SMED30029428

Overview
NameSMED30029428
Smed IDSMED30029428
Length (bp)637
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30029428 (SMED30029428) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30029428 (SMED30029428) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029428

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30029428 SmedASXL_032139SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
protonephridiaSMED30029428 dd_Smed_v4_5765_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30029428 dd_Smed_v4_5765_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029428 dd_Smed_v4_5765_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30029428 dd_Smed_v4_5765_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30029428 dd_Smed_v4_5765_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029428 dd_Smed_v4_5765_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30029428 dd_Smed_v4_5765_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30029428 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.001416:49822..50457 -3153
Homology
BLAST of SMED30029428 vs. Ensembl Human
Match: COA6 (cytochrome c oxidase assembly factor 6 [Source:HGNC Symbol;Acc:HGNC:18025])

HSP 1 Score: 53.1434 bits (126), Expect = 3.931e-9
Identity = 23/59 (38.98%), Postives = 36/59 (61.02%), Query Frame = -1
Query:  287 PSKEERKKCWESRDEFWHCLDNNNEESEKCLNERKLYEKYCSHQWVNWCT*CRLFITFR 463
            PS +ER+ CW +RDE+W CLD N E++ +C   R  +E  C  QW+ +    R ++ F+
Sbjct:    4 PSMKERQVCWGARDEYWKCLDENLEDASQCKKLRSSFESSCPQQWIKYFDKRRDYLKFK 62          
BLAST of SMED30029428 vs. Ensembl Human
Match: COA6 (cytochrome c oxidase assembly factor 6 [Source:HGNC Symbol;Acc:HGNC:18025])

HSP 1 Score: 53.1434 bits (126), Expect = 3.931e-9
Identity = 23/59 (38.98%), Postives = 36/59 (61.02%), Query Frame = -1
Query:  287 PSKEERKKCWESRDEFWHCLDNNNEESEKCLNERKLYEKYCSHQWVNWCT*CRLFITFR 463
            PS +ER+ CW +RDE+W CLD N E++ +C   R  +E  C  QW+ +    R ++ F+
Sbjct:    4 PSMKERQVCWGARDEYWKCLDENLEDASQCKKLRSSFESSCPQQWIKYFDKRRDYLKFK 62          
BLAST of SMED30029428 vs. Ensembl Human
Match: COA6 (cytochrome c oxidase assembly factor 6 [Source:HGNC Symbol;Acc:HGNC:18025])

HSP 1 Score: 53.9138 bits (128), Expect = 5.059e-9
Identity = 23/59 (38.98%), Postives = 36/59 (61.02%), Query Frame = -1
Query:  287 PSKEERKKCWESRDEFWHCLDNNNEESEKCLNERKLYEKYCSHQWVNWCT*CRLFITFR 463
            PS +ER+ CW +RDE+W CLD N E++ +C   R  +E  C  QW+ +    R ++ F+
Sbjct:   50 PSMKERQVCWGARDEYWKCLDENLEDASQCKKLRSSFESSCPQQWIKYFDKRRDYLKFK 108          
BLAST of SMED30029428 vs. Ensembl Human
Match: COA6 (cytochrome c oxidase assembly factor 6 [Source:HGNC Symbol;Acc:HGNC:18025])

HSP 1 Score: 53.5286 bits (127), Expect = 1.196e-8
Identity = 23/59 (38.98%), Postives = 36/59 (61.02%), Query Frame = -1
Query:  287 PSKEERKKCWESRDEFWHCLDNNNEESEKCLNERKLYEKYCSHQWVNWCT*CRLFITFR 463
            PS +ER+ CW +RDE+W CLD N E++ +C   R  +E  C  QW+ +    R ++ F+
Sbjct:   80 PSMKERQVCWGARDEYWKCLDENLEDASQCKKLRSSFESSCPQQWIKYFDKRRDYLKFK 138          
BLAST of SMED30029428 vs. Ensembl Zebrafish
Match: coa6 (cytochrome c oxidase assembly factor 6 [Source:ZFIN;Acc:ZDB-GENE-070705-152])

