLKRQSSGFSWSSKQTRSSQEIDKRLFYFRQHSAVSEDLEENDNFCRSDEQEESDSEYLEPKKIENFK 757          
BLAST of epidermal growth factor receptor 2 vs. TrEMBL
Match: A0A1B1ACX9 (Receptor protein-tyrosine kinase OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 642.499 bits (1656), Expect = 0.000e+0
Identity = 367/922 (39.80%), Postives = 532/922 (57.70%), Query Frame = 3
Query:  885 CARIRVQEVDACIYSCNSLHFYRVDNKCIRCQNSSVCAXXXXXXXXXXXXXXXDVFY--------MTAAILKNFTDIEHVIGEFHFTAQSFDKALGGITLPMLYKHLGNVQYITGDLIIDGSNIVLKNLTFLQNLKEIR-HLLTQSASAALNIMHTDLEFLGLRKLRRIFGKFEVHDSPGLCYADTLNWTGNILKNNQFDPIYPPCNKPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIGGCRYFKENDECVKNCSRKYFSFNK------TCIKCHETCMENDK---NQPLCTGESSILGLGGCSYCSKLIHKRDEKFYCYKDPCPRHYYLNKIDISEVMKRQKSKEIGICQPCLEPCLECSGNYTIYPTCEKCNGYWSGDRCVKQC---FPIALNLPRNASCPYCNGNCVERCTVTPNDPFQCGSCNFKRLYLDN-HNK-SCVSECPQTHKY-KHKDGNLTDIICMTRSQWLSYQENPKFISKWSLIILSV---ITVFLISSVYIFFRYVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKT-IPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIRANRNIDIQEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPNDSCLRPMKKDKHRL----LSQISYDFQVYP 3554
            C    + +   C+Y C+     ++ N+CI C N +          K+ N    D FY        +    L   T+   ++G+      SF+K   G+T+PMLY HL NV+ I G   +      + NLTFL NL+EIR  + + + ++A+NI    +EFLGL+KL++++GK  +  + G CY D + W   I  +N+   +   CNK CD  C  Q CWGPG+ MCY+C  ++A  +CV +C D PG++ + +  K          CQ CHPLC QNCTGP P NC G CRY  E + CVKNCS  +F          TC  CH +C  +         CTG S+ILG GGCS C KLI   + ++ C+K  CP+ +Y + I+ +     +       C+PC   C  CSG+      C +C GY+  ++CVK+C     + + L     CP C+  C   C +  ND   C  C   +L++D+  NK SCV+ CP    + +++DG   D IC+   + ++ ++      K   IILS      VF+I    ++FR+  + NQ + +  +KA+YSN  EPD + + ++  T  PNM R+ +IP +DL+F+ ++KP+G+GAFG VYRG WK   +D   +   +L+V +KVI  +      E +EEAK+MASV H+HCL LIG+CL  E PCL++T+ + GSLDKYL+++   + S ++L W +QIADGM YL  RGIIHRDLA RNVL+ND + IQITDFGLA +V  T+D+   IVI  G+VPIRWLA+ETLL+  YS  TDVW++G+TLWEIFTY +RPY+EL   EI S+L QGNRL QPEI ++++Y +M +CW ++ + RPSF  L+ST   F Q P  +L +P++   +   KD+ +     L+QIS D    P
Sbjct:  310 CPASLLDQNKICVYECDFDAHQKIGNRCIECPNGN--CNSSTAGYKLCNIATIDKFYPKNNRKYSLNKQTLMQLTNCTLILGDLDIDDISFNK--NGVTVPMLYHHLKNVREIIGLFSLVTFQTKISNLTFLSNLEEIRLSVKSHTVASAMNIHGKYIEFLGLKKLKKVYGKISIGGTNGTCYLDRIPWE-EISPDNR---VKFSCNKTCDPLCTGQ-CWGPGNEMCYSCAYYKAGNSCVKQCSDSPGYFASQTEFKTIK-------CQTCHPLCRQNCTGPTPKNCGGQCRYAIEENTCVKNCSIDFFPVANNVNAPITCQLCHSSCFVDKTLVGTNHACTGPSNILGTGGCSKCEKLIKTNNNQYLCHKGSCPKGFYQSVINQNISHLHKNIVHQSSCEPCHSMCRTCSGSTNEKRMCHQCKGYFLDNKCVKECDNMKNVTIKLEIGDECPQCHKECRNGCLLA-NDSTACTRCLNHKLFVDDDKNKFSCVTRCPHDRNFTEYQDG---DFICLKFEETINSKQR-----KTIFIILSGCFGFLVFIIGFCVLYFRW--RANQTRILAEIKALYSNFKEPDMKNMKEDYITRPPNMRRMQMIPISDLVFDTSSKPLGSGAFGKVYRGYWKVPRQD---NKYINLEVVIKVIHNSSKGSTDEFLEEAKIMASVSHRHCLPLIGVCLSLEKPCLVSTYAQHGSLDKYLQQNSKKISSHSMLKWAKQIADGMAYLNKRGIIHRDLAARNVLVNDDDNIQITDFGLARLVDETDDS---IVIKSGKVPIRWLAIETLLSATYSPATDVWAYGVTLWEIFTYAKRPYEELATGEIKSFLQQGNRLCQPEISTLEVYMVMIKCWLDDPHMRPSFMELVSTFEQFIQSPKRFLYMPHEYVNQQYPKDEDQREMIQLNQISIDSDFRP 1198          

HSP 2 Score: 137.502 bits (345), Expect = 0.000e+0
Identity = 100/310 (32.26%), Postives = 148/310 (47.74%), Query Frame = 2
Query:   89 FDEEYPGVTICESSMTSGE--------------LGGNHNCTHVEGNLVIQNV--WPDQESGDLGFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQN--------SLALEKSEVSVYIDLLDEENSQYAIFPKLRVIANNSVYFKTKVKHKFLPQSIKWEELFENPKKQKL----ITYNKYMEHQCHSDC---LRND---FPYCWSSSANHCQKQSKCVKEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNTKLNPNFKLR--VGYMCANSCPGS 910
            F+ +YP   IC  S   G               LG    CTH+ GNL I ++  + +    DL FL SIIE++G + + NN +K I L NLKVIRG          ++    SE   +++ +D  N        LR I + +V        ++L +++ W ++ ++P  QKL             +CH++C    R D     +C+  S N CQKQ+KCVK K  +++WC F  + GEI    C  +C GGC+G  + DC VC K V  + CV  C P   +  G   ++   KLR  VG +C + CP S
Sbjct:   21 FNPDYPNFRICVVSEAHGSFKTPAEAYTYLKYTLGLGQRCTHIYGNLPISDLSRFKNGSDPDLSFLESIIEISGSLSIINNDVKRIPLTNLKVIRGVTLRNEPDALNIIHNHSENGTFLEEIDLRN--------LRAIMSKNVIISQNPGLEYLEKNLDWSQILDDPTTQKLKVSEFVRPSNGTAKCHTECEYWTREDGVRSQFCFGPSKNECQKQTKCVKNK--DLKWCKF-TKTGEIP---CSHECAGGCDGRTSKDCTVCNKLVKDSDCVSSCAPRPNHIFG---MDSKDKLRYTVGGLCTSQCPAS 313          
BLAST of epidermal growth factor receptor 2 vs. TrEMBL
Match: A0A1B1ACY5 (Receptor protein-tyrosine kinase OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 548.895 bits (1413), Expect = 0.000e+0
Identity = 339/897 (37.79%), Postives = 485/897 (54.07%), Query Frame = 3
Query:  885 CARIRVQEVDACIYSCNSLHFYRVDNKCIRCQNSSVCAXXXXXXXXXXXXXXXDV---FYMTAAILKNFTDIEHVIGEFHFTAQSFDKALGGITLPMLYKHLGNVQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIMH------TDLEFLGLRKLRRIFGKFEVHDSPGLCYADTLNWTGNILKNNQFDPIYPPCN---KPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYT--NTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIGGCRYFKENDECVKNCSRKYF---SFNKTCIKCHETCMENDKNQPLCTGESSILGLGGCSYCSKLIHKRDEKFYCYKDPCPRHYYLNKIDISEVMKRQKSKEIGICQPCLEPCLECSGNYTIYPTCEKCNGYWSGDRCVKQCFPIALNLPRNAS-----------CPYCNGNCVERCTVTPNDPFQCGSCNFKRLYLDNHNKSCVSECPQTHKYKHKDGNLTDIICMTRSQWLSYQENPKFISKWSLIILSVITVFLISSVYIFFRYVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWK-PSNKD--LEKSDRD-SLDVAVKVIRANRNIDIQEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPND 3479
            C  + + E   C++ C+  +F    N CI+C   ++C       N      + D    FY+ A  L    + + ++G    T  SF K    IT+ MLY++L  +Q + G       N  LKNLTFL+NL   R     S    L   H      T+LEFLGL+ L+ I G F    +  LCY   +N   N L  N  +  Y P N   K C   C  +GCWGPG+ +CY CR + A   CV  C  + GFY   N+S +           C RCHP CL  C GP P  CI GC+  +EN  CV +CS+ ++   + +K C+ CH  C E   N  +CTG SS+ G+GGC+ C +++  R          C    Y    D  ++ +         C PC E C +C G       CE C G W  + C  +C       PR+ S           C  C+ +C + C  +    F C  C  K++YLD     C   CP     +  +    DI+C++  +  +  E  K       ++++++ + +I  V I      K   ++    LKA YSN+ EP+S+      K  PNM RL+++   DLIF   +KP+G GAFG VY+G WK P N++  L+K+  D  L VA+KVI+   N +I+ +M+EAK+MASV H HCLR IG+CL YE PCLI+ +V+ GSLDK+L ++K+ + S  +LSW EQIADGM YL  R IIHRDLA RNVL++ LE +QITDFGL+ +++ T+D   EI+I  G+VPIRWLA+ETL +G YSH+TDVW++G+TLWEIFT+G+ PY++    +I  ++++G RL+QP+ICS+D+Y +M  CW E+ N RP F+ LM T + + + P  YL+I  D
Sbjct:  313 CPAMMLPENTGCVHKCSEGYFKNKSNHCIKCY-GNMCTNDHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILGYIVLTEDSFVKH--NITVEMLYENLNKLQELEGGFSYFKDN-HLKNLTFLRNLLRFRAAYLHSDIPNLPSYHKFAISETELEFLGLKSLKEINGPFRFFKNQKLCY---MNIPVNELFKNVKNFYYIPSNCTDKICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQK-------CLRCHPECLNTCVGPNPNQCIKGCKNKRENGTCVASCSKNFYPPLNDSKACLPCHPNCSE--YNSTICTGPSSVPGIGGCNKCERILLSRKADIVSCVKTCHEGTYAFPNDRPDISRFYPVTGF-TCLPCPELCSKCKGKSPKNDECEVCKGVWHKNTCRLRC-------PRDESYGTKIIDSISYCKTCHSSC-KGCYGS--TIFNCTRCKNKKIYLDKKKFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKLEETKRTHITVGVVVTMLILVIIVIVTIVVYLKRKAIAERIETELKARYSNLTEPNSKDEDLLSKP-PNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVIKNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKD--KEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAYGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGD 1179          

HSP 2 Score: 147.902 bits (372), Expect = 0.000e+0
Identity = 99/297 (33.33%), Postives = 149/297 (50.17%), Query Frame = 2
Query:   89 FDEEYPGVTIC-------ESSMTSGE------LGGNHNCTHVEGNLVIQNVWP-DQESGDLGFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQNSLA---LEKSEVSVYIDLLDEENSQYAIFPKLRVIANNSVYFKTKVKHKFLPQSIKWEELFENPKKQKL----ITYNKYMEHQCHSDC-LRNDFP--YCWSSSANHCQKQSKCVKEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNTKLNPNFKLRVGYMCANSCPG 907
            F+EEYPG  IC       ES  +S E      +  + NCTH++G++ I  +   + +  +L F  SI E+ G + ++ N ++ I   NL++IRG NS+    ++K      + +    +     F  LR I  ++V F +  K K+LP SIKW ELF +PK Q L    +T +  +  +C   C L  +F   +CW  SAN CQ+Q+ C  +       C +   NGE ++G C++QC GGCNG   S C  CK  +N   CVE C   +    G T  N  F+   G+ C+  CP 
Sbjct:   23 FEEEYPGTIICQNDNVQIESLHSSVEKLKILSIIRSKNCTHIQGSIYILGITKLESKERELNF-DSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQQTLCGSKYSSECTTCRYI--NGE-EQGCCNDQCLGGCNGGGASKCTACKNMLNEKKCVELCRGPYSGGIGGTITNKEFRYHAGFFCSKQCPA 315          
BLAST of epidermal growth factor receptor 2 vs. TrEMBL
Match: F6KBQ3 (Receptor protein-tyrosine kinase (Fragment) OS=Schmidtea mediterranea OX=79327 GN=egfr-3 PE=2 SV=1)

HSP 1 Score: 535.798 bits (1379), Expect = 4.510e-168
Identity = 293/701 (41.80%), Postives = 419/701 (59.77%), Query Frame = 3
Query: 1521 PGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIGGCRYFKENDECVKNCSRKYFSFNK------TCIKCHETCMENDK---NQPLCTGESSILGLGGCSYCSKLIHKRDEKFYCYKDPCPRHYYLNKIDISEVMKRQKSKEIGICQPCLEPCLECSGNYTIYPTCEKCNGYWSGDRCVKQC---FPIALNLPRNASCPYCNGNCVERCTVTPNDPFQCGSCNFKRLYLDN-HNK-SCVSECPQTHKY-KHKDGNLTDIICMTRSQWLSYQENPKFISKWSLIILSV---ITVFLISSVYIFFRYVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKT-IPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIRANRNIDIQEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPNDSCLRPMKKDKHRL----LSQISYDFQVYP 3554
            PG+ MCY+C  ++A  +CV +C + PG++ + +  K          CQ CHPLC QNCTGP P NC G CRY  + + C KNCS  +F          TC  CH +C  +         CTG S+ILG GGCS C KLI   + ++ C+K  CP+ +Y + I+ +     +       C+PC   C  CSG+      C +C GY+  ++CVK+C     + + L     CP C+  C   C +  ND   C  C   +L++D+  NK SCV+ CP    + +++DG   D IC+   +  + ++      K   IILS      VF+I    ++FR+  + NQ + +  +KA+YSN  EPD + + ++  T  PNM R+ +IP +DL+F+ ++KP+G+GAFG VYRG WK   +D   +   +L+V +KVI  +      E +EEAK+MASV H+HCL LIG+CL  E PCL++T+ + GSLDKYL+++   + S ++L W +QIADGM YL  RGIIHRDLA RNVL+ND + IQITDFGLA +V  T+D+   IVI  G+VPIRWLA+ETLL+  YS  TDVW++G+TLWEIFTY +RPY+EL   EI S L QGNRL QPEI ++++Y +M +CW ++ + RPSF  L+ST   F Q P  +L +P++   +   KD+ +     L+QIS D    P
Sbjct:    1 PGNEMCYSCAYYKAGNSCVKQCSNSPGYFASQTEFKTIK-------CQTCHPLCXQNCTGPTPKNCGGQCRYAIKKNTCEKNCSIDFFPVANNVNAPITCQLCHSSCFVBKTLVGTNXACTGPSNILGTGGCSKCEKLIKTNNNQYLCHKGSCPKGFYQSVINQNISHLHKNIVHQSSCEPCHSMCRTCSGSTNEKRMCHQCKGYFLDNKCVKECDNMKNVTIKLEIGDECPQCHKECRNGCLLA-NDSTACTRCLNHKLFVDDDKNKFSCVTRCPHDRNFTEYQDG---DFICLKFEETFNSKQR-----KTIFIILSGCFGFLVFIIGFCVLYFRW--RANQTRILAEIKALYSNFKEPDMKNMKEDYITRPPNMRRMQMIPISDLVFDTSSKPLGSGAFGKVYRGYWKVPRQD---NKYINLEVVIKVIHNSSKGSTDEFLEEAKIMASVSHRHCLPLIGVCLSLEKPCLVSTYAQHGSLDKYLQQNSKKISSHSMLKWAKQIADGMAYLNKRGIIHRDLAARNVLVNDDDNIQITDFGLARLVDETDDS---IVIKSGKVPIRWLAIETLLSATYSPATDVWAYGVTLWEIFTYAKRPYEELATGEIKSLLQQGNRLCQPEISTLEVYMVMIKCWLDDPHMRPSFMELVSTFEQFIQSPKRFLYMPHEYVNQQYPKDEDQREMIQLNQISIDSDFRP 677          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Cavefish
Match: ENSAMXT00000002946.2 (pep primary_assembly:Astyanax_mexicanus-2.0:12:28119056:28308465:-1 gene:ENSAMXG00000002862.2 transcript:ENSAMXT00000002946.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 255.373 bits (651), Expect = 5.522e-69
Identity = 163/493 (33.06%), Postives = 249/493 (50.51%), Query Frame = 3
Query: 2088 CEKCNGYWSGDRCVKQCFPIALNLPRNASCPYCNGNCVERC------------TVTPNDPFQCGSCNFKRLYLDNHNKSCVSECPQTHK------YKHKDGN----LTDIICMTRSQWLSYQENPKFISKWSLIILSVITVFLISSVYI--FFRYVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIRANRNIDIQ-EIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPNDSCLR 3491
            C  C  Y  G  CV+ C     NL R     + NG+    C            T     P QC  C    L+L +   +CV +CP   +      +K+ + N         C         Q+    + +  LI   VI    ++ +    F  YV + + KK     + + + + EP     L    T PN  +L ++  T+L      K +GTGAFG VY+G+W P  + ++      + VA+K++          E M+EA +MAS+ H H +RL+G+CL   +  L+T  +  G L  Y+ +HK  + S+ LL+W  QIA GM YLE R ++HRDLA RNVL+     I+ITDFGLA ++   E   N     GG++PI+W+ALE +    ++H++DVWS+G+T+WE+ T+G +PYD +  REI   L +G RL QP IC++D+Y +M +CW  +A+ RP F+ L +      + P  YL I  D C++
Sbjct:  474 CLSCRFYSRGRTCVRSC-----NLYRGDIREFANGSVCMECDSQCEKAGDKTMTCHGPGPDQCTKC----LHLKD-GPNCVEKCPDGLQGATSFIFKYAESNNECHPCHPNCTQGCTGPRIQDCIGMLDRTPLIAAGVIGGMFVAVIVALGFAIYVRRKSIKKKRALRRFLETELVEP-----LTPSGTAPNQAQLRILKETELK---RVKILGTGAFGTVYKGIWVPEGESVK------IPVAIKILNETTGPKANVEFMDEALIMASMEHPHLVRLLGVCLSPTIQ-LVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVRSPNHIKITDFGLARLLDADEKEYN---ADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDILEKGERLPQPPICTIDVYMVMVKCWMIDADSRPRFKELAAEFCRMARDPQRYLVIQGDDCMK 938          

HSP 2 Score: 100.523 bits (249), Expect = 8.503e-21
Identity = 77/255 (30.20%), Postives = 115/255 (45.10%), Query Frame = 2
Query:  161 NCTHVEGNLVIQNVWPDQESGDLGFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQNSLALEKSEVSVYIDLLDEENSQYAIF--PKLRVIANNSVYFKTKVKHKFL--PQSIKWEELFENPKKQKLITYNKYMEHQCHSDCLRNDFPYCWSSSANHCQKQSKCV-KEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNTKL--NPNFKLRVGYMCANSCP 904
            NC  V GNL I ++   + + +L FL SI EVTG + +  N    + L NL++IRG            +Y         +YA+     L  I N  VY     ++KFL    +I W+++ +NP+ + L+  +      C   C R+    CW    + CQ  +K V  E+ D    C+     G      C  +C GGC+GPK++DC  C  + +   CV  CP  F+Y+    +L  NP  K   G  C   CP
Sbjct:   29 NCEVVMGNLEITSI---ERNRNLNFLKSIREVTGYVLVALNQFDYLPLENLRIIRG----------TKLY-------EGRYALLGLKNLTEILNGGVYVD---QNKFLCHADTIHWQDILKNPRAELLVVPSNNSGSTCRR-CHRSCNGRCWGHQEDQCQTLTKTVCAEQCDG--RCF-----GPYVSDCCHRECAGGCSGPKDTDCFACTNFNDSGACVTQCPQPFVYNPTTFQLEHNPKAKYTYGAFCVKKCP 252          