HSP 1 Score: 50.0618 bits (118), Expect = 3.283e-8
Identity = 23/66 (34.85%), Postives = 37/66 (56.06%), Query Frame = -1
Query:  266 PSKEERKKCWESRDEFWHCLDNNNEESEKCLNERKLYEKYCSHQWVNWCT*CRLFITFRFFILTEN 463
            P+  +RK CW++RDE W CLD N + +  C   ++ +E  C  QWV + +  R F+ ++  I  E 
Sbjct:    4 PNASQRKACWDARDELWKCLDVNKDLTSACEKHQREFEANCPAQWVKYFSKRRDFLKYKEKIEKEG 69          
BLAST of SMED30029428 vs. Ensembl Zebrafish
Match: coa6 (cytochrome c oxidase assembly factor 6 [Source:ZFIN;Acc:ZDB-GENE-070705-152])

HSP 1 Score: 50.0618 bits (118), Expect = 3.283e-8
Identity = 23/66 (34.85%), Postives = 37/66 (56.06%), Query Frame = -1
Query:  266 PSKEERKKCWESRDEFWHCLDNNNEESEKCLNERKLYEKYCSHQWVNWCT*CRLFITFRFFILTEN 463
            P+  +RK CW++RDE W CLD N + +  C   ++ +E  C  QWV + +  R F+ ++  I  E 
Sbjct:    4 PNASQRKACWDARDELWKCLDVNKDLTSACEKHQREFEANCPAQWVKYFSKRRDFLKYKEKIEKEG 69          
BLAST of SMED30029428 vs. Ensembl Xenopus
Match: ptgir (prostaglandin I2 receptor [Source:Xenbase;Acc:XB-GENE-982059])

HSP 1 Score: 57.7658 bits (138), Expect = 6.339e-11
Identity = 23/60 (38.33%), Postives = 40/60 (66.67%), Query Frame = -1
Query:  287 PPSKEERKKCWESRDEFWHCLDNNNEESEKCLNERKLYEKYCSHQWVNWCT*CRLFITFR 466
             P+ +ER+ CW++RDE+W CLD NNE++ KC N R+ ++  C  QW+ +    R ++ ++
Sbjct:    3 APTAKERQACWDARDEYWQCLDANNEDASKCQNLRQSFKNNCPQQWMKYFDKRRDYLKYK 62          
BLAST of SMED30029428 vs. Ensembl Xenopus
Match: ptgir (prostaglandin I2 receptor [Source:Xenbase;Acc:XB-GENE-982059])

HSP 1 Score: 56.9954 bits (136), Expect = 2.391e-10
Identity = 22/49 (44.90%), Postives = 35/49 (71.43%), Query Frame = -1
Query:  320 PPSKEERKKCWESRDEFWHCLDNNNEESEKCLNERKLYEKYCSHQWVNW 466
             P+ +ER+ CW++RDE+W CLD NNE++ KC N R+ ++  C  QW+ +
Sbjct:   30 APTAKERQACWDARDEYWQCLDANNEDASKCQNLRQSFKNNCPQQWMKY 78          
BLAST of SMED30029428 vs. Ensembl Mouse
Match: Coa6 (cytochrome c oxidase assembly factor 6 [Source:MGI Symbol;Acc:MGI:1915142])

HSP 1 Score: 53.9138 bits (128), Expect = 1.410e-9
Identity = 22/59 (37.29%), Postives = 36/59 (61.02%), Query Frame = -1
Query:  287 PSKEERKKCWESRDEFWHCLDNNNEESEKCLNERKLYEKYCSHQWVNWCT*CRLFITFR 463
            PS +ER+ CW +RD +W CLD+N E++ +C   R  +E  C  QW+ +    R ++ F+
Sbjct:    4 PSMKERQACWGARDLYWRCLDDNAEDAARCQKLRSSFEASCPQQWIKYFDKRRDYLKFK 62          
BLAST of SMED30029428 vs. Ensembl Mouse
Match: Coa6 (cytochrome c oxidase assembly factor 6 [Source:MGI Symbol;Acc:MGI:1915142])

HSP 1 Score: 53.9138 bits (128), Expect = 1.410e-9
Identity = 22/59 (37.29%), Postives = 36/59 (61.02%), Query Frame = -1
Query:  287 PSKEERKKCWESRDEFWHCLDNNNEESEKCLNERKLYEKYCSHQWVNWCT*CRLFITFR 463
            PS +ER+ CW +RD +W CLD+N E++ +C   R  +E  C  QW+ +    R ++ F+
Sbjct:    4 PSMKERQACWGARDLYWRCLDDNAEDAARCQKLRSSFEASCPQQWIKYFDKRRDYLKFK 62          
BLAST of SMED30029428 vs. UniProt/SwissProt
Match: sp|Q2M2S5|COA6_BOVIN (Cytochrome c oxidase assembly factor 6 homolog OS=Bos taurus OX=9913 GN=COA6 PE=3 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 2.184e-9
Identity = 23/59 (38.98%), Postives = 36/59 (61.02%), Query Frame = -1
Query:  287 PSKEERKKCWESRDEFWHCLDNNNEESEKCLNERKLYEKYCSHQWVNWCT*CRLFITFR 463
            P+ +ER+ CW +RDE+W CLD N E++ KC   R  +E  C  QW+ +    R ++ F+
Sbjct:    4 PTMKERQACWGARDEYWKCLDENTEDASKCKKLRSSFESSCPQQWIKYFDKRRDYLKFK 62          
BLAST of SMED30029428 vs. UniProt/SwissProt
Match: sp|Q8BGD8|COA6_MOUSE (Cytochrome c oxidase assembly factor 6 homolog OS=Mus musculus OX=10090 GN=Coa6 PE=1 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 9.866e-9
Identity = 22/59 (37.29%), Postives = 36/59 (61.02%), Query Frame = -1
Query:  287 PSKEERKKCWESRDEFWHCLDNNNEESEKCLNERKLYEKYCSHQWVNWCT*CRLFITFR 463
            PS +ER+ CW +RD +W CLD+N E++ +C   R  +E  C  QW+ +    R ++ F+
Sbjct:    4 PSMKERQACWGARDLYWRCLDDNAEDAARCQKLRSSFEASCPQQWIKYFDKRRDYLKFK 62          
BLAST of SMED30029428 vs. UniProt/SwissProt
Match: sp|Q5JTJ3|COA6_HUMAN (Cytochrome c oxidase assembly factor 6 homolog OS=Homo sapiens OX=9606 GN=COA6 PE=1 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 2.429e-8
Identity = 23/59 (38.98%), Postives = 36/59 (61.02%), Query Frame = -1
Query:  287 PSKEERKKCWESRDEFWHCLDNNNEESEKCLNERKLYEKYCSHQWVNWCT*CRLFITFR 463
            PS +ER+ CW +RDE+W CLD N E++ +C   R  +E  C  QW+ +    R ++ F+
Sbjct:   50 PSMKERQVCWGARDEYWKCLDENLEDASQCKKLRSSFESSCPQQWIKYFDKRRDYLKFK 108          
BLAST of SMED30029428 vs. TrEMBL
Match: A0A091IF86 (Cytochrome c oxidase assembly factor 6 (Fragment) OS=Calypte anna OX=9244 GN=N300_13220 PE=4 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 1.136e-10
Identity = 30/68 (44.12%), Postives = 42/68 (61.76%), Query Frame = -1
Query:  260 PSKEERKKCWESRDEFWHCLDNNNEESEKCLNERKLYEKYCSHQWVNWCT*CRLFITFRFFILTENVH 463
            P+ EERK CW +RDEFWHCLD++ E++ KC   R  +E  C  QWV +    R F+ ++  + TE  H
Sbjct:    7 PTMEERKACWGARDEFWHCLDSHAEDAAKCEKLRHSFESLCPQQWVKYFDRRRDFLKYKKKLETEGFH 74          
BLAST of SMED30029428 vs. TrEMBL
Match: A0A218VBN2 (Cytochrome c oxidase assembly factor 6 OS=Lonchura striata domestica OX=299123 GN=COA6 PE=4 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 3.140e-10
Identity = 28/74 (37.84%), Postives = 43/74 (58.11%), Query Frame = -1
Query:  242 PSKEERKKCWESRDEFWHCLDNNNEESEKCLNERKLYEKYCSHQWVNWCT*CRLFITFRFFILTENVHLITSEN 463
            P+ EERK CW +RDEFW CLD++ +++ KC   R+ +E  C  QWV +    R F+ ++  + TE  H   +  
Sbjct:    4 PTMEERKACWGARDEFWQCLDSHGDDAAKCEKLRRAFESRCPQQWVKYFDKRRDFLKYKKKLETEGYHPPEAAG 77          
BLAST of SMED30029428 vs. TrEMBL
Match: A0A131YAZ4 (Cytochrome c oxidase assembly factor 6 OS=Rhipicephalus appendiculatus OX=34631 PE=4 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 5.845e-10
Identity = 29/78 (37.18%), Postives = 46/78 (58.97%), Query Frame = -1
Query:  230 PSKEERKKCWESRDEFWHCLDNNNEESEKCLNERKLYEKYCSHQWVNWCT*CRLFITFRFFILTENVHLITSENLIKK 463
            P+KE+R+KCW+SRD +W CLD+N E++++C   + LYE +C  QWV      R ++ F+  I  +    +   N   K
Sbjct:    4 PNKEQRQKCWDSRDRYWECLDSNAEDAKRCAEMKSLYETHCPSQWVKHFDRKREYLKFKDKIEKDGYDPLDDSNARAK 81          
BLAST of SMED30029428 vs. TrEMBL
Match: C9W1I0 (Cytochrome c oxidase subunit VIb/COX12 OS=Rhipicephalus sanguineus OX=34632 PE=2 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 8.347e-10
Identity = 29/78 (37.18%), Postives = 46/78 (58.97%), Query Frame = -1
Query:  230 PSKEERKKCWESRDEFWHCLDNNNEESEKCLNERKLYEKYCSHQWVNWCT*CRLFITFRFFILTENVHLITSENLIKK 463
            P+KE+R+KCW+SRD +W CLD+N E++++C   + LYE +C  QWV      R ++ F+  I  +    +   N   K
Sbjct:    4 PNKEQRQKCWDSRDRYWECLDSNAEDAKRCAEMKSLYETHCPSQWVKHFDRKREYLKFKDKIEKDGYDPLDDTNARAK 81          
BLAST of SMED30029428 vs. TrEMBL
Match: L7M5M3 (Putative cytochrome c oxidase subunit vib/cox12 OS=Rhipicephalus pulchellus OX=72859 PE=2 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 1.040e-9
Identity = 29/78 (37.18%), Postives = 46/78 (58.97%), Query Frame = -1
Query:  230 PSKEERKKCWESRDEFWHCLDNNNEESEKCLNERKLYEKYCSHQWVNWCT*CRLFITFRFFILTENVHLITSENLIKK 463
            P+KE+R+KCW+SRD +W CLD+N E++++C   + LYE +C  QWV      R ++ F+  I  +    +   N   K
Sbjct:    4 PNKEQRQKCWDSRDRYWECLDSNAEDAKRCAEMKSLYETHCPSQWVKHFDRKREYLKFKDKIEKDGYDPLDDTNTRAK 81          
BLAST of SMED30029428 vs. Ensembl Cavefish
Match: coa6 (cytochrome c oxidase assembly factor 6 homolog [Source:NCBI gene;Acc:103022513])