HSP 3 Score: 71.633 bits (174), Expect = 5.393e-12
Identity = 69/252 (27.38%), Postives = 98/252 (38.89%), Query Frame = 3
Query: 1188 VQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIMHTDLEFLGLRKLRRI-FGKFEVHDSPGLCYADTLNWTG--------NILKNNQFDPIYPPCNKP---CDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLC------LQNCTGPRPTNCIGGCRYFKENDECVKNCSR----------KYFSFNKTCIKCHETCMENDKNQPLCTG 1859
            V+ ITG L I      + +L    NL  I      S  + L +    +  L  + L+ I  G   + ++  LCY +T+NWTG         ++K+N+ DP    C +    CD  C   GCWGPG   C +CR +     CV  C    G       I+++ +     +C  C   C         C GP P  C   C + K+   CV+ C            KY   N  C  CH  C +       CTG
Sbjct:  349 VKEITGFLNIQSWPENMTDLGVFSNLATIGGRSLYSGISLLILKQRWITALQFQSLKEISAGNVYITNNSQLCYYNTVNWTGLFRTGGQRALIKSNK-DPRE--CTQERMVCDKLCSEDGCWGPGPDQCLSCRFYSRGRTCVRSCNLYRG------DIREFANG---SVCMECDSQCEKAGDKTMTCHGPGPDQCT-KCLHLKDGPNCVEKCPDGLQGATSFIFKYAESNNECHPCHPNCTQG------CTG 581          

HSP 4 Score: 66.2402 bits (160), Expect = 2.271e-10
Identity = 36/85 (42.35%), Postives = 46/85 (54.12%), Query Frame = 3
Query: 1485 CDSKCDSQG-----CWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIG 1724
            CDS+C+  G     C GPG   C  C   +   NCV++C D  G    TS I KY ++ ++  C  CHP C Q CTGPR  +CIG
Sbjct:  509 CDSQCEKAGDKTMTCHGPGPDQCTKCLHLKDGPNCVEKCPD--GLQGATSFIFKYAESNNE--CHPCHPNCTQGCTGPRIQDCIG 589          

HSP 5 Score: 54.299 bits (129), Expect = 1.070e-6
Identity = 63/238 (26.47%), Postives = 94/238 (39.50%), Query Frame = 3
Query: 1167 LYKHLGNVQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALN------------IMHTDL-----EFLGLRKLRRIF-GKFEVHDSPGLCYADTLNWTGNILKNNQFDPIYPPCN------KPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIGGCRYFKENDECVKNCSRKYFSFNKTCIK 1808
            L K   N + + G+L I  S    +NL FL++++E+    T     ALN            I  T L       LGL+ L  I  G   V  +  LC+ADT++W  +ILKN + + +  P N      + C   C+ + CWG     C           C  RC                   +   +   CH  C   C+GP+ T+C   C  F ++  CV  C +  F +N T  +
Sbjct:   23 LRKFYENCEVVMGNLEIT-SIERNRNLNFLKSIREV----TGYVLVALNQFDYLPLENLRIIRGTKLYEGRYALLGLKNLTEILNGGVYVDQNKFLCHADTIHWQ-DILKNPRAELLVVPSNNSGSTCRRCHRSCNGR-CWGHQEDQCQTLTKTVCAEQCDGRC-------------------FGPYVSDCCHRECAGGCSGPKDTDCF-ACTNFNDSGACVTQCPQP-FVYNPTTFQ 232          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Cavefish
Match: egfra (epidermal growth factor receptor-like [Source:NCBI gene;Acc:103031629])

HSP 1 Score: 254.603 bits (649), Expect = 6.837e-69
Identity = 135/355 (38.03%), Postives = 211/355 (59.44%), Query Frame = 3
Query: 2427 LSVITVFLISSVYIFFRY---VNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIR-ANRNIDIQEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPND 3479
            +SVI   ++  +  F      V  + +++ +K  + +   + E +    L      PN + L ++  T+       K +G+GAFG VY+G+W P  +D++      + VA+KV+R A      +EI++EA VMASV H H  RL+GICL   +  L++  +  G L  Y++++K  + S+ LL+W  QIA GM YLE R ++HRDLA RNVL+   + ++ITDFGLA ++   E    E    GG+VPI+W+ALE++L+  Y+H++DVWS+G+T+WE+ T+G +PYD +   EI   L +G RL QP IC++D+Y +M +CW  +A  RP F  L++  S   + PT YL I  D
Sbjct:  587 MSVIAAGVVGGILAFVILSLGVAVLVRRRHIKRKRTLRRLLQERELVEPLTPSGEAPNQSLLRILKETEFK---KIKVLGSGAFGTVYKGLWVPEGEDVK------IPVAIKVLREATSPKANKEILDEAYVMASVEHPHVCRLLGICLTSTVQ-LVSQLMPYGCLLDYVKENKDNIGSQHLLNWCVQIAKGMNYLEDRHLVHRDLAARNVLVKTPQHVKITDFGLAKLLSADE---KEYHADGGKVPIKWMALESILHRTYTHQSDVWSYGVTVWELMTFGTKPYDGIPASEIAGVLEKGERLPQPPICTIDVYMIMVKCWMIDAESRPRFRELIAEFSKMARDPTRYLVIQGD 928          

HSP 2 Score: 84.7297 bits (208), Expect = 4.690e-16
Identity = 66/249 (26.51%), Postives = 99/249 (39.76%), Query Frame = 3
Query: 1188 VQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIMHTDLEFLGLRKLRRIF-GKFEVHDSPGLCYADTLNWTGNILKNNQF-------DPIY-PPCNKPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQ-----NCTGPRPTNCIGGCRYFKENDECVKNCSR-----------KYFSFNKTCIKCHETCMENDKNQPLCTG 1859
            V+ ITG L++      + +L+  +NL+ IR       + +L I    +  LGLR LR I  G   +  +  LCY    +W       +Q        DP      N+ CD  C  +GCWGPG  MC++C+ +    +CV  C    G +              +  C  C P C        C+ P P  C+  C +F++   CV  C +           KY    + C  CH+ C +       CTG
Sbjct:  340 VKEITGSLLVQYWPKNMPSLSPFENLEVIRGRTKHQGTVSLGIGKLPITHLGLRALREISDGDVSISANAKLCYNSPEHWKRLFRSEDQVARPMQNADPATCAALNQTCDEMCTPEGCWGPGPTMCFSCKHYSRKKSCVAFCNLLEGEHRECEV---------NMTCLECDPECRPLNGSLTCSKPGPDGCV-ECAHFRDGPHCVARCPQGIPGEKDTLVWKYPDSMRVCQLCHQNCTQG------CTG 572          

HSP 3 Score: 77.0258 bits (188), Expect = 1.199e-13
Identity = 66/250 (26.40%), Postives = 96/250 (38.40%), Query Frame = 2
Query:  161 NCTHVEGNLVIQNVWPDQESGDLGFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQNSLALEKSEVSVYIDLLDEENSQYAIFPKLRVIANNSVYFKTKVKHKFLPQSIKWEELFENPKKQKLITYNKYMEHQCHSDCLRNDFPYCWSSSANHCQKQSKCVKEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNTKL--NPNFKLRVGYMCANSCP 904
            NCT +  NL I          DL FL SI EV G + +  N    I L NL++IRG           ++Y  L             L V++N                       + N K  + +         CHSDC       CW+    +CQ  +K     +   E C  + + G      C+  C  GC GP+ +DC  C+ + + N C + CPP  +Y+    +L  NP+ K   G  C  +CP
Sbjct:   46 NCTVILENLEITYT---SHEHDLSFLKSIEEVGGYVLIGLNKAPRIPLDNLRIIRGH----------TLYDGL------------ALAVLSN-----------------------YNNSKGLRELPLISLTGKMCHSDCYNGS---CWAPGRANCQTFTK-----LTCAEQCSGRCK-GPKPSDCCNMHCASGCTGPRPTDCLACRDFQDDNTCKDACPPLMLYNPNTHQLAPNPDGKYNFGATCVKNCP 238          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Cavefish
Match: egfra (epidermal growth factor receptor-like [Source:NCBI gene;Acc:103031629])

HSP 1 Score: 254.988 bits (650), Expect = 8.094e-69
Identity = 135/355 (38.03%), Postives = 211/355 (59.44%), Query Frame = 3
Query: 2427 LSVITVFLISSVYIFFRY---VNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIR-ANRNIDIQEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPND 3479
            +SVI   ++  +  F      V  + +++ +K  + +   + E +    L      PN + L ++  T+       K +G+GAFG VY+G+W P  +D++      + VA+KV+R A      +EI++EA VMASV H H  RL+GICL   +  L++  +  G L  Y++++K  + S+ LL+W  QIA GM YLE R ++HRDLA RNVL+   + ++ITDFGLA ++   E    E    GG+VPI+W+ALE++L+  Y+H++DVWS+G+T+WE+ T+G +PYD +   EI   L +G RL QP IC++D+Y +M +CW  +A  RP F  L++  S   + PT YL I  D
Sbjct:  647 MSVIAAGVVGGILAFVILSLGVAVLVRRRHIKRKRTLRRLLQERELVEPLTPSGEAPNQSLLRILKETEFK---KIKVLGSGAFGTVYKGLWVPEGEDVK------IPVAIKVLREATSPKANKEILDEAYVMASVEHPHVCRLLGICLTSTVQ-LVSQLMPYGCLLDYVKENKDNIGSQHLLNWCVQIAKGMNYLEDRHLVHRDLAARNVLVKTPQHVKITDFGLAKLLSADE---KEYHADGGKVPIKWMALESILHRTYTHQSDVWSYGVTVWELMTFGTKPYDGIPASEIAGVLEKGERLPQPPICTIDVYMIMVKCWMIDAESRPRFRELIAEFSKMARDPTRYLVIQGD 988          

HSP 2 Score: 88.9669 bits (219), Expect = 2.463e-17
Identity = 72/260 (27.69%), Postives = 108/260 (41.54%), Query Frame = 2
Query:  161 NCTHVEGNLVIQNVWPDQESGDLGFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQNSLALEKSEVSVYIDLLDEENSQYAIFPKLRVIANNSV--YFKTKVKHKFLP-----QSIKWEELFENPKKQKLITYNKYMEH---QCHSDCLRNDFPYCWSSSANHCQKQSKCVKEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNTKL--NPNFKLRVGYMCANSCP 904
            NCT +  NL I          DL FL SI EV G + +  N    I L NL++IRG           ++Y  L     S Y     LR +   S+    K  VK    P     ++I+W ++  +    + + +          CHSDC       CW+    +CQ  +K     +   E C  + + G      C+  C  GC GP+ +DC  C+ + + N C + CPP  +Y+    +L  NP+ K   G  C  +CP
Sbjct:   61 NCTVILENLEITYT---SHEHDLSFLKSIEEVGGYVLIGLNKAPRIPLDNLRIIRGH----------TLYDGLALAVLSNYNNSKGLRELPLISLTEILKGGVKFAHNPYLCNVETIQWADIMSSKDSSQFVKFESTTSKDCKMCHSDCYNGS---CWAPGRANCQTFTK-----LTCAEQCSGRCK-GPKPSDCCNMHCASGCTGPRPTDCLACRDFQDDNTCKDACPPLMLYNPNTHQLAPNPDGKYNFGATCVKNCP 298          

HSP 3 Score: 85.1149 bits (209), Expect = 4.106e-16
Identity = 66/249 (26.51%), Postives = 99/249 (39.76%), Query Frame = 3
Query: 1188 VQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIMHTDLEFLGLRKLRRIF-GKFEVHDSPGLCYADTLNWTGNILKNNQF-------DPIY-PPCNKPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQ-----NCTGPRPTNCIGGCRYFKENDECVKNCSR-----------KYFSFNKTCIKCHETCMENDKNQPLCTG 1859
            V+ ITG L++      + +L+  +NL+ IR       + +L I    +  LGLR LR I  G   +  +  LCY    +W       +Q        DP      N+ CD  C  +GCWGPG  MC++C+ +    +CV  C    G +              +  C  C P C        C+ P P  C+  C +F++   CV  C +           KY    + C  CH+ C +       CTG
Sbjct:  400 VKEITGSLLVQYWPKNMPSLSPFENLEVIRGRTKHQGTVSLGIGKLPITHLGLRALREISDGDVSISANAKLCYNSPEHWKRLFRSEDQVARPMQNADPATCAALNQTCDEMCTPEGCWGPGPTMCFSCKHYSRKKSCVAFCNLLEGEHRECEV---------NMTCLECDPECRPLNGSLTCSKPGPDGCV-ECAHFRDGPHCVARCPQGIPGEKDTLVWKYPDSMRVCQLCHQNCTQG------CTG 632          

HSP 4 Score: 52.7582 bits (125), Expect = 2.680e-6
Identity = 62/245 (25.31%), Postives = 94/245 (38.37%), Query Frame = 3
Query: 1065 AILKNFTDIEHVIGEFHFTAQSFDKALGGITLPMLYKH----LGNVQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIMHTDLEFLGLRKLRRIFGKFEVHDSPGLCYADTLNWTGNILKNN------QFDPIYPPCNKPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIGGCRYFKENDECVKNC 1769
             IL+N  +I +   E   +     + +GG  L  L K     L N++ I G  + DG  + L  L+   N K +R L   S +  L                   G  +   +P LC  +T+ W  +I+ +       +F+       K C S C +  CW PG   C           C  RC+             K +D      C  C+  C   CTGPRPT+C+  CR F++++ C   C
Sbjct:   64 VILENL-EITYTSHEHDLSFLKSIEEVGGYVLIGLNKAPRIPLDNLRIIRGHTLYDG--LALAVLSNYNNSKGLRELPLISLTEILK------------------GGVKFAHNPYLCNVETIQW-ADIMSSKDSSQFVKFESTTSKDCKMCHSDCYNGSCWAPGRANCQTFTKLTCAEQCSGRCKG-----------PKPSD------C--CNMHCASGCTGPRPTDCL-ACRDFQDDNTCKDAC 266          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Cavefish
Match: ENSAMXT00000013634.2 (receptor tyrosine-protein kinase erbB-4 [Source:NCBI gene;Acc:103038099])

HSP 1 Score: 251.136 bits (640), Expect = 1.308e-67
Identity = 164/488 (33.61%), Postives = 256/488 (52.46%), Query Frame = 3
Query: 2088 CEKCNGYWSGDRCVKQCFPIALNLPRNAS-CPYCNGNCVERC--TVTPNDPF--QCGSCNFKRLYLDNHNKSCVSECPQTHK------YKHKDGN----LTDIICMTRSQWLSYQENPKFISKWSLIILSVI----TVFLISSVYIFFRYVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIRANRNIDIQ-EIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPNDSCLR 3491
            C  C  Y  G  CVK C    +    N S C  C+G C +    TVT + P   QC  C    L+L +   +CV +CP   +      +K+ + N         C         Q+    + +  LI+   I     V +I+  +  F     I +K+ ++  + + + + EP     L    T PN  +L ++  T+L      K +GTGAFG VY+G+W P  + ++      + VAVK++          E M+EA +MAS+ H H +RL+G+CL   +  L+T  +  G L  Y+ +HK  + S+ LL+W  QIA GM YLE R ++HRDLA RNVL+     I+ITDFGLA ++   + N+ E    GG++ I+W+ALE +    ++H++DVWS+G+T+WE+ T+G +PYD +   EI   L +G RL QP IC++D+Y +M +CW  +A+ RP F+ L++      + P  YL I  D C++
Sbjct:  494 CLSCKFYSRGKTCVKSCNLYNVREFANGSVCVECDGQCEKTGDRTVTCHGPGPDQCTKC----LHLKD-GPNCVEKCPDGLQGATSFIFKYAESNNECHPCHPNCTQGCTGPRIQDCIGLLDRTPLIVAGTIGGLFVVVIIALGFAIFARRKSIKKKRCLR--RFLETELVEP-----LTPSGTAPNQAQLRILKETELK---RVKILGTGAFGTVYKGIWVPEGESVK------IPVAVKILSETTGPKASVEFMDEALIMASMEHPHLVRLLGVCLSPTIQ-LVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHIKITDFGLARLL---DTNEKEYNADGGKMAIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPPCEIPEILEKGERLPQPPICTIDVYMVMVKCWMIDADSRPRFKELVAEFCRMARDPQRYLVIQGDDCMK 956          

HSP 2 Score: 102.449 bits (254), Expect = 2.070e-21
Identity = 77/257 (29.96%), Postives = 119/257 (46.30%), Query Frame = 2
Query:  161 NCTHVEGNLVIQNVWPDQESGDLGFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQNSLALEKSEVSVYIDLLDEENSQYAI----FPKLRVIANNSVYFKTKVKHKFL--PQSIKWEELFENPKKQKLITYNKYMEHQCHSDCLRNDFPYCWSSSANHCQKQSKCV-KEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNTKL--NPNFKLRVGYMCANSCP 904
            NC  V GNL I ++   + + +L FL SI EVTG + +  N    + L NL++IRG     L +   ++ I L    +  + +       L  I N  VY     ++KFL    +I W+++  NP+ + L+  +    + C   C R+    CW    + CQ  +K V  E+ D    C+     G      C  +C GGC+GPK++DC  C  + +   CV  CP  F+Y+  + +L  NP  K   G  C   CP
Sbjct:   29 NCEVVMGNLEITSI---ERNRNLNFLKSIREVTGYVLVALNQFDYLPLENLRIIRGTK---LYEGRYALAIFLNYRRDGYFGLRQLGLKNLTEILNGGVYVD---QNKFLCHADTIHWQDIVYNPRAELLVVPSNNSGNSCRR-CHRSCNGRCWGHQEDQCQSLTKMVCAEQCDG--RCF-----GPYVSDCCHRECAGGCSGPKDTDCFACTNFNDSGACVTQCPQPFVYNPTSFQLEHNPKAKYTYGAFCVKKCP 268          

HSP 3 Score: 65.855 bits (159), Expect = 3.518e-10
Identity = 63/249 (25.30%), Postives = 94/249 (37.75%), Query Frame = 3
Query: 1188 VQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIMHTDLEFLGLRKLRRI-FGKFEVHDSPGLCYADTLNWTG--------NILKNNQFDPIYPPCNKPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQ------NCTGPRPTNCIGGCRYFKENDECVKNCSR----------KYFSFNKTCIKCHETCMENDKNQPLCTG 1859
            V+ ITG L I      + N     NL  I      S  + L +    +  L  + L+ I  G   + ++  LCY +T+NWTG         ++K+N+           CD  C  +GCWG G   C +C+ +     CV  C        N   ++++ +     +C  C   C +       C GP P  C   C + K+   CV+ C            KY   N  C  CH  C +       CTG
Sbjct:  369 VREITGFLNIQSWPENMTNFGVFSNLATIGGRSLYSGISLLILKLRWIISLQFQSLQEISAGNVYITNNSQLCYYNTVNWTGLFRTRGQRAVIKSNKDLRECSQLQMVCDKLCSEEGCWGSGPDQCLSCKFYSRGKTCVKSC--------NLYNVREFANG---SVCVECDGQCEKTGDRTVTCHGPGPDQCT-KCLHLKDGPNCVEKCPDGLQGATSFIFKYAESNNECHPCHPNCTQG------CTG 599          