HSP 1 Score: 50.8322 bits (120), Expect = 1.720e-8
Identity = 23/66 (34.85%), Postives = 37/66 (56.06%), Query Frame = -1
Query:  266 PSKEERKKCWESRDEFWHCLDNNNEESEKCLNERKLYEKYCSHQWVNWCT*CRLFITFRFFILTEN 463
            P+ +ER+ CW +RDEFW CLD+N ++   C   +  +E  C  QWV +    R ++ ++  I  E 
Sbjct:    4 PNSQERRACWGARDEFWKCLDHNRDDVAACEKYKTDFEMLCPAQWVKYFNKRRDYLKYKEKIDKEG 69          
BLAST of SMED30029428 vs. Ensembl Nematostella
Match: EDO28917 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T547])

HSP 1 Score: 55.8398 bits (133), Expect = 6.584e-11
Identity = 25/69 (36.23%), Postives = 39/69 (56.52%), Query Frame = -1
Query:  257 PSKEERKKCWESRDEFWHCLDNNNEESEKCLNERKLYEKYCSHQWVNWCT*CRLFITFRFFILTENVHL 463
            P+ EER+KC ++RD ++ C+D N  ES  C   + LY+K C   WV +    R + T++  + TE   L
Sbjct:    4 PTTEERRKCHQTRDAYFKCVDENGSESALCKEAKALYDKSCPASWVKYFARKRAYDTYKAKLNTEGFKL 72          
BLAST of SMED30029428 vs. Ensembl Nematostella
Match: EDO40270 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7P0])