HSP 4 Score: 64.6994 bits (156), Expect = 6.416e-10
Identity = 35/85 (41.18%), Postives = 45/85 (52.94%), Query Frame = 3
Query: 1485 CDSKCDSQG-----CWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIG 1724
            CD +C+  G     C GPG   C  C   +   NCV++C D  G    TS I KY ++ ++  C  CHP C Q CTGPR  +CIG
Sbjct:  527 CDGQCEKTGDRTVTCHGPGPDQCTKCLHLKDGPNCVEKCPD--GLQGATSFIFKYAESNNE--CHPCHPNCTQGCTGPRIQDCIG 607          

HSP 5 Score: 56.225 bits (134), Expect = 2.930e-7
Identity = 85/395 (21.52%), Postives = 149/395 (37.72%), Query Frame = 3
Query: 1065 AILKNFTDIEHVIGEFHFTAQSFDKALGGITLPMLYKHLGNVQYITGDLIIDGSNIVLKNLTFL--QNLKEIRHLLTQSASAALNIM-------HTDLEFLGLRKLRRIF-GKFEVHDSPGLCYADTLNWTGNILKNNQFDPIYPPCN------KPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIGGCRYFKENDECVKNCSRKYFSFNKTCIKCHETCMENDKNQPLCTGESSILGLGGCSYCSKLIHKRDEKFYCYKDPCPRHYYLNKIDISEVMKRQKSKEIGICQPCLEPCLECSGNYTIYPTCEKCNGYWSGDRCVKQCFPIALNLPRNASCPYCNGNCV 2201
             + K + + E V+G    T+   ++ L           L +++ +TG +++      L    +L  +NL+ IR         AL I        +  L  LGL+ L  I  G   V  +  LC+ADT++W  +I+ N + + +  P N      + C   C+ + CWG     C +         C  RC                   +   +   CH  C   C+GP+ T+C   C  F ++  CV  C +  F +N T  +     +E++       G          ++C K   K    F   +  C R    NK+++ E        ++ +C PC + C +             C+G  +G   + Q    + N+ +  +C   NGN +
Sbjct:   22 TLRKFYENCEVVMGNLEITSIERNRNL---------NFLKSIREVTGYVLV-----ALNQFDYLPLENLRIIRGTKLYEGRYALAIFLNYRRDGYFGLRQLGLKNLTEILNGGVYVDQNKFLCHADTIHWQ-DIVYNPRAELLVVPSNNSGNSCRRCHRSCNGR-CWGHQEDQCQSLTKMVCAEQCDGRC-------------------FGPYVSDCCHRECAGGCSGPKDTDCF-ACTNFNDSGACVTQCPQP-FVYNPTSFQ-----LEHNPKAKYTYG----------AFCVK---KCPHNFVVDQSSCVRACPSNKMEVEE-------NQVKMCIPCTDICPKV------------CDGIGTGSLQMAQTVDSS-NIHKFVNCTKINGNLI 341          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Cavefish
Match: ENSAMXT00000030092.1 (receptor tyrosine-protein kinase erbB-4 [Source:NCBI gene;Acc:103038099])

HSP 1 Score: 250.366 bits (638), Expect = 4.396e-67
Identity = 163/490 (33.27%), Postives = 258/490 (52.65%), Query Frame = 3
Query: 2088 CEKCNGYWSGDRCVKQCFPIALNLPRNAS---CPYCNGNCVERC--TVTPNDPF--QCGSCNFKRLYLDNHNKSCVSECPQTHK------YKHKDGN----LTDIICMTRSQWLSYQENPKFISKWSLIILSVI----TVFLISSVYIFFRYVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIRANRNIDIQ-EIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPNDSCLR 3491
            C  C  Y  G  CVK C   + ++   A+   C  C+G C +    TVT + P   QC  C    L+L +   +CV +CP   +      +K+ + N         C         Q+    + +  LI+   I     V +I+  +  F     I +K+ ++  + + + + EP     L    T PN  +L ++  T+L      K +GTGAFG VY+G+W P  + ++      + VAVK++          E M+EA +MAS+ H H +RL+G+CL   +  L+T  +  G L  Y+ +HK  + S+ LL+W  QIA GM YLE R ++HRDLA RNVL+     I+ITDFGLA ++   + N+ E    GG++ I+W+ALE +    ++H++DVWS+G+T+WE+ T+G +PYD +   EI   L +G RL QP IC++D+Y +M +CW  +A+ RP F+ L++      + P  YL I  D C++
Sbjct:  536 CLSCKFYSRGKTCVKSCNLYSGDVREFANGSVCVECDGQCEKTGDRTVTCHGPGPDQCTKC----LHLKD-GPNCVEKCPDGLQGATSFIFKYAESNNECHPCHPNCTQGCTGPRIQDCIGLLDRTPLIVAGTIGGLFVVVIIALGFAIFARRKSIKKKRCLR--RFLETELVEP-----LTPSGTAPNQAQLRILKETELK---RVKILGTGAFGTVYKGIWVPEGESVK------IPVAVKILSETTGPKASVEFMDEALIMASMEHPHLVRLLGVCLSPTIQ-LVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHIKITDFGLARLL---DTNEKEYNADGGKMAIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPPCEIPEILEKGERLPQPPICTIDVYMVMVKCWMIDADSRPRFKELVAEFCRMARDPQRYLVIQGDDCMK 1000          

HSP 2 Score: 102.064 bits (253), Expect = 3.023e-21
Identity = 77/257 (29.96%), Postives = 119/257 (46.30%), Query Frame = 2
Query:  161 NCTHVEGNLVIQNVWPDQESGDLGFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQNSLALEKSEVSVYIDLLDEENSQYAI----FPKLRVIANNSVYFKTKVKHKFL--PQSIKWEELFENPKKQKLITYNKYMEHQCHSDCLRNDFPYCWSSSANHCQKQSKCV-KEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNTKL--NPNFKLRVGYMCANSCP 904
            NC  V GNL I ++   + + +L FL SI EVTG + +  N    + L NL++IRG     L +   ++ I L    +  + +       L  I N  VY     ++KFL    +I W+++  NP+ + L+  +    + C   C R+    CW    + CQ  +K V  E+ D    C+     G      C  +C GGC+GPK++DC  C  + +   CV  CP  F+Y+  + +L  NP  K   G  C   CP
Sbjct:   71 NCEVVMGNLEITSI---ERNRNLNFLKSIREVTGYVLVALNQFDYLPLENLRIIRGTK---LYEGRYALAIFLNYRRDGYFGLRQLGLKNLTEILNGGVYVD---QNKFLCHADTIHWQDIVYNPRAELLVVPSNNSGNSCRR-CHRSCNGRCWGHQEDQCQSLTKMVCAEQCDG--RCF-----GPYVSDCCHRECAGGCSGPKDTDCFACTNFNDSGACVTQCPQPFVYNPTSFQLEHNPKAKYTYGAFCVKKCP 310          

HSP 3 Score: 65.4698 bits (158), Expect = 4.726e-10
Identity = 35/85 (41.18%), Postives = 45/85 (52.94%), Query Frame = 3
Query: 1485 CDSKCDSQG-----CWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIG 1724
            CD +C+  G     C GPG   C  C   +   NCV++C D  G    TS I KY ++ ++  C  CHP C Q CTGPR  +CIG
Sbjct:  571 CDGQCEKTGDRTVTCHGPGPDQCTKCLHLKDGPNCVEKCPD--GLQGATSFIFKYAESNNE--CHPCHPNCTQGCTGPRIQDCIG 651          

HSP 4 Score: 64.3142 bits (155), Expect = 8.683e-10
Identity = 63/249 (25.30%), Postives = 95/249 (38.15%), Query Frame = 3
Query: 1188 VQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIMHTDLEFLGLRKLRRI-FGKFEVHDSPGLCYADTLNWTG--------NILKNNQFDPIYPPCNKPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQ------NCTGPRPTNCIGGCRYFKENDECVKNCSR----------KYFSFNKTCIKCHETCMENDKNQPLCTG 1859
            V+ ITG L I      + N     NL  I      S  + L +    +  L  + L+ I  G   + ++  LCY +T+NWTG         ++K+N+           CD  C  +GCWG G   C +C+ +     CV  C      Y+    ++++ +     +C  C   C +       C GP P  C   C + K+   CV+ C            KY   N  C  CH  C +       CTG
Sbjct:  411 VREITGFLNIQSWPENMTNFGVFSNLATIGGRSLYSGISLLILKLRWIISLQFQSLQEISAGNVYITNNSQLCYYNTVNWTGLFRTRGQRAVIKSNKDLRECSQLQMVCDKLCSEEGCWGSGPDQCLSCKFYSRGKTCVKSCN----LYSGD--VREFANG---SVCVECDGQCEKTGDRTVTCHGPGPDQCT-KCLHLKDGPNCVEKCPDGLQGATSFIFKYAESNNECHPCHPNCTQG------CTG 643          

HSP 5 Score: 55.4546 bits (132), Expect = 4.503e-7
Identity = 85/395 (21.52%), Postives = 149/395 (37.72%), Query Frame = 3
Query: 1065 AILKNFTDIEHVIGEFHFTAQSFDKALGGITLPMLYKHLGNVQYITGDLIIDGSNIVLKNLTFL--QNLKEIRHLLTQSASAALNIM-------HTDLEFLGLRKLRRIF-GKFEVHDSPGLCYADTLNWTGNILKNNQFDPIYPPCN------KPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIGGCRYFKENDECVKNCSRKYFSFNKTCIKCHETCMENDKNQPLCTGESSILGLGGCSYCSKLIHKRDEKFYCYKDPCPRHYYLNKIDISEVMKRQKSKEIGICQPCLEPCLECSGNYTIYPTCEKCNGYWSGDRCVKQCFPIALNLPRNASCPYCNGNCV 2201
             + K + + E V+G    T+   ++ L           L +++ +TG +++      L    +L  +NL+ IR         AL I        +  L  LGL+ L  I  G   V  +  LC+ADT++W  +I+ N + + +  P N      + C   C+ + CWG     C +         C  RC                   +   +   CH  C   C+GP+ T+C   C  F ++  CV  C +  F +N T  +     +E++       G          ++C K   K    F   +  C R    NK+++ E        ++ +C PC + C +             C+G  +G   + Q    + N+ +  +C   NGN +
Sbjct:   64 TLRKFYENCEVVMGNLEITSIERNRNL---------NFLKSIREVTGYVLV-----ALNQFDYLPLENLRIIRGTKLYEGRYALAIFLNYRRDGYFGLRQLGLKNLTEILNGGVYVDQNKFLCHADTIHWQ-DIVYNPRAELLVVPSNNSGNSCRRCHRSCNGR-CWGHQEDQCQSLTKMVCAEQCDGRC-------------------FGPYVSDCCHRECAGGCSGPKDTDCF-ACTNFNDSGACVTQCPQP-FVYNPTSFQ-----LEHNPKAKYTYG----------AFCVK---KCPHNFVVDQSSCVRACPSNKMEVEE-------NQVKMCIPCTDICPKV------------CDGIGTGSLQMAQTVDSS-NIHKFVNCTKINGNLI 383          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003172.1 (pep scaffold:Pmarinus_7.0:GL476855:1052:76454:1 gene:ENSPMAG00000002842.1 transcript:ENSPMAT00000003172.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 253.062 bits (645), Expect = 3.235e-70
Identity = 169/523 (32.31%), Postives = 270/523 (51.63%), Query Frame = 3
Query: 1983 ISEVMKRQKSKEIGICQPCLEPCLECSGNYTIYP----TCEKCNGYWSGDRCVKQCFPIALNLPRNASCPYCNGNCVERCTVTPNDPFQCGSCNFKRLYLDNHNKSCVSECPQTHKYKHKDGNLTDIICMTRSQWLSYQENPKFISKWSLIILSVITVFLISSVYIFFRYVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIR-ANRNIDIQEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPNDSCLR-PMKKDKHRLLSQIS 3533
            I+E   R+  ++  +C PC   CL  + + T +     +C +C  Y  G  CV  C P+              G   E  +  P+    C  C+           +C   C        K G L D   +     L    +P         + + + + L++ V +  R    I +K++++  + I   + EP     L      PN  +L ++  T+L      K +G+GAFG V++G+W P  +D++      + VA+KV+R A      +EI++EA +MASV H H +RL+GICL   +  L+T  + LG L +Y R+HK  + S+ LL+W  QIA GM YLE + ++HRDLA RNVL+   + ++ITDFGLA ++   + N+ E    GG++PI+WLALE++    ++H++DVWS+G+T+WE+ T+G +PY+ +  R+I   L +G RL QP IC++D+Y +M +CW  +A  RP F+ L    S   + P  YL I  D  +  P   D H L S ++
Sbjct:  400 ITEGPYREHMQD-AVCAPCDPECLPVNDSVTCFGPGSNSCVRCAHYKDGPHCVSAC-PVGAQ-----------GENDEIISKYPDKNNTCQPCH----------PNCSHGC--------KGGGLLDCHLIGP---LFRTGSPVLAVMAVGGLFACVMLLLLAVVCVRRR---NIARKRAMR--RYIEKELVEP-----LTPSGAAPNQAQLRILKETELR---KGKMLGSGAFGTVHKGIWTPEGEDVK------IPVAIKVLREATSPKANKEILDEAYIMASVSHPHLVRLLGICLTPSVQ-LVTQLMPLGCLLEYTREHKEHIGSQLLLNWAVQIAKGMMYLEEQRLVHRDLAARNVLVRTPQHVKITDFGLARLL---DINEIEYHADGGKMPIKWLALESIQYRTFTHQSDVWSYGVTIWELMTFGGKPYEGIPARDIPELLEKGERLPQPPICTIDVYMIMVKCWMIDAESRPRFKELAVEFSKMARDPQRYLVIQGDDRMTLPSPSDSHFLQSLLA 865          

HSP 2 Score: 94.7449 bits (234), Expect = 7.257e-20
Identity = 75/284 (26.41%), Postives = 114/284 (40.14%), Query Frame = 3
Query: 1185 NVQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIMHT---DLEFLGLRKLRRI-FGKFEVHDSPGLCYADTLNWTGNILKNNQFDPIYPPCNKP----------CDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQ-----NCTGPRPTNCIGGCRYFKENDECVKNCS-----------RKYFSFNKTCIKCHETCMENDKNQPLC----------TGES--SILGLGGCSYCSKLI 1910
            +++ ITG L+I      + +    +NL  IR  + QS     +++     ++  LGL  L+ +  G   + ++  LCY +T+ W    +   Q   ++   NKP          CD  C   GCWGPG   C +CR FR   +CV+ C    G          Y ++  D +C  C P CL       C GP   +C+  C ++K+   CV  C             KY   N TC  CH  C    K   L           TG    +++ +GG   C  L+
Sbjct:  253 SIKEITGHLMIQAWPENMTDFAVFENLTTIRGRVLQSVGRTFSLLVARIPNITALGLASLQEVSAGNVYLKNNERLCYYNTIKWPAVFVSEQQTSYVHD--NKPEADCNADGAVCDLLCSEHGCWGPGPDQCISCRFFRRARSCVESCYITEG---------PYREHMQDAVCAPCDPECLPVNDSVTCFGPGSNSCV-RCAHYKDGPHCVSACPVGAQGENDEIISKYPDKNNTCQPCHPNCSHGCKGGGLLDCHLIGPLFRTGSPVLAVMAVGGLFACVMLL 524          

HSP 3 Score: 66.6254 bits (161), Expect = 3.345e-11
Identity = 45/166 (27.11%), Postives = 71/166 (42.77%), Query Frame = 2
Query:  419 LRVIANNSVYFKTKVKHKFLPQSIKWEELFENPKKQKLITYNKYMEHQCHSDCLRNDFPYCWSSSANHCQKQSK--CVKEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNTKL--NPNFKLRVGYMCANSCP 904
            L  I +  VY K   KH     ++ W ++ +      +   N      CH  C +    +CW +   +CQK +K  C ++       C  +  +G      C  QC  GC+GP+++ C  CK + +   CV +CPP  IY+        NP+ K   G +C   CP
Sbjct:    1 LSEILHGGVYIKEN-KHLCYHNTVDWWDIVKEGSIVNIDMDNSTTCTSCHKGCHK----HCWGNGMKYCQKCTKLTCARQ-------CDGRC-HGPTPSECCHSQCAAGCDGPRDTHCFACKNFNDSGSCVSHCPPPTIYNPVTFAQGENPDVKYSYGAICVKECP 153          

HSP 4 Score: 53.1434 bits (126), Expect = 4.351e-7
Identity = 55/245 (22.45%), Postives = 94/245 (38.37%), Query Frame = 2
Query:  161 NCTHVEGNLVIQNVW---------PDQESGDLGFLSSIIEVTGMIFMK---NNSIKDIILPNLKVIRGQNSLALEKSEVSVYIDLLDEENSQYAIFPKLRVIANNSVYFKTKVKHKFLPQSIKWEELFENPKKQKLITYNKYMEHQCHSDCLRNDF----PYCWSSSANHCQKQSKCVKEKVDNIEWCY-----FKMRNGEIDEGFCDEQC-----TGGCNGPKNSDCAVCKKYVNGNHCVEYCP 817
            NCT + GN+               P  +   L    SI E+TG + ++    N     +  NL  IRG+    L+    +  + +    N        L+ ++  +VY K   +  +   +IKW  +F + ++   +  NK  E  C++D    D       CW    + C    +  +     +E CY     ++    +     CD +C     +  C GP ++ C  C  Y +G HCV  CP
Sbjct:  217 NCTKINGNIAFLTTGIKGDDYMKIPPLDPDKLNVFRSIKEITGHLMIQAWPENMTDFAVFENLTTIRGR---VLQSVGRTFSLLVARIPNITALGLASLQEVSAGNVYLKNNERLCYY-NTIKWPAVFVSEQQTSYVHDNK-PEADCNADGAVCDLLCSEHGCWGPGPDQC-ISCRFFRRARSCVESCYITEGPYREHMQDAVCAPCDPECLPVNDSVTCFGPGSNSCVRCAHYKDGPHCVSACP 455          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Sea Lamprey
Match: EGFR (epidermal growth factor receptor [Source:HGNC Symbol;Acc:HGNC:3236])

HSP 1 Score: 198.364 bits (503), Expect = 5.105e-52
Identity = 141/492 (28.66%), Postives = 239/492 (48.58%), Query Frame = 3
Query: 2088 CEKCNGYWSGDRCVKQCFPI---ALNLPRNASCPYCNGNCV---ERCTVTPNDPFQCGSCNFKRLYLDNHNKSCVSECPQ---------THKYKHKDG-------NLTDIICMTRSQWLSYQENPKFISKWSLIILSVIT-----VFLISSVYIFFRYVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIRANRNIDI-QEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPND 3479
            C  C  +  G  CV+ C  +          A C  C+  C+      T     P  C  C   R         CV  CP+          +KY  +DG       N T      R +   Y  N   ++K  +I   V++       L+ +++I+ R+ N + ++   KY++     + +P     L      PN  +L ++  T+L      K +G+GAFG VY+G+W P  + ++      + VAVKV+R + +    ++I++EA +MASV H H +RL+GIC+      L+T  +  G L +Y+R+H+  + S+ +L+W  QIA   + ++   ++  DL     L+  L          A++ Q  +D K+        +PI+W+ALE++    ++H++DVWS+G+T+WE+ T+G +PYD +  R+I   L +G RL QP +C++D+Y +M +CW  +A  RP F  L +  S   + P+ YL I  D
Sbjct:  493 CLSCKFHKRGKTCVESCSVLDGDEREFVSGALCIACHAECMLINGSLTCHGPGPDNCTRCRNYR-----EGPHCVGFCPEGVPGESGELIYKYPDEDGVCHPCHYNCTQGEIGERHKGAPYWAN---VNKVPVIAAGVVSGLFAVFLLLLALFIYKRHQNALRKRTLRKYVENERPQLVQP-----LTPSGAQPNQAQLRILKETELK---KGKVLGSGAFGTVYKGIWVPEGESVK------IAVAVKVLRDSASSKANKDILDEAYLMASVDHPHLVRLLGICMSSTTQ-LVTQLMPHGCLLEYVREHRGRVGSQLILNWCVQIAKNASEIQALQMVCDDLVR---LVMSLRTPPRITLASANLFQSIDDAKH---WHDRDMPIKWMALESIQYRKFTHQSDVWSYGVTVWELMTFGGKPYDGISARDIPGLLEKGERLPQPPVCTIDVYMIMVKCWMIDAESRPRFSELATDFSKMARDPSRYLVIQGD 955          