HSP 1 Score: 55.8398 bits (133), Expect = 9.146e-10
Identity = 25/69 (36.23%), Postives = 39/69 (56.52%), Query Frame = -1
Query:  257 PSKEERKKCWESRDEFWHCLDNNNEESEKCLNERKLYEKYCSHQWVNWCT*CRLFITFRFFILTENVHL 463
            P+ EER+KC ++RD ++ C+D N  ES  C   + LY+K C   WV +    R + T++  + TE   L
Sbjct:  143 PTTEERRKCHQTRDAYFKCVDENGSESALCKEAKALYDKSCPASWVKYFARKRAYDTYKAKLNTEGFKL 211          
BLAST of SMED30029428 vs. Ensembl Medaka
Match: coa6 (cytochrome c oxidase assembly factor 6 homolog [Source:NCBI gene;Acc:101169596])

HSP 1 Score: 54.299 bits (129), Expect = 8.895e-10
Identity = 23/66 (34.85%), Postives = 40/66 (60.61%), Query Frame = -1
Query:  266 PSKEERKKCWESRDEFWHCLDNNNEESEKCLNERKLYEKYCSHQWVNWCT*CRLFITFRFFILTEN 463
            P+  ER+ CW++RD  W CLD+N++ +E C  ++  ++  C  QWV + +  R F+ ++  I TE 
Sbjct:    4 PNSAERRVCWDARDLLWKCLDDNHDSAEACQKQQSHFQDKCPAQWVRYFSKRRDFLKYKERIQTEG 69          
BLAST of SMED30029428 vs. Planmine SMEST
Match: SMESG000019958.1 (SMESG000019958.1)

HSP 1 Score: 107.457 bits (267), Expect = 1.633e-30
Identity = 54/65 (83.08%), Postives = 55/65 (84.62%), Query Frame = -1
Query:  281 MGDPPSKEERKKCWESRDEFWHCLDNNNEESEKCLNERKLYEKYCSHQWVNWCT*CRLFITFRFF 475
            MGDPP+KEERKKCWESRDEFWHCLDNNNEESEKCLNERKLYEKYCSHQWV      R F  FR F
Sbjct:    1 MGDPPTKEERKKCWESRDEFWHCLDNNNEESEKCLNERKLYEKYCSHQWVLHFDRKRAFDNFRKF 65          

HSP 2 Score: 43.8986 bits (102), Expect = 2.950e-6
Identity = 21/21 (100.00%), Postives = 21/21 (100.00%), Query Frame = -3
Query:  225 VLHFDRKRAFDNFRKFDKKVL 287
            VLHFDRKRAFDNFRKFDKKVL
Sbjct:   50 VLHFDRKRAFDNFRKFDKKVL 70          
BLAST of SMED30029428 vs. Planmine SMEST
Match: SMESG000019957.1 (SMESG000019957.1)