HSP 2 Score: 68.1662 bits (165), Expect = 1.062e-11
Identity = 62/246 (25.20%), Postives = 103/246 (41.87%), Query Frame = 3
Query: 1185 NVQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIMHTDLEFLGLRKLRRIFGKFEVHDS--PGLCYADTLNWTGNILKNNQFDPIYP-PCNKP------CDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCE----DEPGFYTNTSAIKKYTDNYDDGICQRCHPLCL-----QNCTGPRPTNCIGGCRYFKENDECVKNCSR-----------KYFSFNKTCIKCHETCMEND 1835
            ++Q +TG L+++   +  + L FL +L   +    Q     + ++H  L F+ +R    +   F+V  +  P  C+  TL   G+ L + + +  +   C++P      CD+ C ++GCWGPG   C +C+  +    CV+ C     DE  F +               +C  CH  C+       C GP P NC   CR ++E   CV  C             KY   +  C  CH  C + +
Sbjct:  370 SLQQLTGSLLLNHYPVRWQVLPFLLHLDLSKPSRKQFWRLHVLLVHKSLLFMLMRYCTYV-KSFQVTATVHPIFCFVSTL--FGSSLYSTKSNGRHCCACDRPGKEGYVCDALCSAEGCWGPGPMQCLSCKFHKRGKTCVESCSVLDGDEREFVSG-------------ALCIACHAECMLINGSLTCHGPGPDNCT-RCRNYREGPHCVGFCPEGVPGESGELIYKYPDEDGVCHPCHYNCTQGE 598          

HSP 3 Score: 60.8474 bits (146), Expect = 1.782e-9
Identity = 56/215 (26.05%), Postives = 90/215 (41.86%), Query Frame = 2
Query:  161 NCTHVEGNLVIQNVWPDQESGDLGFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQNSLALEKSEVSVYIDLLDEENSQYAIFPKLRV-----IANNSVYFKTKVKHKFLPQSIKWEELFENPKKQKL--------ITYNKYMEHQCHSDCLRNDFPYCWSSSANHCQKQSKCVKEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDC 766
            NC  V GNL I  +   +   DL FL +I EV+G + +  N +  + L NL+V+RG   L  ++  ++V ++  D    +     +LR+     I    VY +   K   LP    W+++     K+           +        CH  C +N   +CW S   +CQ  +  +  K  +   CY     G      C + C  GC GP+ +DC
Sbjct:   27 NCEVVMGNLEITYI---RNGSDLSFLRTIREVSGYVLIALNEVDHVPLENLRVVRG-TRLYDQRYALTVLLNYNDSVPEERLGLKELRLTRLTEILRGGVYVR---KEPGLPS---WDDIRNRNSKENFFLPVVACDFSSVSLSGQPCHPSC-KN---FCWGSGPQYCQTFTSTICAKQCDGR-CY-----GLDPNQCCHKHCASGCTGPRETDC 221          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005822.1 (pep scaffold:Pmarinus_7.0:GL476959:64997:68848:-1 gene:ENSPMAG00000005273.1 transcript:ENSPMAT00000005822.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 170.629 bits (431), Expect = 1.440e-48
Identity = 81/185 (43.78%), Postives = 117/185 (63.24%), Query Frame = 3
Query: 2988 GMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPNDSCLR-PMKKDKHRLLSQISYD 3539
            GM YLE R ++HRDLA RNVL+     ++ITDFGLA ++     N+ E    GG++PI+WLALE++   I++H++DVWS+G+TLWE+ T+G +PYD +  R+I   L +G RL QP IC++D+Y +M +CW  +A  RP F  L +  S   + PT YL I  D  ++ P   D   L S +  D
Sbjct:    1 GMNYLEDRRLVHRDLAARNVLVKAPNHVKITDFGLAKLLDL---NETEYHSEGGKLPIKWLALESIQQRIFTHQSDVWSYGVTLWELMTFGGKPYDGVPARDIPELLEKGERLTQPPICTIDVYMIMVKCWMIDAESRPKFRELAAEFSKMARDPTRYLVIQGDERMKLPSPTDSRFLQSLMEED 182          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Sea Lamprey
Match: frk (fyn-related Src family tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-110411-7])

HSP 1 Score: 179.104 bits (453), Expect = 1.545e-48
Identity = 100/275 (36.36%), Postives = 153/275 (55.64%), Query Frame = 3
Query: 2646 KPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIRANRNIDIQEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKH-KSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLN 3467
            K +G G FG V++G+W            +S  VAVK ++    +  +E + EA++M  + H + ++L  +C + E   +IT  +  GSL  YLR      L +  L+    QIA GM YLE +  IHRDLA RN+L+ + ++ ++ DFGLA I++   +++ E   +G +VPI+W A E +    +S K+DVWSFGI L+E+ TYG  PY E+   E+   L +G R+ QP+ C    Y +M  CW +   +RP+FETL   L  F   P  Y +
Sbjct:  193 KRLGAGMFGEVWQGLWN-----------NSTLVAVKTLKPG-AMKKEEFIGEAQIMKQLRHANLIQLYAVCSQEEPIYIITELMRHGSLLDYLRGPLGKQLKAPELVDMARQIAAGMAYLESQNYIHRDLAARNILVGEGKVCKVADFGLARIIKVRYEDEYE-GKAGAKVPIKWTAPEAVNFHRFSVKSDVWSFGILLYELITYGRMPYPEMGNMEVLKQLDRGYRMPQPDNCPPLFYSIMLECWNKKEEERPTFETLQWRLDYFDSDPNNYTD 454          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Sea Lamprey
Match: fgfr2 (fibroblast growth factor receptor 2 [Source:NCBI gene;Acc:352940])

HSP 1 Score: 179.874 bits (455), Expect = 1.729e-47
Identity = 101/280 (36.07%), Postives = 160/280 (57.14%), Query Frame = 3
Query: 2646 KPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIRANR-NIDIQEIMEEAKVMASVC-HKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHK----------------STLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTL 3431
            KP+G G FG V     +    D EK +R SL VAVK+++ +  + D+ +++ E ++M ++  HK+ + L+G C +     +I  F   G+L ++LR  +                  L  + L+S+  Q+A GM YL  +  IHRDLA RNVL+ D  +++I DFGLA  V   +  K     S G++P++W+A E L + +Y+H++DVWSFG+ LWEIFT G  PY  + V E+   L +G+R+ +P +CS +LY +M  CW    + RP+F+ L+  L
Sbjct:  280 KPLGEGCFGQVVMA--EALGIDKEKPNR-SLRVAVKMLKEDATDKDLYDLVSEMEMMKNIGKHKNIINLLGACTQGGPLYVIVEFAAKGNLREFLRARRPPGTEYTFEGAAAAQGEQLSIKELVSFTYQVARGMEYLASKKCIHRDLAARNVLVTDDNVMKIADFGLARDVNYIDYYKK---TSNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDRPALCSTELYMMMKDCWAAVPSHRPTFKQLVEDL 553          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 97.8265 bits (242), Expect = 6.561e-21
Identity = 68/258 (26.36%), Postives = 127/258 (49.22%), Query Frame = 3
Query: 2652 IGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIRANRNIDIQEIMEEAKVMASVCHKHCLRLIGICLK-YEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLM 3422
            IG G++G VY+ + K +++           VA+K +    + ++ +IM E  ++ ++ H + ++  G   K YE+  L+  +   GSL + + +  + L      ++  Q   G+ YL   G+IHRD+   N+LL+    +++ DFG++ IV     N + + ++G    + W+A E L N   S  +D+WS G T+ E+ T    PY  L    I  Y ++ +    P   S  L   + +C+ +N   RP+ + L+
Sbjct:   31 IGRGSYGVVYKAINKHTDQV----------VAIKEVVYENDEELNDIMAEISLLKNLNHNNIVKYHGFIRKSYELYILLE-YCANGSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVSTIV-----NSSALTLAGT---LNWMAPEILGNRGASTLSDIWSLGATVVEMLTKNP-PYHNLTDANIY-YAVENDTYYPPSSFSEPLKDFLSKCFVKNMYKRPTADQLL 267          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Yeast
Match: SKM1 (Member of the PAK family of serine/threonine protein kinases; similar to Ste20p; involved in down-regulation of sterol uptake; proposed to be a downstream effector of Cdc42p during polarized growth; SKM1 has a paralog, CLA4, that arose from the whole genome duplication [Source:SGD;Acc:S000005473])

HSP 1 Score: 86.6557 bits (213), Expect = 1.071e-17
Identity = 85/300 (28.33%), Postives = 128/300 (42.67%), Query Frame = 3
Query: 2604 LLIPTTDLIFNINTKP-------IGTGAFGAVY--RGVWKPSNKD--LEKSDRDSL---DVAVKVIRANRNIDIQEIMEEAKVMASVCHKHCLRLI-GICLKYEMPCLITTFVELGSLDKYLR--------KHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGN---RLAQPEICSVDLYQLMCRCWYENANDRPSFETLMS 3425
            +++    +  ++N +P        G GA GAVY  + +  P   D    KS    +    VA+K IR +     Q IM E  VM     ++ +  +    +  E   +I  ++E G L   L         +H S L    +    ++   G+ +L  + IIHRD+ + N+LLN   +++ITDFG    V+ TE       + G      W+A E +    Y  K DVWS GI L E+   GE PY   D  +   YLI  N   +L  PE  S    Q +  C   N   R S   L++
Sbjct:  343 IIMKMKTVAIDVNPRPYFQLVEKAGQGASGAVYLSKRIKLPQENDPRFLKSHCHRVVGERVAIKQIRLSEQPKKQLIMNELLVMNDSRQENIVNFLEAYIIDDEELWVIMEYMEGGCLTDILDAVARSNTGEHSSPLNENQMAYIVKETCQGLKFLHNKKIIHRDIKSDNILLNSQGLVKITDFGFC--VELTEKRSKRATMVGTPY---WMAPEIVNQKGYDEKVDVWSLGIMLIEMIE-GEPPYLNEDPLKAL-YLIANNGSPKLRHPESVSKQTKQFLDACLQVNVESRASVRKLLT 635          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Yeast
Match: STE20 (Cdc42p-activated signal transducing kinase; involved in pheromone response, pseudohyphal/invasive growth, vacuole inheritance, down-regulation of sterol uptake; GBB motif binds Ste4p; member of the PAK (p21-activated kinase) family [Source:SGD;Acc:S000000999])

HSP 1 Score: 81.6481 bits (200), Expect = 5.392e-16
Identity = 77/268 (28.73%), Postives = 121/268 (45.15%), Query Frame = 3
Query: 2652 IGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIRANRNIDIQEIMEEAKVMASVCHKHCLRLI-GICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGE------QIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPY-DELDVREITSYLIQGN---RLAQPEICSVDLYQLMCRCWYENANDRPSFETLM 3422
            IG GA G VY      +N          + VA+K +   +    + I+ E  VM    H + +  I    LK ++  +I  ++E GSL   +     T C   +L+ G+      +   G+ +L  +G++HRD+ + N+LL+    I++TDFG     Q  E N     + G      W+A E +    Y  K D+WS GI + E+   GE PY +E  +R +  YLI  N   +L +PE  S  L + +  C      DR S   L+
Sbjct:  626 IGQGASGGVYTAYEIGTN----------VSVAIKQMNLEKQPKKELIINEILVMKGSKHPNIVNFIDSYVLKGDL-WVIMEYMEGGSLTDVV-----THC---ILTEGQIGAVCRETLSGLEFLHSKGVLHRDIKSDNILLSMEGDIKLTDFGFC--AQINELNLKRTTMVGTPY---WMAPEVVSRKEYGPKVDIWSLGIMIIEMI-EGEPPYLNETPLRAL--YLIATNGTPKLKEPENLSSSLKKFLDWCLCVEPEDRASATELL 866          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Yeast
Match: CLA4 (Cdc42p-activated signal transducing kinase; member of the PAK (p21-activated kinase) family, along with Ste20p and Skm1p; involved in septin ring assembly, vacuole inheritance, cytokinesis, sterol uptake regulation; phosphorylates Cdc3p and Cdc10p; CLA4 has a paralog, SKM1, that arose from the whole genome duplication [Source:SGD;Acc:S000005242])

HSP 1 Score: 79.337 bits (194), Expect = 2.695e-15
Identity = 76/277 (27.44%), Postives = 127/277 (45.85%), Query Frame = 3
Query: 2655 GTGAFGAVYRG--VWKPSNKDLEKSDRDSLD-------VAVKVIRANRNIDIQEIMEEAKVMASVCHKHCLRLIGICLKYEMPC-LITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIA-------DGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPY-DELDVREITSYLIQGN---RLAQPEICSVDLYQLMCRCWYENANDRPSFETLM 3422
            G GA G+VY       P+  ++ +   + +D       VA+K +  ++    + I+ E  VM    HK+ +  +   L+ +    ++  F+E GSL   +    +   S + L+   QIA        G+ +L  + IIHRD+ + NVLL+    ++ITDFG     + T+       + G      W+A E +    Y  K DVWS GI   E+   GE PY +E  ++ +  YLI  N   +L  PE  S+++ + +  C   +   R S E L+
Sbjct:  553 GQGASGSVYLAERTHIPTESNMIELINNDIDEPHVGDKVAIKQMVLSKQPRKELIVNEILVMKDSRHKNIVNFLEAYLRTDDDLWVVMEFMEGGSLTDIIENSPTNDNSHSPLT-EPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTRARVKITDFGFC--ARLTDKRSKRATMVGTPY---WMAPEVVKQREYDEKIDVWSLGIMTIEMLE-GEPPYLNEDPLKAL--YLIATNGTPKLKHPESLSLEIKRFLSVCLCVDVRYRASTEELL 820          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Yeast
Match: BCK1 (MAPKKK acting in the protein kinase C signaling pathway; the kinase C signaling pathway controls cell integrity; upon activation by Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p; MAPKKK is an acronym for mitogen-activated protein (MAP) kinase kinase kinase [Source:SGD;Acc:S000003631])

HSP 1 Score: 76.6406 bits (187), Expect = 2.006e-14
Identity = 68/271 (25.09%), Postives = 123/271 (45.39%), Query Frame = 3
Query: 2652 IGTGAFGAVYRGVWKPSN-----KDLEKSDRDSLDVAVKVIRANRNIDIQEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETL-LNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEIC--SVDLYQLMCR-----CWYENANDRPSFETLMS 3425
            IG G+FGAVY  +   +      K +E     S + A+          ++ +  E   +  + H + ++ +G   K  +  L   +V  GS+   +R +        +     Q+  G+ YL  +GI+HRD+   N+LL+   I +I+DFG++   +    N +++ + G    + W+A E +     YS K D+WS G  + E+F  G+RP+  L+V  + +    G   + P I   ++ L   + R     C+  N   RP+   L+S
Sbjct: 1181 IGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILST-------VEALRSEVSTLKDLDHLNIVQYLGFENKNNIYSLFLEYVAGGSVGSLIRMY-GRFDEPLIKHLTTQVLKGLAYLHSKGILHRDMKADNLLLDQDGICKISDFGISRKSKDIYSN-SDMTMRGT---VFWMAPEMVDTKQGYSAKVDIWSLGCIVLEMFA-GKRPWSNLEV--VAAMFKIGKSKSAPPIPEDTLPLISQIGRNFLDACFEINPEKRPTANELLS 1436          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Nematostella
Match: EDO47195 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN18])

HSP 1 Score: 184.111 bits (466), Expect = 7.829e-52
Identity = 102/273 (37.36%), Postives = 154/273 (56.41%), Query Frame = 3
Query: 2652 IGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIRANRNIDIQEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKST-LCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLN 3467
            +G G +G VY G WK  NK           VAVK +R    ++++E ++EA VM  + H++ ++L+G+C +     +IT F+  G+L  YLR  K   L + TL+    Q+   M+YLE    IHRDLA RN L+ D  ++++ DFGL+ +V  +ED        G + PI+W A E L +  +S K+DVW+FGI LWE+ TYG  PY  +D+ ++   L  G R+  PE C  ++Y LM  CW  + N RPSF+ +   L+    FP+  +N
Sbjct:   20 LGGGQYGEVYEGTWKKYNKT----------VAVKTLR-EETMEVEEFLKEASVMKGIKHQNLVQLLGVCTREPPFYIITEFMMNGNLLDYLRSPKGKDLDAVTLMYMATQVGSAMSYLESMNFIHRDLAARNCLVGDNNLVKVADFGLSRLV--SEDIYT--AHQGAKFPIKWTAPEALAHNTFSIKSDVWAFGILLWELATYGMSPYPGIDLSQVYDKLDGGYRMPCPEGCPPEVYSLMQTCWCWDPNSRPSFKEIHEKLNTM--FPSSNVN 275          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Nematostella
Match: EDO47094 (Predicted protein; Vascular endothelial growth factor receptor-like protein [Source:UniProtKB/TrEMBL;Acc:A7RN88])

HSP 1 Score: 168.703 bits (426), Expect = 2.114e-46
Identity = 101/282 (35.82%), Postives = 151/282 (53.55%), Query Frame = 3
Query: 2652 IGTGAFGAVYRGVWKPS---NKDLEKSDRDSLDVAVKVIRANRNIDIQ-EIMEEAKVMASV-CHKHCLRLIGICLKYEMPCL--ITTFVELGSLDKYLRK---------------HKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTL 3431
            +G+GAFG VY G  +      +    S R ++ VA+K ++       Q +++ E K++  V  HK+ + L+G C K     L  I  F   G L  YL+K               H        L+S   Q+A GM +L  R  IHRDLA RNVL+ D  ++++ DFGLA  V     N+  +  + G VPI+W+A+E+L + IYS K+DVWS+G+ LWEIFT G  PY +L   ++  YL+ G R+ +P  C+ ++Y +M  CW  +  DRP+F  L+  L
Sbjct:   22 LGSGAFGQVYLGETEGGIDYRRPSAISMRGNIKVAIKTLKGGATESEQKDLLSELKILIHVGSHKNIVNLLGACTKGPQRDLWIILEFCANGDLLSYLKKKRDIYDPAWCAPSEDHDVQFTQMELVSAAYQVARGMEFLASRRCIHRDLAARNVLIADDYVLKVADFGLARDVY---KNEEYVKHTPGLVPIKWIAIESLTDKIYSQKSDVWSYGVLLWEIFTLGGNPYPDLHPSDVFEYLLDGKRMEKPVDCAQEIYNIMTDCWVLSPEDRPTFTELVKKL 300          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Nematostella
Match: EDO47097 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN91])

HSP 1 Score: 167.548 bits (423), Expect = 5.627e-46
Identity = 94/280 (33.57%), Postives = 154/280 (55.00%), Query Frame = 3
Query: 2652 IGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIRANR-NIDIQEIMEEAKVMASVC-HKHCLRLIGICLKYEMPCLITTFVEL---GSLDKYLRKHK---------------STLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTL 3431
            +GTGAFG V+        + +  S++    VA K ++ N  + + ++++ E K++  +  HK+ + L+G C K    C +   +E    G+L  +LRK +                T     L+    Q++  M +L  R  +HRDLA RNVL+ +  +++I DFGLA  +   E   + +  + G +P++W+A+E L++ +Y+H +DVWSFG+ LWEIFT G  PY  L   E+  YL++G R+AQPE C  ++Y LM RCW  +   RP+F  L+ T+
Sbjct:   22 VGTGAFGQVFLA------EAVGISNKQVTRVACKGLKENATDSEYRDLLSELKILMHIGEHKNIVNLLGACTKGR-ECDLLVIIEYCPHGNLLNFLRKRRDVFEATWSPPTEKPDETFTLTDLVITSFQVSRAMQFLASRRCVHRDLAARNVLVGENYVMKIADFGLARDIYKEE---HYVKTTAGLLPVKWMAIEALVDQVYTHSSDVWSFGVLLWEIFTLGGSPYPGLPANEVYQYLMEGQRMAQPEDCPQEMYDLMLRCWQHDPAQRPTFTQLLETI 291          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Nematostella
Match: EDO33736 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRD7])