HSP 1 Score: 50.447 bits (119), Expect = 1.258e-8
Identity = 26/50 (52.00%), Postives = 33/50 (66.00%), Query Frame = -1
Query:  326 MGDPPSKEERKKCWESRDEFWHCLDNNNEESEKCLNERKLYEKYCSHQWV 475
            M  P +K ERK CW  RD FW+CLD+  +ES  C NERK +E+ C  +WV
Sbjct:    1 MPKPLNKLERKTCWFYRDRFWNCLDSKEDESN-CKNERKQFEESCPQRWV 49          
The following BLAST results are available for this feature:
BLAST of SMED30029428 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
COA63.931e-938.98cytochrome c oxidase assembly factor 6 [Source:HGN... [more]
COA63.931e-938.98cytochrome c oxidase assembly factor 6 [Source:HGN... [more]
COA65.059e-938.98cytochrome c oxidase assembly factor 6 [Source:HGN... [more]
COA61.196e-838.98cytochrome c oxidase assembly factor 6 [Source:HGN... [more]
back to top
BLAST of SMED30029428 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029428 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029428 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
coa63.283e-834.85cytochrome c oxidase assembly factor 6 [Source:ZFI... [more]
coa63.283e-834.85cytochrome c oxidase assembly factor 6 [Source:ZFI... [more]
back to top
BLAST of SMED30029428 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ptgir6.339e-1138.33prostaglandin I2 receptor [Source:Xenbase;Acc:XB-G... [more]
ptgir2.391e-1044.90prostaglandin I2 receptor [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of SMED30029428 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Coa61.410e-937.29cytochrome c oxidase assembly factor 6 [Source:MGI... [more]
Coa61.410e-937.29cytochrome c oxidase assembly factor 6 [Source:MGI... [more]
back to top
BLAST of SMED30029428 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q2M2S5|COA6_BOVIN2.184e-938.98Cytochrome c oxidase assembly factor 6 homolog OS=... [more]
sp|Q8BGD8|COA6_MOUSE9.866e-937.29Cytochrome c oxidase assembly factor 6 homolog OS=... [more]
sp|Q5JTJ3|COA6_HUMAN2.429e-838.98Cytochrome c oxidase assembly factor 6 homolog OS=... [more]
back to top
BLAST of SMED30029428 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A091IF861.136e-1044.12Cytochrome c oxidase assembly factor 6 (Fragment) ... [more]
A0A218VBN23.140e-1037.84Cytochrome c oxidase assembly factor 6 OS=Lonchura... [more]
A0A131YAZ45.845e-1037.18Cytochrome c oxidase assembly factor 6 OS=Rhipicep... [more]
C9W1I08.347e-1037.18Cytochrome c oxidase subunit VIb/COX12 OS=Rhipicep... [more]
L7M5M31.040e-937.18Putative cytochrome c oxidase subunit vib/cox12 OS... [more]
back to top
BLAST of SMED30029428 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
coa61.720e-834.85cytochrome c oxidase assembly factor 6 homolog [So... [more]
back to top
BLAST of SMED30029428 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029428 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029428 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO289176.584e-1136.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO402709.146e-1036.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30029428 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
coa68.895e-1034.85cytochrome c oxidase assembly factor 6 homolog [So... [more]
back to top
BLAST of SMED30029428 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000019958.11.633e-3083.08SMESG000019958.1[more]
SMESG000019957.11.258e-852.00SMESG000019957.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029428 ID=SMED30029428|Name=SMED30029428|organism=Schmidtea mediterranea sexual|type=transcript|length=637bp
CATTTTCTATCAGCATATTTCAACTTTTTAGTAGCTTAAATTTCAAATCG
ATTTCCTCCTTTCGCACATAAATTATTTGAAAAATCAATATTAAAATACA
AAATCAACATTTTTGCGAATTACTAATAATAATATTTGTAAAAATTCAAA
ATTTATAAATAAAATAACTATAAAGACATTTAAATTACAAATATTAAAAC
AGAAAGATAGATCATATATTGTTATAAAACTTTTTTATCAAATTTTCGGA
AGTTATCAAATGCACGTTTTCGGTCAAAATGAAGAACCTAAAAGTAATAA
ACAGTCGGCATCAAGTACACCAATTTACCCATTGATGTGAGCAATATTTT
TCGTATAATTTTCTTTCGTTTAGGCATTTCTCGCTTTCTTCATTATTATT
ATCGAGACAGTGCCAAAATTCATCACGACTTTCCCAACATTTTTTTCTTT
CTTCTTTAGAAGGTGGATCTCCCATAAATTATTTTAAATAATACGAATAA
AAAGGTTTACTTAAAGTTCTTTAAGGTAAAAAAAACTAACAAATGACGAA
CTAATTTGTTATATATTTGAATAGTTTCTCATTTAAAACAATAAAATGTT
AAATTTAACAACTTGGAAAATAACCAATTTCCCATAC
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR042289COA6
IPR036549Cyt_c_oxidase_su6B_sf
IPR003213Cyt_c_oxidase_su6B
Vocabulary: biological process
TermDefinition
GO:0008535respiratory chain complex IV assembly
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
Vocabulary: molecular function
TermDefinition
GO:0004129cytochrome-c oxidase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003213Cytochrome c oxidase, subunit VIbPFAMPF02297COX6Bcoord: 4..51
e-value: 3.2E-12
score: 46.5
IPR042289Cytochrome c oxidase assembly factor 6 homologPANTHERPTHR46690FAMILY NOT NAMEDcoord: 5..52
NoneNo IPR availablePROSITEPS51808CHCHcoord: 10..53
score: 13.245
IPR036549Cytochrome c oxidase, subunit VIb superfamilySUPERFAMILYSSF47694Cytochrome c oxidase subunit hcoord: 5..51