HSP 1 Score: 167.548 bits (423), Expect = 6.140e-45
Identity = 91/259 (35.14%), Postives = 141/259 (54.44%), Query Frame = 3
Query: 2652 IGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIR-ANRNIDIQEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLA-HIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLM 3422
            IG G F  VYRGV    +K  EK       VAVK+++  + + + ++   EA +M    H + + L G+  +     +IT F+E GSLD +L+ +   L +  L+  G  +A GM YL     IHRDLA RN+L++D    +++DFGL+  +    E+ ++E    GG++P+RW A E +    +S  +DVWS+GI LWEI ++GERPY   D  ++   +  G RL  P  C   ++ LM  CW +    RP F  ++
Sbjct:   33 IGGGEFADVYRGVLTNEDKTQEK-------VAVKILKPGSSHKNREDFCVEASIMGQFDHPNVIALKGVITRTRPMMIITEFLENGSLDNFLKSNDGRLTTLQLVGIGRGVAAGMAYLSEMNFIHRDLAARNILVSDNLAAKVSDFGLSRELDDSPENEQSEYQTQGGKIPVRWTAPEAIRYRKFSSASDVWSYGILLWEIMSFGERPYWTWDNFQVMDRVEGGYRLPAPMKCPKVIHNLMLDCWDKEKTSRPKFADIV 284          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Nematostella
Match: EDO31298 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYB5])

HSP 1 Score: 163.696 bits (413), Expect = 6.784e-45
Identity = 95/256 (37.11%), Postives = 142/256 (55.47%), Query Frame = 3
Query: 2646 KPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIRANR-NIDIQEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSF 3410
            K +G G FG+V +G +K  N +        + VAVK ++++  N    EI+ EA+VM  + H + +R+IG+C    M  L+      G L+KYL+K+K  +    +L    Q+A+GM YLE    +HRDLA RNVL+ +   ++I+DFG++  +    D       + G+ P++W A E +    +S K+DVWS+GITLWE  +YG RPY  L  + I   +  G RL  P      +YQLM  CW    +DRPSF
Sbjct:   30 KELGHGNFGSVLKGTYKMPNGE-------RIPVAVKSLKSDDINNPKSEILHEARVMMELDHPYIVRIIGMCQGPSM-MLVMELAGEGPLNKYLKKNKG-MPLLNILVLMLQVAEGMQYLESLQFVHRDLAARNVLVVNDSFVKISDFGMSRAMGAGSDYYK--AGTAGRWPLKWYAPECIYFRKFSSKSDVWSYGITLWEATSYGARPYQSLSGQAILEKIESGYRLPAPAKLPSCVYQLMKDCWQWEQDDRPSF 274          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Medaka
Match: egfra (epidermal growth factor receptor [Source:NCBI gene;Acc:101159776])

HSP 1 Score: 259.225 bits (661), Expect = 5.106e-71
Identity = 170/480 (35.42%), Postives = 254/480 (52.92%), Query Frame = 3
Query: 2088 CEKCNGYWSGDRCVKQCFPIALNLPR----NASCPYCNGNCVE-RCTVTPNDPFQCGSC-NFK-RLYLDNHNKSCVSECPQ-------THKYKHKDGNLTDIICMTRSQWLSYQENPKFISKWSLIILSVITVFLIS-SVYIFFRYVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIR-ANRNIDIQEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPND 3479
            C  C  Y  G RCV  C  I    PR    N +C  C+  C     T T + P  C  C NF+  LY       CVS CPQ       T  +K+ D      +C         Q +       + ++  ++TV +   SV++  R    I +K++++ L      + E +    L      PN   L ++  ++       K +G+GAFG VY+G+W P  +D++      + VA+KV+R A      +EI++EA VMASV + H  RL+GICL   +  LIT  +  G L  Y+++ K  + S+ LL+W  QIA GM YLE R ++HRDLA RNVL+     ++ITDFGLA ++   E    E    GG+VPI+W+ALE++L   Y+H++DVWS+G+T+WE+ T+G +PYD +   EI   L +G+RL QP IC++D+Y +M +CW  +A  RP F  L+   +   + P+ YL I  D
Sbjct:  440 CFACRDYSRGGRCVDSCN-ILEGEPREAVMNKTCVECDPECQRMNGTATCSGPGNCAKCANFQDGLY-------CVSRCPQGVPGEDDTLVWKYADERNVCQLCHKNCT----QGSTGLSMIAAGVVGGLLTVLVTGLSVFVLLRR-RYIKRKRTMRRL------LQERELVEPLTPSGQAPNQALLRILKESEFK---KIKVLGSGAFGTVYKGLWVPEGEDVK------IPVAIKVLREATSPKANKEILDEAYVMASVENPHVCRLLGICLTSTVQ-LITQLMPYGCLLDYVKEKKDNIGSQHLLNWCVQIAKGMNYLEERHLVHRDLAARNVLVKTPNHVKITDFGLAKLLNADE---KEYHADGGKVPIKWMALESILTRTYTHQSDVWSYGVTVWELMTFGTKPYDGIPASEIAGILEKGDRLPQPPICTIDVYMIMVKCWMIDAESRPRFRELIGEFTKMARDPSRYLVIQGD 887          

HSP 2 Score: 87.4261 bits (215), Expect = 4.456e-31
Identity = 95/336 (28.27%), Postives = 131/336 (38.99%), Query Frame = 3
Query:  900 VQEVDACIYSCNSLHFYRVDN----KCIRCQNSSVCAXXXXXXXXXXXXXXXDVFYMTAAILKNFTDIEHVIGEFHFTAQSFDKALGGITL-PMLYKHLGNVQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIMHTDLEFLGLRKLRRIF-GKFEVHDSPGLCYADTLNWTGNILKNNQFDPIYPPCNKPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRC---EDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQ-----NCTGPRPTNCIGGCRYFKENDECVKNCSR-----------KYFSFNKTCIKCHETCMEN 1832
            V +  AC+ +C S + Y VD     KC +C     C K    +          +        KN T I   I   H T+   DK      + P        V+ ITG L I      + +L+  +NL+ IR   T+  S ++ I   D+ +LGLR L+ I  G   +  +  LCY +  +W G      Q        N  CD KC + GCWGPG  MC+ CR +     CVD C   E EP       A+   T       C  C P C +      C+G  P NC   C  F++   CV  C +           KY      C  CH+ C + 
Sbjct:  232 VTDHGACVRTC-SGNTYEVDEGGIRKCAKCNGP--CPKVCNGLGTGNLTHTLSINATNIDSFKNCTKINGNIAFIH-TSIYGDKFTKTPKMDPAKLDVFKTVKEITGYLWIQTWPKNMSSLSPFENLEIIRGR-TKQGSRSVAITQLDISYLGLRSLKEISDGDVVIIKNHNLCYTNRSHWKGLFKSKTQT-----LMNSTCDRKCAADGCWGPGPDMCFACRDYSRGGRCVDSCNILEGEP-----REAVMNKT-------CVECDPECQRMNGTATCSG--PGNC-AKCANFQDGLYCVSRCPQGVPGEDDTLVWKYADERNVCQLCHKNCTQG 542          

HSP 3 Score: 68.9366 bits (167), Expect = 4.456e-31
Identity = 66/250 (26.40%), Postives = 97/250 (38.80%), Query Frame = 2
Query:  161 NCTHVEGNLVIQNVWPDQESGDLGFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQNSLALEKSEVSVYIDLLDEENSQYAIFPKLRVIANNSVYFKTKVKHKFLPQSIKWEELFENPKKQKLITYNKYMEHQCHSDCLRNDFPYCWSSSANHCQKQSKCVKEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNTKL--NPNFKLRVGYMCANSCP 904
            NCT V  NL I  +     + DL FL SI EV G + +  N+   I L NL++IRG           S+Y         ++A    L V+ N+                       +       +   K    +CHS C       CW+    +CQ  +K     ++  + C  + + G      C+E C  GC GP+ +DC  C+ + +   C + CP    YD     L  NPN K   G  C  +CP
Sbjct:   34 NCTVVLENLEITYM---DNNHDLSFLKSIEEVGGYVLIALNTATRIPLENLRIIRGH----------SLY-------EGEFA----LSVLVNS-----------------------DKGTGTTELLLTKLTGKKCHSSCFNGS---CWAPGPQYCQTLTK-----LNCAQQCSKRCK-GPSPSDCCNEHCAAGCTGPRPTDCLACRDFRDDGVCKDSCPGLMRYDPNLHLLVPNPNGKYSFGATCVKNCP 227          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Medaka
Match: ENSORLT00000004471.2 (melanoma receptor tyrosine-protein kinase [Source:NCBI gene;Acc:101169984])

HSP 1 Score: 259.61 bits (662), Expect = 2.111e-70
Identity = 139/360 (38.61%), Postives = 217/360 (60.28%), Query Frame = 3
Query: 2415 SLIILSVITVFLISSVYIFFRYV----NKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIR-ANRNIDIQEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPND 3479
            S + + V++  L++ + + F  V     +I +K++++ L      + E +    L      PN   L ++  T+       + +G+GAFG V++G+W P  +++       + VA+KV+R A      QE+++EA VMASV H H  RL+GICL   +  L+T  +  G L  Y+R+HK  +C++ LL+W  QIA GM YLE R ++HRDLA RNVLL +   I+ITDFGLA ++  T D K E    GG+VPI+W+ALE++L   Y+H++DVWS+G+T+WE+ T+G +PYD +   EI + L +G RL QP IC++D+Y +M +CW  + + RP F+ L+   S   + P+ YL I  D
Sbjct:  664 SSLAVGVVSGLLVAVIVLLFVLVYVRRQRIKKKRTLRRL------LQEKELVEPLTPSGQAPNQALLRILKETEFK---KVRVLGSGAFGTVFKGLWVPEGENVR------IPVAIKVLREATSPKANQEVLDEAYVMASVDHPHVCRLLGICLTSSVQ-LVTQLMPYGCLLDYVRQHKDRICAQWLLNWCVQIAKGMNYLEERHLVHRDLAARNVLLKNPNHIKITDFGLAKLL--TADEK-EYHADGGKVPIKWMALESILQWTYTHQSDVWSYGVTVWELMTFGSKPYDGIAASEIATVLERGERLPQPPICTIDVYMIMVKCWMIDPSSRPKFKELIMEFSQMARDPSRYLVIRGD 1004          

HSP 2 Score: 115.546 bits (288), Expect = 1.818e-25
Identity = 90/310 (29.03%), Postives = 134/310 (43.23%), Query Frame = 3
Query: 1044 DVFYMTAAILKNFTDIEHVIGEFHFTAQSFDKALGGITLPMLYKHLG---NVQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIMHTD-LEFLGLRKLRRI-FGKFEVHDSPGLCYADTLNWTGNILKNNQFDPIYPPC------NKPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCL-----QNCTGPRPTNCIGGCRYFKENDECVKNCSR-----------KYFSFNKTCIKCHETCMENDKNQPLCTGESSILGLGGCS 1892
            +   + ++ +++F +   + G+  F   SF         PM  K L     V+ ITG L+I      + +L+  +NL+ IR         +  ++  D L +LGLR L+ +  G   + D+  LCY+  +NW+       Q     PP       N+ CD +C S+GCWGPG++MC +C+ F    +CV+RC    G                +G C  CHP CL     Q C GP P  C   C +FK+   CV+ C             KY   N  C  CH+ C +       C+G     GL GCS
Sbjct:  369 NTIAVNSSNIESFRNCTKINGDIVFLKSSFSGDQHYNIPPMDPKKLEYFRTVKEITGHLLIQTWPENMTSLSVFENLEIIRGRSLFVNKYSFVVVGADNLHWLGLRSLKELSAGNVRLKDNKLLCYSKAMNWSYLFRDKTQIVDQTPPVDVCEGQNQTCDQQCSSKGCWGPGTNMCLSCQYFNRKQHCVERCNLLQGEPREVEV---------EGSCVECHPECLVMTGTQTCHGPGPDQC-SQCAHFKDGSHCVRMCPHGVLDDENMLIWKYADQNGQCQLCHQNCSQG------CSGP----GLSGCS 658          

HSP 3 Score: 89.3521 bits (220), Expect = 2.015e-17
Identity = 76/263 (28.90%), Postives = 119/263 (45.25%), Query Frame = 2
Query:  161 NCTHVEGNLVIQNVWPDQESGDLGFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQN-----SLALEKSEVSVYIDLLDEENS--QYAIFPKLRVIANNSVYFKTKVKHKFL---PQSIKWEELFENPKK-QKLITYNKYME--HQCHSDCLRNDFPYCWSSSANHCQKQSKCVKEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNTKL--NPNFKLRVGYMCANSCP 904
            NC+ V  NL I     +Q   DL FL SI EV G + +  N +  + L NL++IRGQN     +L +  +  S  I       S  +     +L  I N  V    KV +  L    + I+W ++ +  +    L+ ++ Y     +C   C+ +    CW++  +HCQK +K V       E C     +G      C++ C  GC GP  +DC  CK + +   C + CPP  +Y+  + ++  NPN K   G  C  +CP
Sbjct:   72 NCSVVLENLEITYTLENQ---DLSFLQSIQEVGGYVLIAMNDVATVPLVNLRLIRGQNLYDKFALLVMSNYHSNNITGAPRYTSGLRQLQLSRLTEILNGGV----KVTNNPLLCNMEKIQWWDIVDKARNFSVLLKFDDYKRDCERCDPGCVNDS---CWAAGPDHCQKFTKLVCA-----EQCGPGRCSGPKPLDCCNQHCAAGCTGPLATDCLACKNFNDDGICKDSCPPLNLYNHKSQQVVENPNAKYSFGATCVKACP 319          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Medaka
Match: ENSORLT00000004469.2 (melanoma receptor tyrosine-protein kinase [Source:NCBI gene;Acc:101169984])

HSP 1 Score: 259.225 bits (661), Expect = 2.125e-70
Identity = 139/360 (38.61%), Postives = 217/360 (60.28%), Query Frame = 3
Query: 2415 SLIILSVITVFLISSVYIFFRYV----NKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIR-ANRNIDIQEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPND 3479
            S + + V++  L++ + + F  V     +I +K++++ L      + E +    L      PN   L ++  T+       + +G+GAFG V++G+W P  +++       + VA+KV+R A      QE+++EA VMASV H H  RL+GICL   +  L+T  +  G L  Y+R+HK  +C++ LL+W  QIA GM YLE R ++HRDLA RNVLL +   I+ITDFGLA ++  T D K E    GG+VPI+W+ALE++L   Y+H++DVWS+G+T+WE+ T+G +PYD +   EI + L +G RL QP IC++D+Y +M +CW  + + RP F+ L+   S   + P+ YL I  D
Sbjct:  654 SSLAVGVVSGLLVAVIVLLFVLVYVRRQRIKKKRTLRRL------LQEKELVEPLTPSGQAPNQALLRILKETEFK---KVRVLGSGAFGTVFKGLWVPEGENVR------IPVAIKVLREATSPKANQEVLDEAYVMASVDHPHVCRLLGICLTSSVQ-LVTQLMPYGCLLDYVRQHKDRICAQWLLNWCVQIAKGMNYLEERHLVHRDLAARNVLLKNPNHIKITDFGLAKLL--TADEK-EYHADGGKVPIKWMALESILQWTYTHQSDVWSYGVTVWELMTFGSKPYDGIAASEIATVLERGERLPQPPICTIDVYMIMVKCWMIDPSSRPKFKELIMEFSQMARDPSRYLVIRGD 994          

HSP 2 Score: 118.242 bits (295), Expect = 2.719e-26
Identity = 90/304 (29.61%), Postives = 136/304 (44.74%), Query Frame = 3
Query: 1044 DVFYMTAAILKNFTDIEHVIGEFHFTAQSFDKALGGITLPMLYKHLG---NVQYITGDLIIDGSNIVLKNLTFLQNLKEIR-HLLTQSASAALNIMHTDLEFLGLRKLRRI-FGKFEVHDSPGLCYADTLNWTGNILKNNQFDPIYPPCNKPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCL-----QNCTGPRPTNCIGGCRYFKENDECVKNCSR-----------KYFSFNKTCIKCHETCMENDKNQPLCTGESSILGLGGCS 1892
            +   + ++ +++F +   + G+  F   SF         PM  K L     V+ ITG L+I      + +L+  +NL+ IR   L  +  + + +   +L +LGLR L+ +  G   + D+  LCY+  +NW+       Q     PP N+ CD +C S+GCWGPG++MC +C+ F    +CV+RC    G                +G C  CHP CL     Q C GP P  C   C +FK+   CV+ C             KY   N  C  CH+ C +       C+G     GL GCS
Sbjct:  366 NTIAVNSSNIESFRNCTKINGDIVFLKSSFSGDQHYNIPPMDPKKLEYFRTVKEITGHLLIQTWPENMTSLSVFENLEIIRGRSLFVNKYSFVVVGADNLHWLGLRSLKELSAGNVRLKDNKLLCYSKAMNWSYLFRDKTQIVDQTPP-NQTCDQQCSSKGCWGPGTNMCLSCQYFNRKQHCVERCNLLQGEPREVEV---------EGSCVECHPECLVMTGTQTCHGPGPDQC-SQCAHFKDGSHCVRMCPHGVLDDENMLIWKYADQNGQCQLCHQNCSQG------CSGP----GLSGCS 648          

HSP 3 Score: 89.3521 bits (220), Expect = 2.158e-17
Identity = 76/263 (28.90%), Postives = 119/263 (45.25%), Query Frame = 2
Query:  161 NCTHVEGNLVIQNVWPDQESGDLGFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQN-----SLALEKSEVSVYIDLLDEENS--QYAIFPKLRVIANNSVYFKTKVKHKFL---PQSIKWEELFENPKK-QKLITYNKYME--HQCHSDCLRNDFPYCWSSSANHCQKQSKCVKEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNTKL--NPNFKLRVGYMCANSCP 904
            NC+ V  NL I     +Q   DL FL SI EV G + +  N +  + L NL++IRGQN     +L +  +  S  I       S  +     +L  I N  V    KV +  L    + I+W ++ +  +    L+ ++ Y     +C   C+ +    CW++  +HCQK +K V       E C     +G      C++ C  GC GP  +DC  CK + +   C + CPP  +Y+  + ++  NPN K   G  C  +CP
Sbjct:   69 NCSVVLENLEITYTLENQ---DLSFLQSIQEVGGYVLIAMNDVATVPLVNLRLIRGQNLYDKFALLVMSNYHSNNITGAPRYTSGLRQLQLSRLTEILNGGV----KVTNNPLLCNMEKIQWWDIVDKARNFSVLLKFDDYKRDCERCDPGCVNDS---CWAAGPDHCQKFTKLVCA-----EQCGPGRCSGPKPLDCCNQHCAAGCTGPLATDCLACKNFNDDGICKDSCPPLNLYNHKSQQVVENPNAKYSFGATCVKACP 316          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Medaka
Match: egfra (epidermal growth factor receptor [Source:NCBI gene;Acc:101159776])

HSP 1 Score: 255.758 bits (652), Expect = 3.091e-69
Identity = 168/484 (34.71%), Postives = 251/484 (51.86%), Query Frame = 3
Query: 2088 CEKCNGYWSGDRCVKQCFPIALNLPR----NASCPYCNGNCVE---RCTVTPNDPFQCGSC-NFK-RLYLDNHNKSCVSECPQ-------THKYKHKDGNLTDIICMTRSQWLSYQENPKFISKWSLIILSVITVFLIS---SVYIFFRYVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIR-ANRNIDIQEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPND 3479
            C  C  Y  G RCV  C  I    PR    N +C  C+  C       T + + P  C  C NF+  LY       CVS CPQ       T  +K+ D      +C             K     S   LS+I   ++    +V +    V  + +++ +K  + +   + E +    L      PN   L ++  ++       K +G+GAFG VY+G+W P  +D++      + VA+KV+R A      +EI++EA VMASV + H  RL+GICL   +  LIT  +  G L  Y+++ K  + S+ LL+W  QIA GM YLE R ++HRDLA RNVL+     ++ITDFGLA ++   E    E    GG+VPI+W+ALE++L   Y+H++DVWS+G+T+WE+ T+G +PYD +   EI   L +G+RL QP IC++D+Y +M +CW  +A  RP F  L+   +   + P+ YL I  D
Sbjct:  515 CFACRDYSRGGRCVDSCN-ILEGEPREAVMNKTCVECDPECQRMNGTATCSASGPGNCAKCANFQDGLY-------CVSRCPQGVPGEDDTLVWKYADERNVCQLCHKNCTQGCTGPGLKGCHIKSSTGLSMIAAGVVGGLLTVLVTGLSVFVLLRRRYIKRKRTMRRLLQERELVEPLTPSGQAPNQALLRILKESEFK---KIKVLGSGAFGTVYKGLWVPEGEDVK------IPVAIKVLREATSPKANKEILDEAYVMASVENPHVCRLLGICLTSTVQ-LITQLMPYGCLLDYVKEKKDNIGSQHLLNWCVQIAKGMNYLEERHLVHRDLAARNVLVKTPNHVKITDFGLAKLLNADE---KEYHADGGKVPIKWMALESILTRTYTHQSDVWSYGVTVWELMTFGTKPYDGIPASEIAGILEKGDRLPQPPICTIDVYMIMVKCWMIDAESRPRFRELIGEFTKMARDPSRYLVIQGD 977          

HSP 2 Score: 88.5817 bits (218), Expect = 1.366e-36
Identity = 102/363 (28.10%), Postives = 139/363 (38.29%), Query Frame = 3
Query:  900 VQEVDACIYSCNSLHFYRVDN----KCIRCQNSSVCAXXXXXXXXXXXXXXXDVFYMTAAILKNFTDIEHVIGEFHFTAQSFDKALGGITL-PMLYKHLGNVQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIMHTDLEFLGLRKLRRIF-GKFEVHDSPGLCYADTLNWTGNILKNNQFDPI-----YPPC---NKPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRC---EDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQ-----NCTGPRPTNCIGGCRYFKENDECVKNCSR-----------KYFSFNKTCIKCHETCMENDKNQPLCTGESSILGLGGC 1889
            V +  AC+ +C S + Y VD     KC +C     C K    +          +        KN T I   I   H T+   DK      + P        V+ ITG L I      + +L+  +NL+ IR   T+  S ++ I   D+ +LGLR L+ I  G   +  +  LCY +  +W G      Q   +        C   N  CD KC + GCWGPG  MC+ CR +     CVD C   E EP       A+   T       C  C P C +      C+   P NC   C  F++   CV  C +           KY      C  CH+ C +       CTG     GL GC
Sbjct:  294 VTDHGACVRTC-SGNTYEVDEGGIRKCAKCNGP--CPKVCNGLGTGNLTHTLSINATNIDSFKNCTKINGNIAFIH-TSIYGDKFTKTPKMDPAKLDVFKTVKEITGYLWIQTWPKNMSSLSPFENLEIIRGR-TKQGSRSVAITQLDISYLGLRSLKEISDGDVVIIKNHNLCYTNRSHWKGLFKSKTQSANVDENASATACALMNSTCDRKCAADGCWGPGPDMCFACRDYSRGGRCVDSCNILEGEP-----REAVMNKT-------CVECDPECQRMNGTATCSASGPGNC-AKCANFQDGLYCVSRCPQGVPGEDDTLVWKYADERNVCQLCHKNCTQG------CTGP----GLKGC 628          

HSP 3 Score: 86.2705 bits (212), Expect = 1.366e-36
Identity = 73/253 (28.85%), Postives = 112/253 (44.27%), Query Frame = 2
Query:  161 NCTHVEGNLVIQNVWPDQESGDLGFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQNSLALEKSEVSVYIDLLDEENSQYAIFPKLRVIANNSVYFKTKVKHKFLPQSIKWEELFENPKKQKL---ITYNKYMEHQCHSDCLRNDFPYCWSSSANHCQKQSKCVKEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNTKL--NPNFKLRVGYMCANSCP 904
            NCT V  NL I  +     + DL FL SI EV G + +  N+   I L NL++IRG  SL   +  +SV ++      +   +  KL  I    + F          ++I+W ++    KK K+   +  N  +  +CHS C       CW+    +CQ  +K     ++  + C  + + G      C+E C  GC GP+ +DC  C+ + +   C + CP    YD     L  NPN K   G  C  +CP
Sbjct:   52 NCTVVLENLEITYM---DNNHDLSFLKSIEEVGGYVLIALNTATRIPLENLRIIRGH-SLYEGEFALSVLVNSDKGTGTTELLLTKLTEILAGGIKFGNNQLCNV--ETIQWFDIVNPDKKPKMELPMASNNPLCKKCHSSCFNGS---CWAPGPQYCQTLTK-----LNCAQQCSKRCK-GPSPSDCCNEHCAAGCTGPRPTDCLACRDFRDDGVCKDSCPGLMRYDPNLHLLVPNPNGKYSFGATCVKNCP 289          
BLAST of epidermal growth factor receptor 2 vs. Ensembl Medaka
Match: erbb4a (receptor tyrosine-protein kinase erbB-4 [Source:NCBI gene;Acc:101165379])

HSP 1 Score: 246.514 bits (628), Expect = 6.089e-66
Identity = 165/491 (33.60%), Postives = 250/491 (50.92%), Query Frame = 3
Query: 2088 CEKCNGYWSGDRCVKQC--FPIALNLPRNAS-CPYCNGNCVE----RCTVTPNDPFQCGSC-NFKRLYLDNHNKSCVSECPQTHK------YKHKDGNLT----DIICMTRSQWLSYQENPKFISKWSLIILSVITVFLISSVYIFFRYVNKINQKKSVKYLKAIY----SNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIRANRNIDIQ-EIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPNDSCLR 3491
            C  C  +  G  CV+ C  F   +    N S C  C+  C +      T     P QC  C NFK    D  N  CV +CP   +      +K+   N       + C         Q+    + +  LI   +I    I  + I    V    ++KS+K  +A+     + + EP     L    T PN  +L ++  T+L      K +G+GAFG VY+G+W P  + ++      + VA+K++          E M+EA +MASV H H +RL+G+CL   +  L+T  +  G L  Y+ +HK  + S+ LL+W  QIA GM YLE R ++HRDLA RNVL+     I+ITDFGLA ++   E   N     GG++PI+W+ALE +    ++H++DVWS+G+T+WE+ T+G +PYD +  REI   L +G RL QP IC++D+Y +M +CW  +A+ RP F+ L +      + P  YL I  D  ++
Sbjct:  463 CLSCRYFKRGRTCVESCNLFNGEVREFANGSVCLECDSQCEKMDGNSLTCLGQGPDQCVKCLNFK----DGPN--CVEKCPDGLQGANSFIFKYAKANNECHPCHVNCTQGCIGPRIQDCVGMMDRTPLIAAGIIGGLFI--IVIVALTVAIYARRKSIKKKRALRRFLETELVEP-----LTPSGTAPNQAQLRILKETELK---RVKILGSGAFGTVYKGIWVPEGETVK------IPVAIKILNEATGPKANVEFMDEALIMASVEHPHLVRLLGVCLSPTIQ-LVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHIKITDFGLARLLDADEKEYNA---DGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDILEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFCRMARDPQRYLVIQGDDRMK 927          

HSP 2 Score: 99.7525 bits (247), Expect = 1.533e-20
Identity = 75/251 (29.88%), Postives = 116/251 (46.22%), Query Frame = 2
Query:  179 GNLVIQNVWPDQESGDLGFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQNSLALEKSEVSVYIDLLDEENSQYAI----FPKLRVIANNSVYFKTKVKHKFL--PQSIKWEELFENPKKQKLITYNKYMEHQCHSDCLRNDFPYCWSSSANHCQKQSKCV-KEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNTKL--NPNFKLRVGYMCANSCP 904
            GNL I ++     + +L FL SI EVTG + +  N  + + L NL++IRG     L +   ++ I L    +  Y +       L  I N  VY     ++KFL    +I W+++ +NP+ + L+  +    + C   C R+    CW    + CQ  +K V  E+ D    C+     G      C  +C GGC GPK++DC  C  + +   CV  CP  F+Y+  + +L  NP  K   G  C   CP
Sbjct:    2 GNLEITSI---DRNRNLSFLKSIREVTGYVLVALNQFEYLPLENLRIIRGT---TLYEGRYALAIFLNYRRDGNYGLKQLGLRSLTEILNGGVYVD---QNKFLCHADTIHWQDVIKNPQAELLVVPSNNSNNGCRR-CHRSCNGRCWGHQEDQCQTLTKTVCAEQCDG--RCF-----GPYVSDCCHRECAGGCFGPKDTDCFACTNFNDSGACVTQCPQPFVYNPTSFQLEHNPRAKYTYGAFCVRECP 235          

HSP 3 Score: 69.707 bits (169), Expect = 2.129e-11
Identity = 64/244 (26.23%), Postives = 97/244 (39.75%), Query Frame = 3
Query: 1188 VQYITGDLIIDGSNIVLKNLTFLQNLKEI--RHLLTQSASAALNIMHTDLEFLGLRKLRRI-FGKFEVHDSPGLCYADTLNWTG-------NILKNNQFDPIYPPCNKP---CDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQ------NCTGPRPTNCIGGCRYFKENDECVKNCSR----------KYFSFNKTCIKCHETCMEN 1832
            V+ ITG L I      + +L+   NL  I  R L + S  + L +    +     + L  I  G   + ++  LC+ +T+NWT         +L  N  +P+   C +    CD  C   GCWGPG   C +CR F+    CV+ C    G       ++++ +     +C  C   C +       C G  P  C+  C  FK+   CV+ C            KY   N  C  CH  C + 
Sbjct:  336 VKEITGFLNIQSWPENMTDLSVFSNLVTIGGRSLYSGSGISLLILKQRRISSFQFQSLNEISAGNVYIFNNSRLCFYNTINWTSLFRTPSQKVLIRNNREPME--CLQQQMICDRMCSEDGCWGPGPDQCLSCRYFKRGRTCVESCNLFNG------EVREFANG---SVCLECDSQCEKMDGNSLTCLGQGPDQCV-KCLNFKDGPNCVEKCPDGLQGANSFIFKYAKANNECHPCHVNCTQG 567          

HSP 4 Score: 56.9954 bits (136), Expect = 1.412e-7
Identity = 77/330 (23.33%), Postives = 121/330 (36.67%), Query Frame = 3
Query: 1254 LQNLKEIRHLLTQSASAALNIM-------HTDLEFLGLRKLRRIF-GKFEVHDSPGLCYADTLNWTGNILKNNQFDPIYPPCN------KPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIGGCRYFKENDECVKNCSRKYFSFNKTCIKCHETCMENDKNQPLCTGESSILGLGGCSYCSKLIHKRDEKFYCYKDPCPRHYYLNKIDISEVMKRQKSKEIGICQPCLEPCLECSGNYTIYPTCEKCNGYWSGDRCVKQCFPIALNLPRNASCPYCNGNCV 2201
            L+NL+ IR         AL I        +  L+ LGLR L  I  G   V  +  LC+ADT++W  +++KN Q + +  P N      + C   C+ + CWG     C           C  RC                   +   +   CH  C   C GP+ T+C   C  F ++  CV  C +  F +N T  +     +E++       G          ++C   + +    F      C R    NK+++ E         I +C PC + C +             C+G  +G     Q    A N+ +  +C   NGN +
Sbjct:   40 LENLRIIRGTTLYEGRYALAIFLNYRRDGNYGLKQLGLRSLTEILNGGVYVDQNKFLCHADTIHWQ-DVIKNPQAELLVVPSNNSNNGCRRCHRSCNGR-CWGHQEDQCQTLTKTVCAEQCDGRC-------------------FGPYVSDCCHRECAGGCFGPKDTDCF-ACTNFNDSGACVTQCPQP-FVYNPTSFQ-----LEHNPRAKYTYG----------AFC---VRECPHNFVVDHSSCVRACPSNKMEVEE-------NRIKMCIPCTDICPKV------------CDGIGTGSLQTAQTVD-ASNIDKFVNCTKINGNLI 308          

HSP 5 Score: 54.299 bits (129), Expect = 1.091e-6
Identity = 32/85 (37.65%), Postives = 41/85 (48.24%), Query Frame = 3
Query: 1485 CDSKCD-----SQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIG 1724
            CDS+C+     S  C G G   C  C  F+   NCV++C D  G     S I KY    ++  C  CH  C Q C GPR  +C+G
Sbjct:  498 CDSQCEKMDGNSLTCLGQGPDQCVKCLNFKDGPNCVEKCPD--GLQGANSFIFKYAKANNE--CHPCHVNCTQGCIGPRIQDCVG 578          
BLAST of epidermal growth factor receptor 2 vs. Planmine SMEST
Match: SMESG000004200.1 (SMESG000004200.1)

HSP 1 Score: 936.791 bits (2420), Expect = 0.000e+0
Identity = 465/471 (98.73%), Postives = 468/471 (99.36%), Query Frame = 3
Query:  900 VQEVDACIYSCNSLHFYRVDNKCIRCQNSSVCAXXXXXXXXXXXXXXXDVFYMTAAILKNFTDIEHVIGEFHFTAQSFDKALGGITLPMLYKHLGNVQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIMHTDLEFLGLRKLRRIFGKFEVHDSPGLCYADTLNWTGNILKNNQFDPIYPPCNKPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIGGCRYFKENDECVKNCSRKYFSFNKTCIKCHETCMENDKNQPLCTGESSILGLGGCSYCSKLIHKRDEKFYCYKDPCPRHYYLNKIDISEVMKRQKSKEIGICQPCLEPCLECSGNYTIYPTCEKCNGYWSGDRCVKQCFPIALNLPRNASCPYCNGNCVERCTVTPNDPFQCGSCNFKRLYLDNHNKS--CVSECP 2306
            +QEVDACIYSCNSLHFYRVDNKCIRCQNSSVCAKKEFNINKIINEENEDVFYMTAAILKNFTDIEHVIGEFHFTAQSFDKALGGITLPMLYKHLGNVQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIMHTDLEFLGLRKLRRIFGKFEVHDSPGLCYADTLNWTGNILKNNQFDPIYPPCNKPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIGGCRYFKENDECVKNCSRKYFSFNKTCIKCHETCMENDKNQPLCTGESSILGLGGCSYCSKLIHKRDEKFYCYKDPCPRHYYL+KIDISEVMKRQKSKEIGICQPCLEPCLECSGNYTIYPTCEKCNGYWSGDRCVKQCFPIALNLPRNASCPYCNGNC+ERCTVTPNDPFQCGSCNFKRLYL NHNKS  CVSECP
Sbjct:  298 LQEVDACIYSCNSLHFYRVDNKCIRCQNSSVCAKKEFNINKIINEENEDVFYMTAAILKNFTDIEHVIGEFHFTAQSFDKALGGITLPMLYKHLGNVQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIMHTDLEFLGLRKLRRIFGKFEVHDSPGLCYADTLNWTGNILKNNQFDPIYPPCNKPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIGGCRYFKENDECVKNCSRKYFSFNKTCIKCHETCMENDKNQPLCTGESSILGLGGCSYCSKLIHKRDEKFYCYKDPCPRHYYLDKIDISEVMKRQKSKEIGICQPCLEPCLECSGNYTIYPTCEKCNGYWSGDRCVKQCFPIALNLPRNASCPYCNGNCIERCTVTPNDPFQCGSCNFKRLYLHNHNKSFQCVSECP 768          

HSP 2 Score: 587.03 bits (1512), Expect = 0.000e+0
Identity = 292/294 (99.32%), Postives = 294/294 (100.00%), Query Frame = 2
Query:   23 MGFVCNXXXXXXXXESSLAIRQFDEEYPGVTICESSMTSGELGGNHNCTHVEGNLVIQNVWPDQESGDLGFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQNSLALEKSEVSVYIDLLDEENSQYAIFPKLRVIANNSVYFKTKVKHKFLPQSIKWEELFENPKKQKLITYNKYMEHQCHSDCLRNDFPYCWSSSANHCQKQSKCVKEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNTKLNPNFKLRVGYMCANSCP 904
            MGFVCNIIVVIILLESSLAIRQFDEEYPGVTICESSMTSGELGGNHNCTHVEGNLVIQNVWPDQESGDLGFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQNSLA+EKSEVSVYIDLLDEENSQYAIFPKLRVI+NNSVYFKTKVKHKFLPQSIKWEELFENPKKQKLITYNKYMEHQCHSDCLRNDFPYCWSSSANHCQKQSKCVKEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNTKLNPNFKLRVGYMCANSCP
Sbjct:    1 MGFVCNIIVVIILLESSLAIRQFDEEYPGVTICESSMTSGELGGNHNCTHVEGNLVIQNVWPDQESGDLGFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQNSLAIEKSEVSVYIDLLDEENSQYAIFPKLRVISNNSVYFKTKVKHKFLPQSIKWEELFENPKKQKLITYNKYMEHQCHSDCLRNDFPYCWSSSANHCQKQSKCVKEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNTKLNPNFKLRVGYMCANSCP 294          
BLAST of epidermal growth factor receptor 2 vs. Planmine SMEST
Match: SMESG000004201.1 (SMESG000004201.1)

HSP 1 Score: 735.717 bits (1898), Expect = 0.000e+0
Identity = 352/352 (100.00%), Postives = 352/352 (100.00%), Query Frame = 3
Query: 2793 MEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPNDSCLRPMKKDKHRLLSQISYDFQVYPKLNNIYKQHSLDGTISTFVGDYQDDIEGEPSLKRQSSGFSWSSKQTRSSQEIDKRLFYFRQHSAVSEDLEENDNFCRSDEQEESDSEYLEPKKIENFK 3848
            MEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPNDSCLRPMKKDKHRLLSQISYDFQVYPKLNNIYKQHSLDGTISTFVGDYQDDIEGEPSLKRQSSGFSWSSKQTRSSQEIDKRLFYFRQHSAVSEDLEENDNFCRSDEQEESDSEYLEPKKIENFK
Sbjct:    1 MEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPNDSCLRPMKKDKHRLLSQISYDFQVYPKLNNIYKQHSLDGTISTFVGDYQDDIEGEPSLKRQSSGFSWSSKQTRSSQEIDKRLFYFRQHSAVSEDLEENDNFCRSDEQEESDSEYLEPKKIENFK 352          
BLAST of epidermal growth factor receptor 2 vs. Planmine SMEST
Match: SMESG000016935.1 (SMESG000016935.1)

HSP 1 Score: 643.269 bits (1658), Expect = 0.000e+0
Identity = 368/922 (39.91%), Postives = 532/922 (57.70%), Query Frame = 3
Query:  885 CARIRVQEVDACIYSCNSLHFYRVDNKCIRCQNSSVCAXXXXXXXXXXXXXXXDVFY--------MTAAILKNFTDIEHVIGEFHFTAQSFDKALGGITLPMLYKHLGNVQYITGDLIIDGSNIVLKNLTFLQNLKEIR-HLLTQSASAALNIMHTDLEFLGLRKLRRIFGKFEVHDSPGLCYADTLNWTGNILKNNQFDPIYPPCNKPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIGGCRYFKENDECVKNCSRKYFSFNK------TCIKCHETCMENDK---NQPLCTGESSILGLGGCSYCSKLIHKRDEKFYCYKDPCPRHYYLNKIDISEVMKRQKSKEIGICQPCLEPCLECSGNYTIYPTCEKCNGYWSGDRCVKQC---FPIALNLPRNASCPYCNGNCVERCTVTPNDPFQCGSCNFKRLYLDN-HNK-SCVSECPQTHKY-KHKDGNLTDIICMTRSQWLSYQENPKFISKWSLIILSV---ITVFLISSVYIFFRYVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKT-IPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSNKDLEKSDRDSLDVAVKVIRANRNIDIQEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPNDSCLRPMKKDKHRL----LSQISYDFQVYP 3554
            C    + +   C+Y C+     ++ N+CI C N +          K+ N    D FY        +    L   T+   ++G+      SF+K   G+T+PMLY HL NV+ I G   +      + NLTFL NL+EIR  + + + ++A+NI    +EFLGL+KL++++GK  +  + G CY D + W   I  +N+   +   CNK CD  C  Q CWGPG+ MCY+C  ++A  +CV +C D PG++ + +  K          CQ CHPLC QNCTGP P NC G CRY  E + CVKNCS  +F          TC  CH +C  +         CTG S+ILG GGCS C KLI   + ++ C+K  CP+ +Y + I+ +     +K      C+PC   C  CSG       C +C GY+  ++CVK+C     + + L     CP C+  C   C +  ND   C  C   +L++D+  NK SCV+ CP    + +++DG   D IC+   + ++ ++      K   IILS      VF+I    ++FR+  + NQ + +  +KA+YSN  EPD + + ++  T  PNM R+ +IP +DL+F+ ++KP+G+GAFG VYRG WK   +D   +   +L+V +KVI  +      E +EEAK+MASV H+HCL LIG+CL  E PCL++T+ + GSLDKYL+++   + S ++L W +QIADGM YL  RGIIHRDLA RNVL+ND + IQITDFGLA +V  T+D+   IVI  G+VPIRWLA+ETLL+  YS  TDVW++G+TLWEIFTY +RPY+EL   EI S+L QGNRL QPEI ++++Y +M +CW ++ + RPSF  L+ST   F Q P  +L +P++   +   KD+ +     L+QIS D    P
Sbjct:  310 CPASLLDQNKICVYECDFDAHQKIGNRCIECPNGN--CNSSTAGYKLCNLATIDKFYPKNNRKYSLNKQTLMQLTNCTLILGDLDIDDISFNK--NGVTVPMLYHHLKNVREIIGLFSLVTFRTKISNLTFLSNLEEIRLSVKSHTVASAMNIHGKYIEFLGLKKLKKVYGKISIGGTNGTCYLDRIPWE-EISPDNR---VKFSCNKTCDPLCTGQ-CWGPGNEMCYSCAYYKAGNSCVKQCSDSPGYFASQTEFKTIK-------CQTCHPLCRQNCTGPTPKNCGGQCRYAIEENTCVKNCSIDFFPVANNVNAPITCQLCHSSCFVDKTLVGTNHACTGPSNILGTGGCSKCEKLIKTSNNQYLCHKGSCPKGFYQSVINQNISHLHKKIVHQSSCEPCHSMCRTCSGPTNEKRMCHQCKGYFLDNKCVKECDNMKNVTMKLEIGDECPQCHKECRNGCLLA-NDSTACTRCLNHKLFVDDDKNKFSCVTRCPHDRNFTEYQDG---DFICLKFEETINSKQR-----KTIFIILSGCFGFLVFIIGFCVLYFRW--RANQTRILAEIKALYSNFKEPDMKNMKEDYITRPPNMRRMQMIPISDLVFDTSSKPLGSGAFGKVYRGYWKVPRQD---NKYINLEVVIKVIHNSSKGSTDEFLEEAKIMASVSHRHCLPLIGVCLSLEKPCLVSTYAQHGSLDKYLQQNSKKISSHSMLKWAKQIADGMAYLNKRGIIHRDLAARNVLVNDDDNIQITDFGLARLVDETDDS---IVIKSGKVPIRWLAIETLLSATYSPATDVWAYGVTLWEIFTYAKRPYEELATGEIKSFLQQGNRLCQPEISTLEVYMVMIKCWLDDPHMRPSFMELVSTFEQFIQSPKRFLYMPHEYVNQQYPKDEDQREMIQLNQISIDSDFRP 1198          

HSP 2 Score: 137.117 bits (344), Expect = 0.000e+0
Identity = 100/312 (32.05%), Postives = 149/312 (47.76%), Query Frame = 2
Query:   89 FDEEYPGVTICESSMTSGE--------------LGGNHNCTHVEGNLVIQNV--WPDQESGDLGFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQN--------SLALEKSEVSVYIDLLDEENSQYAIFPKLRVIANNSVYFKTKVKHKFLPQSIKWEELFENPKKQKL----ITYNKYMEHQCHSDC--------LRNDFPYCWSSSANHCQKQSKCVKEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNTKLNPNFKLR--VGYMCANSCPGS 910
            F+ +YP   IC  S   G               LG    CTH+ GNL I ++  + +    DL FL SIIE++G + + NN +K I L NLKVIRG          ++    SE   +++ +D  N        LR I + +V        ++L +++ W ++ ++P  QKL             +CH++C        +R+ F  C+  S N CQKQ+KCVK K  +++WC F  + GEI    C  +C GGC+G  + DC VC K V  + CV  C P   +  G   ++   KLR  VG +C + CP S
Sbjct:   21 FNPDYPNFRICVVSEAHGSFKTPAEAYKYLKYTLGLGQRCTHIYGNLPISDLSRFKNGSDPDLSFLESIIEISGSLSIINNDVKRIPLTNLKVIRGVTLRNEPDALNIIHNHSENGTFLEEIDLRN--------LRAIMSKNVIISQNPGLEYLEKNLDWSQILDDPTTQKLKVSEFVRPSNGTAKCHTECEYWTGEDGVRSQF--CFGPSKNECQKQTKCVKNK--DLKWCKF-TKTGEIP---CSHECAGGCDGRTSKDCTVCNKLVKDSDCVSSCAPRPNHIFG---MDSKDKLRYTVGGLCTSQCPAS 313          
BLAST of epidermal growth factor receptor 2 vs. Planmine SMEST
Match: SMESG000005947.1 (SMESG000005947.1)

HSP 1 Score: 548.895 bits (1413), Expect = 0.000e+0
Identity = 339/897 (37.79%), Postives = 485/897 (54.07%), Query Frame = 3
Query:  885 CARIRVQEVDACIYSCNSLHFYRVDNKCIRCQNSSVCAXXXXXXXXXXXXXXXDV---FYMTAAILKNFTDIEHVIGEFHFTAQSFDKALGGITLPMLYKHLGNVQYITGDLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIMH------TDLEFLGLRKLRRIFGKFEVHDSPGLCYADTLNWTGNILKNNQFDPIYPPCN---KPCDSKCDSQGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYT--NTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIGGCRYFKENDECVKNCSRKYF---SFNKTCIKCHETCMENDKNQPLCTGESSILGLGGCSYCSKLIHKRDEKFYCYKDPCPRHYYLNKIDISEVMKRQKSKEIGICQPCLEPCLECSGNYTIYPTCEKCNGYWSGDRCVKQCFPIALNLPRNAS-----------CPYCNGNCVERCTVTPNDPFQCGSCNFKRLYLDNHNKSCVSECPQTHKYKHKDGNLTDIICMTRSQWLSYQENPKFISKWSLIILSVITVFLISSVYIFFRYVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWK-PSNKD--LEKSDRD-SLDVAVKVIRANRNIDIQEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPND 3479
            C  + + E   C++ C+  +F    N CI+C   ++C       N      + D    FY+ A  L    + + ++G    T  SF K    IT+ MLY++L  +Q + G       N  LKNLTFL+NL   R     S    L   H      T+LEFLGL+ L+ I G F    +  LCY   +N   N L  N  +  Y P N   K C   C  +GCWGPG+ +CY CR + A   CV  C  + GFY   N+S +           C RCHP CL  C GP P  CI GC+  +EN  CV +CS+ ++   + +K C+ CH  C E   N  +CTG SS+ G+GGC+ C +++  R          C    Y    D  ++ +         C PC E C +C G       CE C G W  + C  +C       P++ S           C  C+ +C + C  +    F C  C  K++YLD     C   CP     +  +    DI+C++  +  +  E  K       ++++++ + +I  V I      K   ++    LKA YSN+ EP+S+      K  PNM RL+++   DLIF   +KP+G GAFG VY+G WK P N++  L+K+  D  L VA+KVI+   N +I+ +M+EAK+MASV H HCLR IG+CL YE PCLI+ +V+ GSLDK+L ++K+ + S  +LSW EQIADGM YL  R IIHRDLA RNVL++ LE +QITDFGL+ +++ T+D   EI+I  G+VPIRWLA+ETL +G YSH+TDVW+FG+TLWEIFT+G+ PY++    +I  ++++G RL+QP+ICS+D+Y +M  CW E+ N RP F+ LM T + + + P  YL+I  D
Sbjct:  313 CPAMMLPENTGCVHKCSEGYFKNKSNHCIKCY-GNMCTNDHLPCNLFKIAGHTDGANDFYLRAQDLVQLKNCKKILGYIVLTEDSFVKH--NITVEMLYENLNKLQELEGGFSYFKDN-HLKNLTFLRNLLRFRAAYLHSDIPNLPSYHKFAISETELEFLGLKSLKEINGPFRFFKNQKLCY---MNIPVNELFKNVKNFYYIPSNCTDKICHKDCSEKGCWGPGNKLCYECRKYDAAGTCVSDCSQKKGFYNPINSSLLSNQK-------CLRCHPECLNTCVGPNPNQCIKGCKNKRENGTCVASCSKNFYPPLNDSKACLPCHPNCSE--YNSTICTGPSSVPGIGGCNKCERILLSRKADIVSCVKTCHEGTYAFPNDRPDISRFYPVTGF-TCLPCPELCSKCKGKSPKNDECEVCKGVWHKNTCRLRC-------PKDESYGTKIIDSISYCKTCHSSC-KGCYGS--TIFNCTRCKNKKIYLDKKKFYCNDTCPPLKSVEEIEKGSGDIVCLSLWESKAKLEETKRTHITVGVVVTMLILVIIVIVTIVVYLKRKAIAERIETELKARYSNLTEPNSKDEDLLSKP-PNMGRLMIVSKEDLIFEDESKPLGFGAFGYVYKGKWKIPKNEETLLKKASGDFYLPVAIKVIKNMGNEEIESVMQEAKMMASVSHMHCLRFIGVCLSYEKPCLISAYVKEGSLDKFLIRNKNKITSLIMLSWSEQIADGMLYLTKRNIIHRDLAARNVLVSRLECVQITDFGLSKMLESTKD--KEIIIKTGKVPIRWLAIETLTDGKYSHETDVWAFGVTLWEIFTFGKVPYEDQATHDIFDFVLKGGRLSQPDICSLDVYIIMVNCWLESPNLRPDFQNLMQTFTDYCKNPGRYLSIQGD 1179          

HSP 2 Score: 148.288 bits (373), Expect = 0.000e+0
Identity = 99/297 (33.33%), Postives = 149/297 (50.17%), Query Frame = 2
Query:   89 FDEEYPGVTIC-------ESSMTSGE------LGGNHNCTHVEGNLVIQNVWP-DQESGDLGFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQNSLA---LEKSEVSVYIDLLDEENSQYAIFPKLRVIANNSVYFKTKVKHKFLPQSIKWEELFENPKKQKL----ITYNKYMEHQCHSDC-LRNDFP--YCWSSSANHCQKQSKCVKEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNTKLNPNFKLRVGYMCANSCPG 907
            F+EEYPG  IC       ES  +S E      +  + NCTH++G++ I  +   + +  +L F  SI E+ G + ++ N ++ I   NL++IRG NS+    ++K      + +    +     F  LR I  ++V F +  K K+LP SIKW ELF +PK Q L    +T +  +  +C   C L  +F   +CW  SAN CQ+Q+ C  +       C +   NGE ++G C++QC GGCNG   S C  CK  +N   CVE C   +    G T  N  F+   G+ C+  CP 
Sbjct:   23 FEEEYPGTIICQNDNVQIESLHSSVEKLKILSIIRSKNCTHIQGSIYILGITKLESKERELNF-DSIEEIDGHLIIEGNDLEKITFKNLRIIRGANSIKRNLIDKGHTDFSLVVSGNAHLVDLDFRSLRSINAHNVIFDSNPKMKYLPHSIKWNELFTDPKAQILFSPTVTKDLILRDKCSDQCKLWANFTQVFCWGPSANQCQQQTLCGSKYSSECTTCRYI--NGE-EQGCCNDQCLGGCNGGGASKCTACKNMLNKKKCVELCRGPYSGGIGGTITNKEFRYHAGFFCSKQCPA 315          
BLAST of epidermal growth factor receptor 2 vs. Planmine SMEST
Match: SMESG000070834.1 (SMESG000070834.1)

HSP 1 Score: 476.863 bits (1226), Expect = 1.139e-145
Identity = 306/823 (37.18%), Postives = 441/823 (53.58%), Query Frame = 3
Query: 1173 KHLGNVQYITGDLIIDGSNIVLK--NLTFLQNLKEIRHLLTQSASAALNIMHTDLEFLGLRKLRRIFGK------------FEVHDSPGLCYADTLNWTGNILKNNQFDP-IYPPCNKPCDSKCDSQ-GCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDGICQRCHPLCLQNCTGPRPTNCIGGCRYFKENDECVKNCSRKYF--SFNKTCIKCHETCMENDKNQ-PLCTGESSILGLGGCSYCSKLIHKRDEKF-YCYKDPCPRHYY-LNKIDISEV----MKRQKSKEIGICQPCLEPCLEC--------SGNYTIYPTCEKCNGYWSGDRCVKQCFPIALNLPRNASC----------PYCNGNCVERCTVTPNDPFQCGSCNFKRLYLDNHNK---SCVSECPQTHKYKHKDGNLTDIICMTRSQWLSYQENPKFISKW--SLIILSVITVFLISSVY-IFFRYVNKINQKKSVKYLKAIYSNIHEPDSRIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWK------PSNKDLEKSDRDSLDVAVKVIRANRNIDIQEIMEEAKVMASVCHKHCLRLIGICLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLEIRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQVPIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSYLIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPTCYLNIPN 3476
            K L N++ I+G + ID  +   K  +L+FL NL+ I  L+    S +L I++T++ +LGL+ L+ I  K            F++     +   DTLN    I  N   DP +       C  +CDSQ GCWGPG + C +C   R    C + C  +PG+ TN  +  K        +C +CH  C + C+G R   CIGGC++  EN  CV+ CSR +F     KTC  CH+ C      + P+CTG S+  G GGC+ C  +I +RD +   CY++     Y+ LN  + +         + +  I I +PC + C +C        S + T +  C +C GYW  D+CV  C  +   L  + +           P CNG     C    N+   C  CN  +L  +N N    SCV  CP    YK   GN  + IC+             F+S W  +L+IL+V+ +F+I +++ I  ++ +  N K+    LKA +SN  E DS+       + PNMN LL+I + +L F +  + +G G FG+VY G WK        N  +       +DV +KV+  N + D  E M+E ++MASV HKHCLRLIG+  K     LI++++ LGS++KYL K+K +L  + LL W EQIA+GM YLE   IIHRDLATRNVL+     +QITDFGL+ I+     NK+E+ I GG VP+RWLA+ETL +GIYSHKTDVW++ +TLWEIFT+   PY+ L   EI   +I+G RL QP+ICS+D+Y LM +CW  +  +RP+FE L +    +      YL+ PN
Sbjct:  420 KFLENLRNISGSVYIDLKDAPFKLDSLSFLSNLQAIESLVP-IISTSLTIINTNISYLGLKSLKTIKNKAIFFKNNTKLCYFDIKKFKNIVKTDTLNDVTIISDNGMADPKLCEQRGNVCSVQCDSQLGCWGPGPNHCISCANVRLGTICAENCLVQPGYLTNPDSTSK--------VCLKCHDECAKTCSGLRSDQCIGGCKHAMENSMCVRECSRTHFLNKITKTCEPCHKDCHSRSITRLPVCTGPSNTPGPGGCNKCQSMILRRDYQVERCYQNTSLNGYFSLNHPNTNSSPHSNFIEKFTDLIVILEPCHDLCSQCTIGTDQRISLSKTDWKGCTQCKGYWFDDKCVSICPKVRTFLKADETNSSLGKCHPCHPQCNG-----CYGVDNN--HCIHCNNFKL-PENENLTLFSCVESCPSN--YKETSGNSNENICVFV-----------FLSGWELALVILAVVFIFVIITLFTIITKFCHARNGKRKRDKLKAYFSNAKESDSQT-----PSPPNMNHLLVISSDNLEFIMGGEILGKGTFGSVYAGKWKLDNGCFDDNSSMNSCKDSKVDVVIKVL--NHSCDQNEFMDEVRIMASVRHKHCLRLIGVSYKGSEKLLISSYMPLGSMEKYLEKNKKSLTGKILLKWAEQIANGMLYLENNHIIHRDLATRNVLIYKENHVQITDFGLSKIIN---PNKDEMQIFGGMVPVRWLAIETLRDGIYSHKTDVWAYAVTLWEIFTFATVPYEFLKAHEIRDEIIKGTRLRQPDICSLDIYILMLKCWSVDPEERPNFEYLWTEFKNYSNNSETYLSYPN 1202          

HSP 2 Score: 122.094 bits (305), Expect = 1.551e-27
Identity = 93/294 (31.63%), Postives = 137/294 (46.60%), Query Frame = 2
Query:   98 EYPGVTICESSM--TSGELGGNHN---------CTHVEGNLVIQNVWPDQESG--DLGFLSSIIEVTGMIFMKNNSIKDIILPNLKVIRGQNSL-------ALEKS-EVSVYIDLLDEENSQYAI-FPKLRVIANNSVYFKTKVKHKFLPQSIKWEELFENPKKQKLITYNKYMEHQCHSDCL-RNDFPYCWSSSANHCQKQSKCVKEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGPKNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNTKLNPNFKLRVGY--MCANSCP 904
            EYP +  C SSM    G    N+N         CTHV GN+ I NV  +      DL FLS I E+TG + ++N++I  + L NL+VIRG + L       AL+ S EVS+  D+    + +  I    LR I + ++Y  ++        +++W EL E+P +Q +         +C   C+ +    +CW    + CQ  SKC K    N   C+        DE  C+ QC GGC    +S C  C+  ++ N C   CPP+ I +R      PN   R  +  +C N CP
Sbjct:   37 EYPEIKYCFSSMDLLDGSQSSNYNTLKQDLGNNCTHVYGNIFINNVKSESNGSEPDLEFLSGIKEITGSLKIRNSNISSVPLRNLRVIRGDSRLYTHDSMGALQNSFEVSIDQDISVSNSIKTVIDLRSLRSIVSGNIYISSQFCSSL--ANVEWNELLEDPTRQSVTGKCTPQPTKCSKKCMQKGKSGFCWGPLTSQCQIFSKCRKRMCAN--RCFLSETG---DEECCNSQCLGGCTSSDSSSCIACQGVLDNNVCQPECPPKKIINRETGIPEPNKYFRPLFVNICLNKCP 323          
The following BLAST results are available for this feature:
BLAST of epidermal growth factor receptor 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EGFR3.113e-6733.88epidermal growth factor receptor [Source:HGNC Symb... [more]
EGFR3.314e-6733.88epidermal growth factor receptor [Source:HGNC Symb... [more]
EGFR4.696e-6733.88epidermal growth factor receptor [Source:HGNC Symb... [more]
ERBB41.135e-6636.44erb-b2 receptor tyrosine kinase 4 [Source:HGNC Sym... [more]
ERBB41.342e-6636.44erb-b2 receptor tyrosine kinase 4 [Source:HGNC Sym... [more]
back to top
BLAST of epidermal growth factor receptor 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
let-232.235e-11128.02Receptor tyrosine-protein kinase let-23 [Source:U... [more]
let-232.728e-11128.02Receptor tyrosine-protein kinase let-23 [Source:U... [more]
let-232.891e-11128.02Receptor tyrosine-protein kinase let-23 [Source:U... [more]
let-232.915e-11128.02Receptor tyrosine-protein kinase let-23 [Source:U... [more]
R151.18.022e-5138.81pep chromosome:WBcel235:III:7218813:7221186:1 gene... [more]
back to top
BLAST of epidermal growth factor receptor 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Egfr6.500e-9728.79gene:FBgn0003731 transcript:FBtr0071653[more]
Egfr1.191e-9628.98gene:FBgn0003731 transcript:FBtr0071654[more]
Abl3.399e-4836.84gene:FBgn0000017 transcript:FBtr0330130[more]
Abl3.631e-4836.84gene:FBgn0000017 transcript:FBtr0330135[more]
Abl3.634e-4836.84gene:FBgn0000017 transcript:FBtr0330131[more]
back to top
BLAST of epidermal growth factor receptor 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-383l1.13.638e-6739.68si:ch73-383l1.1 [Source:ZFIN;Acc:ZDB-GENE-121214-6... [more]
si:ch73-383l1.16.466e-6636.31si:ch73-383l1.1 [Source:ZFIN;Acc:ZDB-GENE-121214-6... [more]
egfra1.240e-6542.14epidermal growth factor receptor a (erythroblastic... [more]
erbb4a6.307e-6531.85erb-b2 receptor tyrosine kinase 4a [Source:ZFIN;Ac... [more]
erbb4a1.562e-6431.85erb-b2 receptor tyrosine kinase 4a [Source:ZFIN;Ac... [more]
back to top
BLAST of epidermal growth factor receptor 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gnb57.225e-7133.02guanine nucleotide binding protein (G protein), be... [more]
gnb58.216e-7128.37guanine nucleotide binding protein (G protein), be... [more]
gnb58.803e-7133.72guanine nucleotide binding protein (G protein), be... [more]
gnb51.077e-7033.72guanine nucleotide binding protein (G protein), be... [more]
gnb51.545e-7032.89guanine nucleotide binding protein (G protein), be... [more]
back to top
BLAST of epidermal growth factor receptor 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Egfr2.040e-7034.15epidermal growth factor receptor [Source:MGI Symbo... [more]
Erbb21.939e-6733.81erb-b2 receptor tyrosine kinase 2 [Source:MGI Symb... [more]
Erbb41.042e-6636.17erb-b2 receptor tyrosine kinase 4 [Source:MGI Symb... [more]
Erbb41.241e-6636.17erb-b2 receptor tyrosine kinase 4 [Source:MGI Symb... [more]
Erbb36.948e-5833.88erb-b2 receptor tyrosine kinase 3 [Source:MGI Symb... [more]
back to top
BLAST of epidermal growth factor receptor 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P24348|LET23_CAEEL2.869e-11028.02Receptor tyrosine-protein kinase let-23 OS=Caenorh... [more]
sp|P0CY46|EGFR_APIME3.481e-11030.35Epidermal growth factor receptor OS=Apis mellifera... [more]
sp|P04412|EGFR_DROME8.011e-9528.86Epidermal growth factor receptor OS=Drosophila mel... [more]
sp|P11273|ERBB_AVIEU5.329e-7039.94Tyrosine-protein kinase transforming protein erbB ... [more]
sp|P00535|ERBB_AVIER7.795e-7039.09Tyrosine-protein kinase transforming protein erbB ... [more]
back to top
BLAST of epidermal growth factor receptor 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1B1ACY20.000e+099.70Receptor protein-tyrosine kinase OS=Schmidtea medi... [more]
F6KBQ40.000e+099.08Epidermal growth factor receptor 2 (Fragment) OS=S... [more]
A0A1B1ACX90.000e+039.80Receptor protein-tyrosine kinase OS=Schmidtea medi... [more]
A0A1B1ACY50.000e+037.79Receptor protein-tyrosine kinase OS=Schmidtea medi... [more]
F6KBQ34.510e-16841.80Receptor protein-tyrosine kinase (Fragment) OS=Sch... [more]
back to top
BLAST of epidermal growth factor receptor 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000002946.25.522e-6933.06pep primary_assembly:Astyanax_mexicanus-2.0:12:281... [more]
egfra6.837e-6938.03epidermal growth factor receptor-like [Source:NCBI... [more]
egfra8.094e-6938.03epidermal growth factor receptor-like [Source:NCBI... [more]
ENSAMXT00000013634.21.308e-6733.61receptor tyrosine-protein kinase erbB-4 [Source:NC... [more]
ENSAMXT00000030092.14.396e-6733.27receptor tyrosine-protein kinase erbB-4 [Source:NC... [more]
back to top
BLAST of epidermal growth factor receptor 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003172.13.235e-7032.31pep scaffold:Pmarinus_7.0:GL476855:1052:76454:1 ge... [more]
EGFR5.105e-5228.66epidermal growth factor receptor [Source:HGNC Symb... [more]
ENSPMAT00000005822.11.440e-4843.78pep scaffold:Pmarinus_7.0:GL476959:64997:68848:-1 ... [more]
frk1.545e-4836.36fyn-related Src family tyrosine kinase [Source:ZFI... [more]
fgfr21.729e-4736.07fibroblast growth factor receptor 2 [Source:NCBI g... [more]
back to top
BLAST of epidermal growth factor receptor 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CDC156.561e-2126.36Protein kinase of the Mitotic Exit Network; locali... [more]
SKM11.071e-1728.33Member of the PAK family of serine/threonine prote... [more]
STE205.392e-1628.73Cdc42p-activated signal transducing kinase; involv... [more]
CLA42.695e-1527.44Cdc42p-activated signal transducing kinase; member... [more]
BCK12.006e-1425.09MAPKKK acting in the protein kinase C signaling pa... [more]
back to top
BLAST of epidermal growth factor receptor 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO471957.829e-5237.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470942.114e-4635.82Predicted protein; Vascular endothelial growth fac... [more]
EDO470975.627e-4633.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337366.140e-4535.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO312986.784e-4537.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of epidermal growth factor receptor 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egfra5.106e-7135.42epidermal growth factor receptor [Source:NCBI gene... [more]
ENSORLT00000004471.22.111e-7038.61melanoma receptor tyrosine-protein kinase [Source:... [more]
ENSORLT00000004469.22.125e-7038.61melanoma receptor tyrosine-protein kinase [Source:... [more]
egfra3.091e-6934.71epidermal growth factor receptor [Source:NCBI gene... [more]
erbb4a6.089e-6633.60receptor tyrosine-protein kinase erbB-4 [Source:NC... [more]
back to top
BLAST of epidermal growth factor receptor 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000004200.10.000e+098.73SMESG000004200.1[more]
SMESG000004201.10.000e+0100.00SMESG000004201.1[more]
SMESG000016935.10.000e+039.91SMESG000016935.1[more]
SMESG000005947.10.000e+037.79SMESG000005947.1[more]
SMESG000070834.11.139e-14537.18SMESG000070834.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30029442
GenBankAEE89452.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029442 ID=SMED30029442|Name=epidermal growth factor receptor 2|organism=Schmidtea mediterranea sexual|type=transcript|length=3956bp
AATTAATGAAGTACGTCTTCTCATGGGCTTCGTATGTAACATAATCGTCG
TTATCATTCTGTTGGAATCCAGTCTAGCTATTCGACAATTCGATGAAGAA
TATCCAGGCGTAACAATCTGTGAAAGCTCTATGACCTCAGGCGAACTTGG
TGGTAACCACAATTGCACACATGTAGAAGGCAATTTAGTAATTCAAAATG
TTTGGCCAGATCAAGAAAGTGGAGATTTGGGTTTTTTATCATCTATAATA
GAAGTAACTGGGATGATATTTATGAAAAATAATTCTATAAAAGATATAAT
ATTGCCTAATCTAAAAGTTATTCGGGGTCAGAACAGTTTGGCTTTAGAGA
AAAGTGAAGTATCAGTATACATAGATTTATTAGACGAAGAGAACTCTCAA
TATGCTATTTTCCCAAAACTTAGAGTTATTGCAAATAATTCAGTCTATTT
TAAAACAAAAGTAAAGCATAAATTTCTACCTCAGTCTATAAAATGGGAAG
AATTATTCGAAAATCCAAAAAAGCAGAAATTAATTACTTATAATAAATAT
ATGGAACATCAATGCCATTCTGATTGTTTACGAAACGATTTCCCGTATTG
TTGGTCTTCCAGTGCAAATCACTGTCAGAAACAATCGAAATGCGTTAAAG
AAAAAGTGGACAATATAGAATGGTGCTATTTCAAAATGCGGAATGGAGAA
ATTGATGAAGGGTTTTGCGATGAACAATGCACAGGAGGTTGCAATGGACC
GAAGAATTCAGATTGCGCAGTTTGCAAAAAGTATGTCAATGGAAACCATT
GTGTTGAATACTGTCCCCCGGAATTTATATATGATCGCGGAAATACGAAA
TTGAATCCAAATTTTAAATTAAGAGTGGGATATATGTGCGCGAATTCGTG
TCCAGGAAGTTGATGCTTGCATATACAGCTGCAATAGTCTTCATTTCTAT
CGAGTCGACAATAAATGTATTCGGTGTCAAAACTCATCAGTTTGTGCTAA
AAAAGAATTCAATATAAATAAGATTATCAATGAAGAAAATGAAGATGTGT
TTTACATGACTGCGGCCATTCTGAAAAATTTTACAGACATAGAGCACGTC
ATTGGAGAATTCCATTTTACTGCCCAATCATTTGATAAAGCCCTCGGTGG
AATCACTTTGCCAATGCTCTACAAACATTTGGGAAATGTCCAATATATTA
CCGGAGATCTAATCATTGATGGCAGCAATATTGTTTTGAAAAATTTAACA
TTTTTACAAAATCTAAAAGAAATAAGACATCTGTTAACTCAATCGGCATC
AGCTGCCTTGAACATAATGCATACGGACCTGGAATTTCTGGGACTGCGCA
AGCTCAGGCGCATATTCGGAAAATTTGAGGTTCACGACAGTCCTGGTCTA
TGCTATGCTGACACATTAAATTGGACGGGAAACATTTTAAAAAACAATCA
GTTTGATCCGATCTATCCGCCTTGCAATAAACCCTGTGATTCTAAATGTG
ATTCTCAAGGATGTTGGGGACCTGGTTCACATATGTGCTACAATTGTAGA
GGTTTTAGAGCAGTCTATAATTGTGTTGACAGGTGTGAAGATGAGCCAGG
TTTCTACACCAACACGTCTGCCATTAAAAAATATACGGATAACTATGATG
ATGGCATTTGTCAAAGATGTCATCCTTTATGTTTACAAAACTGTACAGGA
CCTCGGCCAACAAACTGCATTGGAGGTTGTCGATATTTTAAGGAAAACGA
CGAATGTGTAAAAAATTGTTCCAGGAAGTACTTTTCATTCAACAAGACTT
GCATCAAGTGTCATGAGACATGTATGGAAAATGATAAAAATCAGCCACTA
TGTACAGGTGAAAGCTCAATTTTGGGTTTGGGTGGATGCTCTTATTGTAG
CAAACTGATTCATAAAAGAGACGAGAAATTCTATTGCTACAAGGATCCAT
GCCCTCGGCACTACTATTTAAATAAAATAGACATTTCAGAAGTGATGAAA
CGCCAGAAATCAAAGGAAATCGGGATCTGTCAACCGTGTTTAGAGCCATG
TTTGGAATGCAGTGGCAACTATACTATCTATCCAACATGTGAGAAATGCA
ATGGATATTGGAGCGGAGATCGCTGCGTTAAGCAATGTTTTCCAATAGCC
CTAAATCTGCCCCGAAATGCTTCCTGTCCATATTGTAATGGAAACTGCGT
AGAAAGGTGTACAGTTACTCCAAATGATCCATTCCAATGTGGAAGCTGCA
ATTTTAAGCGGCTTTATCTCGATAACCATAACAAATCGTGCGTATCCGAG
TGCCCCCAAACTCACAAATACAAGCATAAAGATGGAAATTTAACTGATAT
CATTTGCATGACCCGATCTCAATGGCTGTCCTACCAAGAAAATCCTAAAT
TTATTTCGAAATGGTCATTGATAATTCTTTCTGTTATTACAGTCTTTTTG
ATTTCGTCTGTCTACATTTTTTTCCGATATGTTAATAAAATAAATCAGAA
AAAGTCTGTGAAATATCTCAAAGCCATATATTCGAACATTCATGAGCCAG
ATTCAAGAATAATTCTTCAAAATAAAAAGACCATACCAAATATGAATAGA
TTGCTCTTGATTCCGACTACAGACCTTATTTTCAATATCAATACCAAACC
CATTGGAACTGGAGCCTTCGGTGCAGTATATCGTGGTGTATGGAAACCAT
CTAATAAAGATTTGGAAAAATCGGATCGAGATTCTCTAGATGTGGCCGTT
AAAGTAATTCGAGCCAATAGAAATATTGACATTCAAGAAATAATGGAAGA
AGCTAAAGTCATGGCTTCTGTTTGTCACAAACACTGCCTCAGGCTTATAG
GTATTTGTTTGAAATACGAAATGCCATGTCTTATTACGACCTTTGTGGAA
CTTGGAAGTCTTGACAAATACCTAAGAAAACACAAGTCAACTCTTTGTAG
CAGAACTCTGCTATCTTGGGGAGAACAAATAGCTGATGGGATGACATATT
TAGAAATTAGAGGGATTATTCATAGAGATTTGGCTACGAGAAATGTCTTA
CTGAATGATCTAGAAATAATACAAATTACTGATTTCGGTTTGGCTCATAT
TGTTCAGTGCACCGAAGATAATAAAAATGAAATTGTTATATCCGGTGGAC
AAGTTCCAATCAGATGGCTAGCCTTAGAGACTCTGTTGAATGGTATCTAT
TCTCACAAAACTGATGTTTGGTCTTTTGGTATCACTTTATGGGAAATATT
TACTTATGGAGAAAGACCTTATGATGAATTAGATGTAAGAGAAATCACTT
CGTATTTGATACAGGGCAACCGATTAGCACAGCCTGAAATTTGTTCTGTT
GATTTGTATCAACTGATGTGTAGATGTTGGTACGAGAATGCAAATGATCG
GCCATCTTTCGAAACATTAATGTCAACACTGTCATGTTTTCATCAATTTC
CCACATGCTATCTAAATATTCCGAATGACAGTTGTTTAAGACCCATGAAA
AAAGATAAGCATCGCTTACTTTCTCAAATCAGTTACGACTTCCAAGTATA
TCCCAAACTCAATAACATATACAAACAGCACAGCTTGGATGGAACAATTT
CAACTTTTGTTGGGGATTATCAAGATGATATTGAAGGTGAACCGTCTTTG
AAACGTCAAAGTTCCGGTTTCAGTTGGAGTTCAAAACAAACCAGAAGCTC
CCAAGAAATTGATAAAAGGCTATTTTATTTTCGTCAACATTCCGCAGTTT
CAGAGGACTTGGAAGAAAATGATAACTTTTGCAGATCAGATGAACAGGAA
GAATCCGATTCTGAATATCTGGAACCAAAAAAAATTGAAAATTTCAAGTT
ATAAAGTGAATTCCATTTTCTGTCCATTTTGTTTCTCCATTTTTTTCCAT
AACTGTCATGCTTCATAGCATCCAGATTTATATTTATTTGCATAAAAACC
TAGTCC
back to top

protein sequence of SMED30029442-orf-1

>SMED30029442-orf-1 ID=SMED30029442-orf-1|Name=SMED30029442-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=104bp
MSFDTEYIYCRLDRNEDYCSCICKHQLPGHEFAHIYPTLNLKFGFNFVFP
RSYINSGGQYSTQWFPLTYFLQTAQSEFFGPLQPPVHCSSQNPSSISPFR
ILK*
back to top

protein sequence of SMED30029442-orf-2

>SMED30029442-orf-2 ID=SMED30029442-orf-2|Name=SMED30029442-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=304bp
INEVRLLMGFVCNIIVVIILLESSLAIRQFDEEYPGVTICESSMTSGELG
GNHNCTHVEGNLVIQNVWPDQESGDLGFLSSIIEVTGMIFMKNNSIKDII
LPNLKVIRGQNSLALEKSEVSVYIDLLDEENSQYAIFPKLRVIANNSVYF
KTKVKHKFLPQSIKWEELFENPKKQKLITYNKYMEHQCHSDCLRNDFPYC
WSSSANHCQKQSKCVKEKVDNIEWCYFKMRNGEIDEGFCDEQCTGGCNGP
KNSDCAVCKKYVNGNHCVEYCPPEFIYDRGNTKLNPNFKLRVGYMCANSC
PGS*
back to top

protein sequence of SMED30029442-orf-3

>SMED30029442-orf-3 ID=SMED30029442-orf-3|Name=SMED30029442-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=933bp
MTAAILKNFTDIEHVIGEFHFTAQSFDKALGGITLPMLYKHLGNVQYITG
DLIIDGSNIVLKNLTFLQNLKEIRHLLTQSASAALNIMHTDLEFLGLRKL
RRIFGKFEVHDSPGLCYADTLNWTGNILKNNQFDPIYPPCNKPCDSKCDS
QGCWGPGSHMCYNCRGFRAVYNCVDRCEDEPGFYTNTSAIKKYTDNYDDG
ICQRCHPLCLQNCTGPRPTNCIGGCRYFKENDECVKNCSRKYFSFNKTCI
KCHETCMENDKNQPLCTGESSILGLGGCSYCSKLIHKRDEKFYCYKDPCP
RHYYLNKIDISEVMKRQKSKEIGICQPCLEPCLECSGNYTIYPTCEKCNG
YWSGDRCVKQCFPIALNLPRNASCPYCNGNCVERCTVTPNDPFQCGSCNF
KRLYLDNHNKSCVSECPQTHKYKHKDGNLTDIICMTRSQWLSYQENPKFI
SKWSLIILSVITVFLISSVYIFFRYVNKINQKKSVKYLKAIYSNIHEPDS
RIILQNKKTIPNMNRLLLIPTTDLIFNINTKPIGTGAFGAVYRGVWKPSN
KDLEKSDRDSLDVAVKVIRANRNIDIQEIMEEAKVMASVCHKHCLRLIGI
CLKYEMPCLITTFVELGSLDKYLRKHKSTLCSRTLLSWGEQIADGMTYLE
IRGIIHRDLATRNVLLNDLEIIQITDFGLAHIVQCTEDNKNEIVISGGQV
PIRWLALETLLNGIYSHKTDVWSFGITLWEIFTYGERPYDELDVREITSY
LIQGNRLAQPEICSVDLYQLMCRCWYENANDRPSFETLMSTLSCFHQFPT
CYLNIPNDSCLRPMKKDKHRLLSQISYDFQVYPKLNNIYKQHSLDGTIST
FVGDYQDDIEGEPSLKRQSSGFSWSSKQTRSSQEIDKRLFYFRQHSAVSE
DLEENDNFCRSDEQEESDSEYLEPKKIENFKL*
back to top
Aliases
The feature 'epidermal growth factor receptor 2' has the following synonyms
Synonym
EGFR2
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000420parapharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR001245Ser-Thr/Tyr_kinase_cat_dom
IPR020635Tyr_kinase_cat_dom
IPR006212Furin_repeat
IPR000494Rcpt_L-dom
IPR032778GF_recep_IV
IPR008266Tyr_kinase_AS
IPR017441Protein_kinase_ATP_BS
IPR000719Prot_kinase_dom
IPR009030Growth_fac_rcpt_cys_sf
IPR032675LRR_dom_sf
IPR011009Kinase-like_dom_sf
IPR006211Furin-like_Cys-rich_dom
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0004713protein tyrosine kinase activity
GO:0005524ATP binding
GO:0004714transmembrane receptor protein tyrosine kinase activity
GO:0000166nucleotide binding
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0007169transmembrane receptor protein tyrosine kinase signaling pathway
GO:0016310phosphorylation
GO:0018108peptidyl-tyrosine phosphorylation
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane