Homogentisate 1,2-dioxygenase

Overview
NameHomogentisate 1,2-dioxygenase
Smed IDSMED30029427
Length (bp)1774
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Homogentisate 1,2-dioxygenase (SMED30029427) t-SNE clustered cells

Violin plots show distribution of expression levels for Homogentisate 1,2-dioxygenase (SMED30029427) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Homogentisate 1,2-dioxygenase (SMED30029427) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Homogentisate 1,2-dioxygenase (SMED30029427) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029427

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
tail regionSMED30029427SMESG000033366.1 SmedASXL_010841SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
gutSMED30029427SMESG000033366.1 dd_Smed_v4_2908_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30029427SMESG000033366.1 dd_Smed_v4_2908_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029427SMESG000033366.1 dd_Smed_v4_2908_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30029427SMESG000033366.1 dd_Smed_v4_2908_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029427SMESG000033366.1 Contig32877newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029427SMESG000033366.1 Contig32877uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029427SMESG000077847.1 SMESG000057533.1 SMESG000044971.1 SMESG000033570.1 SMESG000033366.1 SMESG000031842.1 SMESG000027782.1 SMESG000026563.1 SMESG000014849.1 SMESG000004883.1 Contig16675newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029427SMESG000077847.1 SMESG000057533.1 SMESG000044971.1 SMESG000033570.1 SMESG000033366.1 SMESG000031842.1 SMESG000027782.1 SMESG000026563.1 SMESG000014849.1 SMESG000004883.1 Contig16675uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parenchymal cellSMED30029427SMESG000033366.1 dd_Smed_v6_2908_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Homogentisate 1,2-dioxygenase vs. Ensembl Human
Match: HGD (homogentisate 1,2-dioxygenase [Source:HGNC Symbol;Acc:HGNC:4892])

HSP 1 Score: 543.117 bits (1398), Expect = 0.000e+0
Identity = 261/440 (59.32%), Postives = 327/440 (74.32%), Query Frame = 2
Query:  209 LDSYSYQNGFGNEFSSEHFKYKGSLPNSQNNPQKCTFGLYAEQLSGTAFTAPRHENLRSWLYRILPSVVHDPFKKYSDAPHFTNKFQSTKVNPNQLRWNPFKNDKEFNQTKVDFVNGIRTICGAGDPNIRNAIMIYVYNFNINMTNKAFFNSDGDFLIVPQEGALSVITEFGKFIIAPGEIIVIQQGIRFSVNLLDSQSASGYILEVCGNHFVLPSLGPIGANGLANPRDFQTSVAWFDEESINKNETFTVISKYQGELFTYNQNHTCFDVVAWHGNYVPYKYDLGSFMVINSVSFDHADPSIFTVLTCPSLKPGTALADFVIFPPRWSVQEHTFRPPYYHRNCMAEFMGLIYGNYEAKEKGFLPGGATLHSMMIPHGPDSNCFESASNSHLKSERIADNTLAFMFETSLSLSITDWAQENN--VDGDYYKCWQELKKNF 1522
            +    Y +GFGNE SSE  +  GSLP  QNNPQ C + LYAEQLSG+AFT PR  N RSWLYRILPSV H PF+   D    T+ +     +PNQLRW PF+  K  +Q KVDFV+G+ T+CGAGD    N + I+++  N +M N+ F+NSDGDFLIVPQ+G L + TEFGK ++ P EI VIQ+G+RFS+++   +   GYILEV G HF LP LGPIGANGLANPRDF   +AW+++  +     +TVI+KYQG+LF   Q+ + F+VVAWHGNY PYKY+L +FMVINSV+FDHADPSIFTVLT  S++PG A+ADFVIFPPRW V + TFRPPYYHRNCM+EFMGLI G+YEAK+ GFLPGG +LHS M PHGPD++CFE AS   L  ERIAD T+AFMFE+SLSL++T W  + +  +D +Y+KCW+ LK +F
Sbjct:    1 MAELKYISGFGNECSSEDPRCPGSLPEGQNNPQVCPYNLYAEQLSGSAFTCPRSTNKRSWLYRILPSVSHKPFESI-DEGQVTHNWDEVDPDPNQLRWKPFEIPKA-SQKKVDFVSGLHTLCGAGDIKSNNGLAIHIFLCNTSMENRCFYNSDGDFLIVPQKGNLLIYTEFGKMLVQPNEICVIQRGMRFSIDVF--EETRGYILEVYGVHFELPDLGPIGANGLANPRDFLIPIAWYEDRQVPGG--YTVINKYQGKLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDHADPSIFTVLTAKSVRPGVAIADFVIFPPRWGVADKTFRPPYYHRNCMSEFMGLIRGHYEAKQGGFLPGGGSLHSTMTPHGPDADCFEKASKVKLAPERIADGTMAFMFESSLSLAVTKWGLKASRCLDENYHKCWEPLKSHF 434          
BLAST of Homogentisate 1,2-dioxygenase vs. Ensembl Human
Match: HGD (homogentisate 1,2-dioxygenase [Source:HGNC Symbol;Acc:HGNC:4892])

HSP 1 Score: 205.297 bits (521), Expect = 6.444e-63
Identity = 95/140 (67.86%), Postives = 113/140 (80.71%), Query Frame = 2
Query:  812 GYILEVCGNHFVLPSLGPIGANGLANPRDFQTSVAWFDEESINKNETFTVISKYQGELFTYNQNHTCFDVVAWHGNYVPYKYDLGSFMVINSVSFDHADPSIFTVLTCPSLKPGTALADFVIFPPRWSVQEHTFRPPYYH 1231
            GYILEV G HF LP LGPIGANGLANPRDF   +AW+++  +     +TVI+KYQG+LF   Q+ + F+VVAWHGNY PYKY+L +FMVINSV+FDHADPSIFTVLT  S++PG A+ADFVIFPPRW V + TFRPPYYH
Sbjct:    5 GYILEVYGVHFELPDLGPIGANGLANPRDFLIPIAWYEDRQVPGG--YTVINKYQGKLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDHADPSIFTVLTAKSVRPGVAIADFVIFPPRWGVADKTFRPPYYH 142          
BLAST of Homogentisate 1,2-dioxygenase vs. Ensembl Human
Match: HGD (homogentisate 1,2-dioxygenase [Source:HGNC Symbol;Acc:HGNC:4892])

HSP 1 Score: 137.117 bits (344), Expect = 2.184e-37
Identity = 67/127 (52.76%), Postives = 87/127 (68.50%), Query Frame = 2
Query:  383 SWLYRILPSVVHDPFKKYSDAPHFTNKFQSTKVNPNQLRWNPFKNDKEFNQTKVDFVNGIRTICGAGDPNIRNAIMIYVYNFNINMTNKAFFNSDGDFLIVPQEGALSVITEFGKFIIAPGEIIVIQ 763
            SWLYRILPSV H PF+   D    T+ +     +PNQLRW PF+  K  +Q KVDFV+G+ T+CGAGD    N + I+++  N +M N+ F+NSDGDFLIVPQ+G L + TEFGK ++ P EI VIQ
Sbjct:   18 SWLYRILPSVSHKPFESI-DEGQVTHNWDEVDPDPNQLRWKPFEIPKA-SQKKVDFVSGLHTLCGAGDIKSNNGLAIHIFLCNTSMENRCFYNSDGDFLIVPQKGNLLIYTEFGKMLVQPNEICVIQ 142          
BLAST of Homogentisate 1,2-dioxygenase vs. Ensembl Human
Match: HGD (homogentisate 1,2-dioxygenase [Source:HGNC Symbol;Acc:HGNC:4892])

HSP 1 Score: 75.0998 bits (183), Expect = 4.002e-16
Identity = 36/66 (54.55%), Postives = 47/66 (71.21%), Query Frame = 2
Query:  686 PQEGALSVITEFGKFIIAPGEIIVIQQGIRFSVNLLDSQSASGYILEVCGNHFVLPSLGPIGANGL 883
            PQ+G L + TEFGK ++ P EI VIQ+G+RFS+++   +   GYILEV G HF LP LGPI + GL
Sbjct:    2 PQKGNLLIYTEFGKMLVQPNEICVIQRGMRFSIDVF--EETRGYILEVYGVHFELPDLGPIDSLGL 65          
BLAST of Homogentisate 1,2-dioxygenase vs. Ensembl Human
Match: HGD (homogentisate 1,2-dioxygenase [Source:HGNC Symbol;Acc:HGNC:4892])

HSP 1 Score: 68.5514 bits (166), Expect = 1.158e-13
Identity = 33/67 (49.25%), Postives = 45/67 (67.16%), Query Frame = 2
Query:  584 DPNIRNAIMIYVYNFNINMTNKAFFNSDGDFLIVPQEGALSVITEFGKFIIAPGEIIVIQQGIRFSV 784
            D    N + I+++  N +M N+ F+NSDGDFLIVPQ+G L + TEFGK ++ P EI VIQ    F+V
Sbjct:    1 DIKSNNGLAIHIFLCNTSMENRCFYNSDGDFLIVPQKGNLLIYTEFGKMLVQPNEICVIQDVSPFNV 67          

HSP 2 Score: 59.3066 bits (142), Expect = 1.877e-10
Identity = 26/36 (72.22%), Postives = 32/36 (88.89%), Query Frame = 2
Query:  998 QNHTCFDVVAWHGNYVPYKYDLGSFMVINSVSFDHA 1105
            Q+ + F+VVAWHGNY PYKY+L +FMVINSV+FDHA
Sbjct:   60 QDVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDHA 95          
BLAST of Homogentisate 1,2-dioxygenase vs. Ensembl Celegans
Match: hgo-1 (Homogentisate 1,2-dioxygenase [Source:UniProtKB/Swiss-Prot;Acc:Q9Y041])

HSP 1 Score: 549.666 bits (1415), Expect = 0.000e+0
Identity = 266/442 (60.18%), Postives = 323/442 (73.08%), Query Frame = 2
Query:  206 RLDSYSYQNGFGNEFSSEHFKYKGSLPNSQNNPQKCTFGLYAEQLSGTAFTAPRHENLRSWLYRILPSVVHDPFKKYSD-APHFTNKFQSTKVNPNQLRWNPFKNDKEFNQTKVDFVNGIRTICGAGDPNIRNAIMIYVYNFNINMTNKAFFNSDGDFLIVPQEGALSVITEFGKFIIAPGEIIVIQQGIRFSVNLLDSQSASGYILEVCGNHFVLPSLGPIGANGLANPRDFQTSVAWFDEESINKNETFTVISKYQGELFTYNQNHTCFDVVAWHGNYVPYKYDLGSFMVINSVSFDHADPSIFTVLTCPSLKPGTALADFVIFPPRWSVQEHTFRPPYYHRNCMAEFMGLIYGNYEAKEKGFLPGGATLHSMMIPHGPDSNCFESASNSHLKSERIADNTLAFMFETSLSLSITDWAQENNVDGDYYKCWQELKKNFIL 1528
              D   Y  GFGNE ++   +   +LP  QN+PQKC+ GLYAEQLSGTAFTAPR +N RSWLYRI PSV+H PF+   +   H+TN F S   NPNQ RWNPF       +  V FV+ + T+CG GD   R  + I+ ++ N +M + A +NSDGDFLIVPQ+GAL + TEFG+ ++ P EI VI QGIRFSV +     + GYILEV G HF LP LGPIGANGLANPRDF+  VAWF++  +     FT+I+KYQG  F   Q H+ FDVV WHGNYVPYKYDL  FMVIN+VSFDH DPSIFTVLT PS+K GTA+ADFVIFPPRW   ++TFRPPYYHRNCM+E+MGLI G YEAKE GF PGG +LHSMM PHGPD NCFE ASN+ LK +R+A+ T++FMFE+SL+++IT+WA   NVD DYYK WQ LKK+F +
Sbjct:    3 EFDELKYLTGFGNEHATSDPRVPDALPVGQNSPQKCSHGLYAEQLSGTAFTAPRSQNQRSWLYRIRPSVIHRPFEAMKENDQHWTNNFSSIPPNPNQYRWNPFPLP---TKEGVTFVDNLYTVCGGGDVISRTGLAIHQFSCNASMEHTAMYNSDGDFLIVPQQGALEITTEFGRLLVNPQEIAVIPQGIRFSVAV--RGPSRGYILEVYGTHFQLPDLGPIGANGLANPRDFEAPVAWFEDLDVE----FTIINKYQGSWFQAKQGHSPFDVVGWHGNYVPYKYDLKKFMVINTVSFDHCDPSIFTVLTAPSVKHGTAIADFVIFPPRWGCADNTFRPPYYHRNCMSEYMGLITGCYEAKEGGFKPGGGSLHSMMTPHGPDFNCFEMASNADLKPQRVAEGTMSFMFESSLNMAITNWAVYQNVDKDYYKDWQPLKKHFTM 435          
BLAST of Homogentisate 1,2-dioxygenase vs. Ensembl Fly
Match: hgo (gene:FBgn0040211 transcript:FBtr0080201)

HSP 1 Score: 592.038 bits (1525), Expect = 0.000e+0
Identity = 284/440 (64.55%), Postives = 335/440 (76.14%), Query Frame = 2
Query:  209 LDSYSYQNGFGNEFSSEHFKYKGSLPNSQNNPQKCTFGLYAEQLSGTAFTAPRHENLRSWLYRILPSVVHDPFKKYSDAPHFTNKFQSTKVNPNQLRWNPFKNDKEFNQTKVDFVNGIRTICGAGDPNIRNAIMIYVYNFNINMTNKAFFNSDGDFLIVPQEGALSVITEFGKFIIAPGEIIVIQQGIRFSVNLLDSQSASGYILEVCGNHFVLPSLGPIGANGLANPRDFQTSVAWFDEESINKNETFTVISKYQGELFTYNQNHTCFDVVAWHGNYVPYKYDLGSFMVINSVSFDHADPSIFTVLTCPSLKPGTALADFVIFPPRWSVQEHTFRPPYYHRNCMAEFMGLIYGNYEAKEKGFLPGGATLHSMMIPHGPDSNCFESASNSHLKSERIADNTLAFMFETSLSLSITDWAQE--NNVDGDYYKCWQELKKNF 1522
            +  Y Y +GFG+ FSSE  +Y  SLP  QN+PQ C + LYAEQLSG+AFTAPR EN+R+WLYR LPS  H PF+ +  A +F+  +     NPNQLRW PF    + +   V+FV G+ T+CGAGDP  R+ + I++Y+ N +M N AF+NSDGDFLIVPQ+G L + TEFG+  +AP EI VI QGIRF+VN+ DS S  GYILEV  +HFVLP LGPIGANGLANPRDF+T VAWFD+  +   + F VISK+QG LF   QNHT FDVVAWHGNYVP+KYDL  FMVINSVSFDH DPSIFTVLTCPSL+ GTA+ADFVIFPPRWSVQEHTFRPPYYHRNCM+EFMGLI G YEAKE GF  GGATLHSMM PHGPD  CFE ASN+ L  ER+A+ T AFMFE+SLSL++T W +E    +D  YY+CWQ LK NF
Sbjct:    1 MSEYKYLSGFGSHFSSEDERYPNSLPVGQNSPQVCPYKLYAEQLSGSAFTAPRTENMRTWLYRKLPSAAHLPFQPFKGAEYFSQNWDEQPPNPNQLRWKPFDLPPK-DGKNVNFVEGLHTVCGAGDPRSRHGLAIHIYSCNGSMDNSAFYNSDGDFLIVPQQGVLDITTEFGRMSVAPNEICVIPQGIRFAVNV-DSPS-RGYILEVYDDHFVLPDLGPIGANGLANPRDFETPVAWFDDRDV---KDFQVISKFQGRLFVAKQNHTVFDVVAWHGNYVPFKYDLSKFMVINSVSFDHCDPSIFTVLTCPSLRAGTAIADFVIFPPRWSVQEHTFRPPYYHRNCMSEFMGLILGKYEAKEDGFAAGGATLHSMMTPHGPDVKCFEGASNAKLVPERVAEGTQAFMFESSLSLAVTKWGEETCQKLDAAYYECWQALKNNF 434          
BLAST of Homogentisate 1,2-dioxygenase vs. Ensembl Zebrafish
Match: hgd (homogentisate 1,2-dioxygenase [Source:ZFIN;Acc:ZDB-GENE-020802-5])

HSP 1 Score: 560.836 bits (1444), Expect = 0.000e+0
Identity = 266/440 (60.45%), Postives = 332/440 (75.45%), Query Frame = 2
Query:  209 LDSYSYQNGFGNEFSSEHFKYKGSLPNSQNNPQKCTFGLYAEQLSGTAFTAPRHENLRSWLYRILPSVVHDPFKKYSDAPHFTNKFQSTKVNPNQLRWNPFKNDKEFNQTKVDFVNGIRTICGAGDPNIRNAIMIYVYNFNINMTNKAFFNSDGDFLIVPQEGALSVITEFGKFIIAPGEIIVIQQGIRFSVNLLDSQSASGYILEVCGNHFVLPSLGPIGANGLANPRDFQTSVAWFDEESINKNETFTVISKYQGELFTYNQNHTCFDVVAWHGNYVPYKYDLGSFMVINSVSFDHADPSIFTVLTCPSLKPGTALADFVIFPPRWSVQEHTFRPPYYHRNCMAEFMGLIYGNYEAKEKGFLPGGATLHSMMIPHGPDSNCFESASNSHLKSERIADNTLAFMFETSLSLSITDWAQE--NNVDGDYYKCWQELKKNF 1522
            +    Y +GFGNEFSSE  +  GSLP  QNNPQ C +GLYAEQLSG+AFT PR  N RSWLYRILPSV H PF + S     T  +   + +PNQLRW PF N  + ++ KVDFV+G+ T+CGAGD   RN I I++Y+ N +MT+K F N+DGDFLIVPQ+G + + TEFGK ++ P EI VIQQG+RFSV++       GYILEV G HF LP LGPIGANGLANPRDFQT VAW+++ +I     +T+++KYQG+LF+  Q+ + F+VVAWHGNY PYKY+L +FMVIN V+FDHADPSIFTVLT  S +PG A+ADFVIFPPRW V +HTFRPPYYHRNCM+EFMGLI G+YEAKE+GF PGG +LHS+M PHGPD +CFE  S + LK ER+A+ T+AFMFE+S S+++T W  E    +D +YYKCW+ LK +F
Sbjct:    1 MAGLKYMSGFGNEFSSEDPRCPGSLPEGQNNPQVCPYGLYAEQLSGSAFTCPRSSNKRSWLYRILPSVRHKPFTRMSCG-DLTENWNEVEPDPNQLRWKPF-NIPKSSEKKVDFVSGLHTVCGAGDSKSRNGIAIHMYSCNTSMTDKCFQNADGDFLIVPQQGEILITTEFGKMMVEPNEICVIQQGMRFSVDVFGE--TRGYILEVFGAHFELPDLGPIGANGLANPRDFQTPVAWYEDRTIATG--YTIVNKYQGKLFSCQQDFSPFNVVAWHGNYAPYKYNLENFMVINCVAFDHADPSIFTVLTAKSTRPGVAIADFVIFPPRWGVADHTFRPPYYHRNCMSEFMGLIKGHYEAKEEGFQPGGGSLHSIMTPHGPDVDCFEKNSTALLKPERVAEGTMAFMFESSFSMAVTKWGLETCQRLDKNYYKCWEALKSHF 434          
BLAST of Homogentisate 1,2-dioxygenase vs. Ensembl Zebrafish
Match: hgd (homogentisate 1,2-dioxygenase [Source:ZFIN;Acc:ZDB-GENE-020802-5])

HSP 1 Score: 545.428 bits (1404), Expect = 0.000e+0
Identity = 266/469 (56.72%), Postives = 332/469 (70.79%), Query Frame = 2
Query:  209 LDSYSYQNGFGNEFSSEHFKYKGSLPNS-----------------------------QNNPQKCTFGLYAEQLSGTAFTAPRHENLRSWLYRILPSVVHDPFKKYSDAPHFTNKFQSTKVNPNQLRWNPFKNDKEFNQTKVDFVNGIRTICGAGDPNIRNAIMIYVYNFNINMTNKAFFNSDGDFLIVPQEGALSVITEFGKFIIAPGEIIVIQQGIRFSVNLLDSQSASGYILEVCGNHFVLPSLGPIGANGLANPRDFQTSVAWFDEESINKNETFTVISKYQGELFTYNQNHTCFDVVAWHGNYVPYKYDLGSFMVINSVSFDHADPSIFTVLTCPSLKPGTALADFVIFPPRWSVQEHTFRPPYYHRNCMAEFMGLIYGNYEAKEKGFLPGGATLHSMMIPHGPDSNCFESASNSHLKSERIADNTLAFMFETSLSLSITDWAQE--NNVDGDYYKCWQELKKNF 1522
            +    Y +GFGNEFSSE  +  GSLP                               QNNPQ C +GLYAEQLSG+AFT PR  N RSWLYRILPSV H PF + S     T  +   + +PNQLRW PF N  + ++ KVDFV+G+ T+CGAGD   RN I I++Y+ N +MT+K F N+DGDFLIVPQ+G + + TEFGK ++ P EI VIQQG+RFSV++       GYILEV G HF LP LGPIGANGLANPRDFQT VAW+++ +I     +T+++KYQG+LF+  Q+ + F+VVAWHGNY PYKY+L +FMVIN V+FDHADPSIFTVLT  S +PG A+ADFVIFPPRW V +HTFRPPYYHRNCM+EFMGLI G+YEAKE+GF PGG +LHS+M PHGPD +CFE  S + LK ER+A+ T+AFMFE+S S+++T W  E    +D +YYKCW+ LK +F
Sbjct:    1 MAGLKYMSGFGNEFSSEDPRCPGSLPEGQVVPKLHLHRLLPDQLTRQTKCSVYIIVFQNNPQVCPYGLYAEQLSGSAFTCPRSSNKRSWLYRILPSVRHKPFTRMSCG-DLTENWNEVEPDPNQLRWKPF-NIPKSSEKKVDFVSGLHTVCGAGDSKSRNGIAIHMYSCNTSMTDKCFQNADGDFLIVPQQGEILITTEFGKMMVEPNEICVIQQGMRFSVDVFG--ETRGYILEVFGAHFELPDLGPIGANGLANPRDFQTPVAWYEDRTIATG--YTIVNKYQGKLFSCQQDFSPFNVVAWHGNYAPYKYNLENFMVINCVAFDHADPSIFTVLTAKSTRPGVAIADFVIFPPRWGVADHTFRPPYYHRNCMSEFMGLIKGHYEAKEEGFQPGGGSLHSIMTPHGPDVDCFEKNSTALLKPERVAEGTMAFMFESSFSMAVTKWGLETCQRLDKNYYKCWEALKSHF 463          
BLAST of Homogentisate 1,2-dioxygenase vs. Ensembl Xenopus
Match: cebpb (CCAAT enhancer binding protein beta [Source:Xenbase;Acc:XB-GENE-479779])

HSP 1 Score: 533.487 bits (1373), Expect = 0.000e+0
Identity = 252/435 (57.93%), Postives = 322/435 (74.02%), Query Frame = 2
Query:  224 YQNGFGNEFSSEHFKYKGSLPNSQNNPQKCTFGLYAEQLSGTAFTAPRHENLRSWLYRILPSVVHDPFKKYSDAPHFTNKFQSTKVNPNQLRWNPFKNDKEFNQTKVDFVNGIRTICGAGDPNIRNAIMIYVYNFNINMTNKAFFNSDGDFLIVPQEGALSVITEFGKFIIAPGEIIVIQQGIRFSVNLLDSQSASGYILEVCGNHFVLPSLGPIGANGLANPRDFQTSVAWFDEESINKNETFTVISKYQGELFTYNQNHTCFDVVAWHGNYVPYKYDLGSFMVINSVSFDHADPSIFTVLTCPSLKPGTALADFVIFPPRWSVQEHTFRPPYYHRNCMAEFMGLIYGNYEAKEKGFLPGGATLHSMMIPHGPDSNCFESASNSHLKSERIADNTLAFMFETSLSLSITDWAQE--NNVDGDYYKCWQELKKNF 1522
            Y +GFGNEFSSE  +  GSLP  QN+PQ C +GLYAEQLSG+AFT PR  N RSW YRILPSV H PF  Y    + T+ +   + +PNQ+RW P++        K DF++G+ T+CGAGD   RN I I++Y  N +M ++  +NSDGDFLIVPQ+G L ++TEFGK ++ P EI VIQQG+RFSV +     A GY+LEV G HF LP LGPIGANGLANPRDF T VAW+++ ++     +TVISKYQG+LF+  Q+ + F+VVAWHGNY PYKY+L +FMVIN V+FDHADPSIFTVL   SL+PG A+ADFVIFPPR    +H FRPP++ RNCM+EFMGLI G+YEAKE+GF PGG +LHS+M PHGPD+ CFE AS + L+ ER+A+ T+AFMFE+SLS+++T W  E    +D +YY+CW+ L+  F
Sbjct:    2 YLSGFGNEFSSEDPRCPGSLPEGQNSPQVCPYGLYAEQLSGSAFTCPRSTNKRSWFYRILPSVRHKPFVTYEQK-NLTHNWDEVEPDPNQMRWKPYQIPTAAAH-KQDFIDGLYTLCGAGDTRSRNGIAIHIYTANTSMIDRCLYNSDGDFLIVPQQGKLLILTEFGKLLVEPNEICVIQQGMRFSVEVFGE--ARGYVLEVFGVHFELPDLGPIGANGLANPRDFLTPVAWYEDRTVEAG--YTVISKYQGKLFSSEQDFSPFNVVAWHGNYAPYKYNLENFMVINCVAFDHADPSIFTVLXXKSLRPGVAIADFVIFPPRGGGADHPFRPPFFPRNCMSEFMGLIKGHYEAKEEGFQPGGGSLHSVMTPHGPDAGCFEKASKAKLEPERVAEGTMAFMFESSLSMAVTKWGMETCQRLDKNYYQCWESLRSYF 430          
BLAST of Homogentisate 1,2-dioxygenase vs. Ensembl Xenopus
Match: cebpb (CCAAT enhancer binding protein beta [Source:Xenbase;Acc:XB-GENE-479779])

HSP 1 Score: 516.538 bits (1329), Expect = 8.264e-180
Identity = 249/442 (56.33%), Postives = 319/442 (72.17%), Query Frame = 2
Query:  203 HRLDSYSYQNGFGNEFSSEHFKYKGSLPNSQNNPQKCTFGLYAEQLSGTAFTAPRHENLRSWLYRILPSVVHDPFKKYSDAPHFTNKFQSTKVNPNQLRWNPFKNDKEFNQTKVDFVNGIRTICGAGDPNIRNAIMIYVYNFNINMTNKAFFNSDGDFLIVPQEGALSVITEFGKFIIAPGEIIVIQQGIRFSVNLLDSQSASGYILEVCGNHFVLPSLGPIGANGLANPRDFQTSVAWFDEESINKNETFTVISKYQGELFTYNQNHTCFDVVAWHGNYVPYKYDLGSFMVINSVSFDHADPSIFTVLTCPSLKPGTALADFVIFPPRWSVQEHTFRPPYYHRNCMAEFMGLIYGNYEAKEKGFLPGGATLHSMMIPHGPDSNCFESASNSHLKSERIADNTLAFMFETSLSLSITDWAQE--NNVDGDYYKCWQELKKNF 1522
              L   SY +GFGNEFSSE  +  GSLP  QN+PQ C +GLYAEQLSG+AFT PR  N RSW YRILPSV H PF  Y    + T+ +   + +PNQ+RW P++        K DF++G+ T+CGAGD   RN I I++Y  N +M ++  +NSDGDFLIVPQ+G L ++TEFGK ++ P EI VIQQG+RFSV +     A GY+LEV G HF LP LGPIGANGLANPRDF T VAW+++ ++     +TVISKYQG+LF+  Q+ + F+VVAWHGNY PYKY+L +FMVIN V+FDHA     TV T  SL+PG A+ADFVIFPPR    +H FRPP++ RNCM+EFMGLI G+YEAKE+GF PGG +LHS+M PHGPD+ CFE AS + L+ ER+A+ T+AFMFE+SLS+++T W  E    +D +YY+CW+ L+  F
Sbjct:    2 QELTICSYLSGFGNEFSSEDPRCPGSLPEGQNSPQVCPYGLYAEQLSGSAFTCPRSTNKRSWFYRILPSVRHKPFVTYEQK-NLTHNWDEVEPDPNQMRWKPYQIPTAAAH-KQDFIDGLYTLCGAGDTRSRNGIAIHIYTANTSMIDRCLYNSDGDFLIVPQQGKLLILTEFGKLLVEPNEICVIQQGMRFSVEVFGE--ARGYVLEVFGVHFELPDLGPIGANGLANPRDFLTPVAWYEDRTVEAG--YTVISKYQGKLFSSEQDFSPFNVVAWHGNYAPYKYNLENFMVINCVAFDHAVGLGVTVPT--SLRPGVAIADFVIFPPRGGGADHPFRPPFFPRNCMSEFMGLIKGHYEAKEEGFQPGGGSLHSVMTPHGPDAGCFEKASKAKLEPERVAEGTMAFMFESSLSMAVTKWGMETCQRLDKNYYQCWESLRSYF 435          
BLAST of Homogentisate 1,2-dioxygenase vs. Ensembl Xenopus
Match: cebpb (CCAAT enhancer binding protein beta [Source:Xenbase;Acc:XB-GENE-479779])

HSP 1 Score: 514.227 bits (1323), Expect = 6.658e-179
Identity = 247/435 (56.78%), Postives = 317/435 (72.87%), Query Frame = 2
Query:  224 YQNGFGNEFSSEHFKYKGSLPNSQNNPQKCTFGLYAEQLSGTAFTAPRHENLRSWLYRILPSVVHDPFKKYSDAPHFTNKFQSTKVNPNQLRWNPFKNDKEFNQTKVDFVNGIRTICGAGDPNIRNAIMIYVYNFNINMTNKAFFNSDGDFLIVPQEGALSVITEFGKFIIAPGEIIVIQQGIRFSVNLLDSQSASGYILEVCGNHFVLPSLGPIGANGLANPRDFQTSVAWFDEESINKNETFTVISKYQGELFTYNQNHTCFDVVAWHGNYVPYKYDLGSFMVINSVSFDHADPSIFTVLTCPSLKPGTALADFVIFPPRWSVQEHTFRPPYYHRNCMAEFMGLIYGNYEAKEKGFLPGGATLHSMMIPHGPDSNCFESASNSHLKSERIADNTLAFMFETSLSLSITDWAQE--NNVDGDYYKCWQELKKNF 1522
            Y +GFGNEFSSE  +  GSLP  QN+PQ C +GLYAEQLSG+AFT PR  N RSW YRILPSV H PF  Y    + T+ +   + +PNQ+RW P++        K DF++G+ T+CGAGD   RN I I++Y  N +M ++  +NSDGDFLIVPQ+G L ++TEFGK ++ P EI VIQQG+RFSV +     A GY+LEV G HF LP LGPIGANGLANPRDF T VAW+++ ++     +TVISKYQG+LF+  Q+ + F+VVAWHGNY PYKY+L +FMVIN V+FDHA     TV T  SL+PG A+ADFVIFPPR    +H FRPP++ RNCM+EFMGLI G+YEAKE+GF PGG +LHS+M PHGPD+ CFE AS + L+ ER+A+ T+AFMFE+SLS+++T W  E    +D +YY+CW+ L+  F
Sbjct:    7 YLSGFGNEFSSEDPRCPGSLPEGQNSPQVCPYGLYAEQLSGSAFTCPRSTNKRSWFYRILPSVRHKPFVTYEQK-NLTHNWDEVEPDPNQMRWKPYQIPTAAAH-KQDFIDGLYTLCGAGDTRSRNGIAIHIYTANTSMIDRCLYNSDGDFLIVPQQGKLLILTEFGKLLVEPNEICVIQQGMRFSVEVFGE--ARGYVLEVFGVHFELPDLGPIGANGLANPRDFLTPVAWYEDRTVEAG--YTVISKYQGKLFSSEQDFSPFNVVAWHGNYAPYKYNLENFMVINCVAFDHAVGLGVTVPT--SLRPGVAIADFVIFPPRGGGADHPFRPPFFPRNCMSEFMGLIKGHYEAKEEGFQPGGGSLHSVMTPHGPDAGCFEKASKAKLEPERVAEGTMAFMFESSLSMAVTKWGMETCQRLDKNYYQCWESLRSYF 433          
BLAST of Homogentisate 1,2-dioxygenase vs. Ensembl Xenopus
Match: cebpb (CCAAT enhancer binding protein beta [Source:Xenbase;Acc:XB-GENE-479779])

HSP 1 Score: 512.686 bits (1319), Expect = 2.115e-178
Identity = 246/433 (56.81%), Postives = 316/433 (72.98%), Query Frame = 2
Query:  230 NGFGNEFSSEHFKYKGSLPNSQNNPQKCTFGLYAEQLSGTAFTAPRHENLRSWLYRILPSVVHDPFKKYSDAPHFTNKFQSTKVNPNQLRWNPFKNDKEFNQTKVDFVNGIRTICGAGDPNIRNAIMIYVYNFNINMTNKAFFNSDGDFLIVPQEGALSVITEFGKFIIAPGEIIVIQQGIRFSVNLLDSQSASGYILEVCGNHFVLPSLGPIGANGLANPRDFQTSVAWFDEESINKNETFTVISKYQGELFTYNQNHTCFDVVAWHGNYVPYKYDLGSFMVINSVSFDHADPSIFTVLTCPSLKPGTALADFVIFPPRWSVQEHTFRPPYYHRNCMAEFMGLIYGNYEAKEKGFLPGGATLHSMMIPHGPDSNCFESASNSHLKSERIADNTLAFMFETSLSLSITDWAQE--NNVDGDYYKCWQELKKNF 1522
            +GFGNEFSSE  +  GSLP  QN+PQ C +GLYAEQLSG+AFT PR  N RSW YRILPSV H PF  Y    + T+ +   + +PNQ+RW P++        K DF++G+ T+CGAGD   RN I I++Y  N +M ++  +NSDGDFLIVPQ+G L ++TEFGK ++ P EI VIQQG+RFSV +     A GY+LEV G HF LP LGPIGANGLANPRDF T VAW+++ ++     +TVISKYQG+LF+  Q+ + F+VVAWHGNY PYKY+L +FMVIN V+FDHA     TV T  SL+PG A+ADFVIFPPR    +H FRPP++ RNCM+EFMGLI G+YEAKE+GF PGG +LHS+M PHGPD+ CFE AS + L+ ER+A+ T+AFMFE+SLS+++T W  E    +D +YY+CW+ L+  F
Sbjct:    5 HGFGNEFSSEDPRCPGSLPEGQNSPQVCPYGLYAEQLSGSAFTCPRSTNKRSWFYRILPSVRHKPFVTYEQK-NLTHNWDEVEPDPNQMRWKPYQIPTAAAH-KQDFIDGLYTLCGAGDTRSRNGIAIHIYTANTSMIDRCLYNSDGDFLIVPQQGKLLILTEFGKLLVEPNEICVIQQGMRFSVEVFGE--ARGYVLEVFGVHFELPDLGPIGANGLANPRDFLTPVAWYEDRTVEAG--YTVISKYQGKLFSSEQDFSPFNVVAWHGNYAPYKYNLENFMVINCVAFDHAVGLGVTVPT--SLRPGVAIADFVIFPPRGGGADHPFRPPFFPRNCMSEFMGLIKGHYEAKEEGFQPGGGSLHSVMTPHGPDAGCFEKASKAKLEPERVAEGTMAFMFESSLSMAVTKWGMETCQRLDKNYYQCWESLRSYF 429          
BLAST of Homogentisate 1,2-dioxygenase vs. Ensembl Xenopus
Match: cebpb (CCAAT enhancer binding protein beta [Source:Xenbase;Acc:XB-GENE-479779])

HSP 1 Score: 502.286 bits (1292), Expect = 6.506e-174
Identity = 247/456 (54.17%), Postives = 318/456 (69.74%), Query Frame = 2
Query:  224 YQNGFGNEFSSEHFKYKGSLPNSQ---------------------NNPQKCTFGLYAEQLSGTAFTAPRHENLRSWLYRILPSVVHDPFKKYSDAPHFTNKFQSTKVNPNQLRWNPFKNDKEFNQTKVDFVNGIRTICGAGDPNIRNAIMIYVYNFNINMTNKAFFNSDGDFLIVPQEGALSVITEFGKFIIAPGEIIVIQQGIRFSVNLLDSQSASGYILEVCGNHFVLPSLGPIGANGLANPRDFQTSVAWFDEESINKNETFTVISKYQGELFTYNQNHTCFDVVAWHGNYVPYKYDLGSFMVINSVSFDHADPSIFTVLTCPSLKPGTALADFVIFPPRWSVQEHTFRPPYYHRNCMAEFMGLIYGNYEAKEKGFLPGGATLHSMMIPHGPDSNCFESASNSHLKSERIADNTLAFMFETSLSLSITDWAQE--NNVDGDYYKCWQELKKNF 1522
            Y +GFGNEFSSE  +  GSLP  Q                     N+PQ C +GLYAEQLSG+AFT PR  N RSW YRILPSV H PF  Y +  + T+ +   + +PNQ+RW P++        K DF++G+ T+CGAGD   RN I I++Y  N +M ++  +NSDGDFLIVPQ+G L ++TEFGK ++ P EI VIQQG+RFSV +     A GY+LEV G HF LP LGPIGANGLANPRDF T VAW+++ ++     +TVISKYQG+LF+  Q+ + F+VVAWHGNY PYKY+L +FMVIN V+FDHA     TV T  SL+PG A+ADFVIFPPR    +H FRPP++ RNCM+EFMGLI G+YEAKE+GF PGG +LHS+M PHGPD+ CFE AS + L+ ER+A+ T+AFMFE+SLS+++T W  E    +D +YY+CW+ L+  F
Sbjct:    2 YLSGFGNEFSSEDPRCPGSLPEGQVGSNGINWASDQSTCCFISPQNSPQVCPYGLYAEQLSGSAFTCPRSTNKRSWFYRILPSVRHKPFVTY-EQKNLTHNWDEVEPDPNQMRWKPYQIPTAAAH-KQDFIDGLYTLCGAGDTRSRNGIAIHIYTANTSMIDRCLYNSDGDFLIVPQQGKLLILTEFGKLLVEPNEICVIQQGMRFSVEVFGE--ARGYVLEVFGVHFELPDLGPIGANGLANPRDFLTPVAWYEDRTVEAG--YTVISKYQGKLFSSEQDFSPFNVVAWHGNYAPYKYNLENFMVINCVAFDHAVGLGVTVPT--SLRPGVAIADFVIFPPRGGGADHPFRPPFFPRNCMSEFMGLIKGHYEAKEEGFQPGGGSLHSVMTPHGPDAGCFEKASKAKLEPERVAEGTMAFMFESSLSMAVTKWGMETCQRLDKNYYQCWESLRSYF 449          
BLAST of Homogentisate 1,2-dioxygenase vs. Ensembl Mouse
Match: Hgd (homogentisate 1, 2-dioxygenase [Source:MGI Symbol;Acc:MGI:96078])

HSP 1 Score: 541.191 bits (1393), Expect = 0.000e+0
Identity = 260/440 (59.09%), Postives = 330/440 (75.00%), Query Frame = 2
Query:  209 LDSYSYQNGFGNEFSSEHFKYKGSLPNSQNNPQKCTFGLYAEQLSGTAFTAPRHENLRSWLYRILPSVVHDPFKKYSDAPHFTNKFQSTKVNPNQLRWNPFKNDKEFNQTKVDFVNGIRTICGAGDPNIRNAIMIYVYNFNINMTNKAFFNSDGDFLIVPQEGALSVITEFGKFIIAPGEIIVIQQGIRFSVNLLDSQSASGYILEVCGNHFVLPSLGPIGANGLANPRDFQTSVAWFDEESINKNETFTVISKYQGELFTYNQNHTCFDVVAWHGNYVPYKYDLGSFMVINSVSFDHADPSIFTVLTCPSLKPGTALADFVIFPPRWSVQEHTFRPPYYHRNCMAEFMGLIYGNYEAKEKGFLPGGATLHSMMIPHGPDSNCFESASNSHLKSERIADNTLAFMFETSLSLSITDWAQE--NNVDGDYYKCWQELKKNF 1522
            +    Y +GFGNE +SE  +  GSLP  QNNPQ C + LYAEQLSG+AFT PR+ N RSWLYRILPSV H PF+   D  H T+ +     +PNQLRW PF+  K  ++ KVDFV+G+ T+CGAGD    N + ++++  N +M N+ F+NSDGDFLIVPQ+G L + TEFGK  + P EI VIQ+G+RFSV++   +   GYILEV G HF LP LGPIGANGLANPRDF   VAW+++  +     +TVI+K+QG+LF   Q+ + F+VVAWHGNY PYKY+L +FMVIN+V+FDHADPSIFTVLT  SL+PG A+ADFVIFPPRW V + TFRPPYYHRNCM+EFMGLI G+YEAK+ GFLPGG +LHS M PHGPD++CFE AS + L+ ERIAD T+AFMFE+SLSL++T W  +  + +D +YYKCW+ L+ +F
Sbjct:    1 MAELKYISGFGNECASEDPRCPGSLPKGQNNPQVCPYNLYAEQLSGSAFTCPRNTNKRSWLYRILPSVSHKPFESI-DQGHVTHNWDEVGPDPNQLRWKPFEIPKA-SEKKVDFVSGLYTLCGAGDIKSNNGLAVHIFLCNSSMENRCFYNSDGDFLIVPQKGKLLIYTEFGKMSLQPNEICVIQRGMRFSVDVF--EETRGYILEVYGVHFELPDLGPIGANGLANPRDFLIPVAWYEDRRVPGG--YTVINKFQGKLFACKQDVSPFNVVAWHGNYTPYKYNLENFMVINAVAFDHADPSIFTVLTAKSLRPGVAIADFVIFPPRWGVADKTFRPPYYHRNCMSEFMGLIKGHYEAKQGGFLPGGGSLHSAMTPHGPDADCFEKASKAKLEPERIADGTMAFMFESSLSLAVTKWGLKTCSCLDENYYKCWEPLRSHF 434          
BLAST of Homogentisate 1,2-dioxygenase vs. Ensembl Mouse
Match: Hgd (homogentisate 1, 2-dioxygenase [Source:MGI Symbol;Acc:MGI:96078])

HSP 1 Score: 476.478 bits (1225), Expect = 8.203e-165
Identity = 227/382 (59.42%), Postives = 290/382 (75.92%), Query Frame = 2
Query:  383 SWLYRILPSVVHDPFKKYSDAPHFTNKFQSTKVNPNQLRWNPFKNDKEFNQTKVDFVNGIRTICGAGDPNIRNAIMIYVYNFNINMTNKAFFNSDGDFLIVPQEGALSVITEFGKFIIAPGEIIVIQQGIRFSVNLLDSQSASGYILEVCGNHFVLPSLGPIGANGLANPRDFQTSVAWFDEESINKNETFTVISKYQGELFTYNQNHTCFDVVAWHGNYVPYKYDLGSFMVINSVSFDHADPSIFTVLTCPSLKPGTALADFVIFPPRWSVQEHTFRPPYYHRNCMAEFMGLIYGNYEAKEKGFLPGGATLHSMMIPHGPDSNCFESASNSHLKSERIADNTLAFMFETSLSLSITDWAQE--NNVDGDYYKCWQELKKNF 1522
            SWLYRILPSV H PF+   D  H T+ +     +PNQLRW PF+  K  ++ KVDFV+G+ T+CGAGD    N + ++++  N +M N+ F+NSDGDFLIVPQ+G L + TEFGK  + P EI VIQ+G+RFSV++   +   GYILEV G HF LP LGPIGANGLANPRDF   VAW+++  +     +TVI+K+QG+LF   Q+ + F+VVAWHGNY PYKY+L +FMVIN+V+FDHADPSIFTVLT  SL+PG A+ADFVIFPPRW V + TFRPPYYHRNCM+EFMGLI G+YEAK+ GFLPGG +LHS M PHGPD++CFE AS + L+ ERIAD T+AFMFE+SLSL++T W  +  + +D +YYKCW+ L+ +F
Sbjct:   18 SWLYRILPSVSHKPFESI-DQGHVTHNWDEVGPDPNQLRWKPFEIPKA-SEKKVDFVSGLYTLCGAGDIKSNNGLAVHIFLCNSSMENRCFYNSDGDFLIVPQKGKLLIYTEFGKMSLQPNEICVIQRGMRFSVDVF--EETRGYILEVYGVHFELPDLGPIGANGLANPRDFLIPVAWYEDRRVPGG--YTVINKFQGKLFACKQDVSPFNVVAWHGNYTPYKYNLENFMVINAVAFDHADPSIFTVLTAKSLRPGVAIADFVIFPPRWGVADKTFRPPYYHRNCMSEFMGLIKGHYEAKQGGFLPGGGSLHSAMTPHGPDADCFEKASKAKLEPERIADGTMAFMFESSLSLAVTKWGLKTCSCLDENYYKCWEPLRSHF 393          
BLAST of Homogentisate 1,2-dioxygenase vs. UniProt/SwissProt
Match: sp|Q9VKJ0|HGD_DROME (Homogentisate 1,2-dioxygenase OS=Drosophila melanogaster OX=7227 GN=hgo PE=2 SV=3)

HSP 1 Score: 592.038 bits (1525), Expect = 0.000e+0
Identity = 284/440 (64.55%), Postives = 335/440 (76.14%), Query Frame = 2
Query:  209 LDSYSYQNGFGNEFSSEHFKYKGSLPNSQNNPQKCTFGLYAEQLSGTAFTAPRHENLRSWLYRILPSVVHDPFKKYSDAPHFTNKFQSTKVNPNQLRWNPFKNDKEFNQTKVDFVNGIRTICGAGDPNIRNAIMIYVYNFNINMTNKAFFNSDGDFLIVPQEGALSVITEFGKFIIAPGEIIVIQQGIRFSVNLLDSQSASGYILEVCGNHFVLPSLGPIGANGLANPRDFQTSVAWFDEESINKNETFTVISKYQGELFTYNQNHTCFDVVAWHGNYVPYKYDLGSFMVINSVSFDHADPSIFTVLTCPSLKPGTALADFVIFPPRWSVQEHTFRPPYYHRNCMAEFMGLIYGNYEAKEKGFLPGGATLHSMMIPHGPDSNCFESASNSHLKSERIADNTLAFMFETSLSLSITDWAQE--NNVDGDYYKCWQELKKNF 1522
            +  Y Y +GFG+ FSSE  +Y  SLP  QN+PQ C + LYAEQLSG+AFTAPR EN+R+WLYR LPS  H PF+ +  A +F+  +     NPNQLRW PF    + +   V+FV G+ T+CGAGDP  R+ + I++Y+ N +M N AF+NSDGDFLIVPQ+G L + TEFG+  +AP EI VI QGIRF+VN+ DS S  GYILEV  +HFVLP LGPIGANGLANPRDF+T VAWFD+  +   + F VISK+QG LF   QNHT FDVVAWHGNYVP+KYDL  FMVINSVSFDH DPSIFTVLTCPSL+ GTA+ADFVIFPPRWSVQEHTFRPPYYHRNCM+EFMGLI G YEAKE GF  GGATLHSMM PHGPD  CFE ASN+ L  ER+A+ T AFMFE+SLSL++T W +E    +D  YY+CWQ LK NF
Sbjct:    1 MSEYKYLSGFGSHFSSEDERYPNSLPVGQNSPQVCPYKLYAEQLSGSAFTAPRTENMRTWLYRKLPSAAHLPFQPFKGAEYFSQNWDEQPPNPNQLRWKPFDLPPK-DGKNVNFVEGLHTVCGAGDPRSRHGLAIHIYSCNGSMDNSAFYNSDGDFLIVPQQGVLDITTEFGRMSVAPNEICVIPQGIRFAVNV-DSPS-RGYILEVYDDHFVLPDLGPIGANGLANPRDFETPVAWFDDRDV---KDFQVISKFQGRLFVAKQNHTVFDVVAWHGNYVPFKYDLSKFMVINSVSFDHCDPSIFTVLTCPSLRAGTAIADFVIFPPRWSVQEHTFRPPYYHRNCMSEFMGLILGKYEAKEDGFAAGGATLHSMMTPHGPDVKCFEGASNAKLVPERVAEGTQAFMFESSLSLAVTKWGEETCQKLDAAYYECWQALKNNF 434          
BLAST of Homogentisate 1,2-dioxygenase vs. UniProt/SwissProt
Match: sp|Q9Y041|HGD_CAEEL (Homogentisate 1,2-dioxygenase OS=Caenorhabditis elegans OX=6239 GN=hgo-1 PE=2 SV=2)

HSP 1 Score: 549.666 bits (1415), Expect = 0.000e+0
Identity = 266/442 (60.18%), Postives = 323/442 (73.08%), Query Frame = 2
Query:  206 RLDSYSYQNGFGNEFSSEHFKYKGSLPNSQNNPQKCTFGLYAEQLSGTAFTAPRHENLRSWLYRILPSVVHDPFKKYSD-APHFTNKFQSTKVNPNQLRWNPFKNDKEFNQTKVDFVNGIRTICGAGDPNIRNAIMIYVYNFNINMTNKAFFNSDGDFLIVPQEGALSVITEFGKFIIAPGEIIVIQQGIRFSVNLLDSQSASGYILEVCGNHFVLPSLGPIGANGLANPRDFQTSVAWFDEESINKNETFTVISKYQGELFTYNQNHTCFDVVAWHGNYVPYKYDLGSFMVINSVSFDHADPSIFTVLTCPSLKPGTALADFVIFPPRWSVQEHTFRPPYYHRNCMAEFMGLIYGNYEAKEKGFLPGGATLHSMMIPHGPDSNCFESASNSHLKSERIADNTLAFMFETSLSLSITDWAQENNVDGDYYKCWQELKKNFIL 1528
              D   Y  GFGNE ++   +   +LP  QN+PQKC+ GLYAEQLSGTAFTAPR +N RSWLYRI PSV+H PF+   +   H+TN F S   NPNQ RWNPF       +  V FV+ + T+CG GD   R  + I+ ++ N +M + A +NSDGDFLIVPQ+GAL + TEFG+ ++ P EI VI QGIRFSV +     + GYILEV G HF LP LGPIGANGLANPRDF+  VAWF++  +     FT+I+KYQG  F   Q H+ FDVV WHGNYVPYKYDL  FMVIN+VSFDH DPSIFTVLT PS+K GTA+ADFVIFPPRW   ++TFRPPYYHRNCM+E+MGLI G YEAKE GF PGG +LHSMM PHGPD NCFE ASN+ LK +R+A+ T++FMFE+SL+++IT+WA   NVD DYYK WQ LKK+F +
Sbjct:    3 EFDELKYLTGFGNEHATSDPRVPDALPVGQNSPQKCSHGLYAEQLSGTAFTAPRSQNQRSWLYRIRPSVIHRPFEAMKENDQHWTNNFSSIPPNPNQYRWNPFPLP---TKEGVTFVDNLYTVCGGGDVISRTGLAIHQFSCNASMEHTAMYNSDGDFLIVPQQGALEITTEFGRLLVNPQEIAVIPQGIRFSVAV--RGPSRGYILEVYGTHFQLPDLGPIGANGLANPRDFEAPVAWFEDLDVE----FTIINKYQGSWFQAKQGHSPFDVVGWHGNYVPYKYDLKKFMVINTVSFDHCDPSIFTVLTAPSVKHGTAIADFVIFPPRWGCADNTFRPPYYHRNCMSEYMGLITGCYEAKEGGFKPGGGSLHSMMTPHGPDFNCFEMASNADLKPQRVAEGTMSFMFESSLNMAITNWAVYQNVDKDYYKDWQPLKKHFTM 435          
BLAST of Homogentisate 1,2-dioxygenase vs. UniProt/SwissProt
Match: sp|Q93099|HGD_HUMAN (Homogentisate 1,2-dioxygenase OS=Homo sapiens OX=9606 GN=HGD PE=1 SV=2)

HSP 1 Score: 543.117 bits (1398), Expect = 0.000e+0
Identity = 261/440 (59.32%), Postives = 327/440 (74.32%), Query Frame = 2
Query:  209 LDSYSYQNGFGNEFSSEHFKYKGSLPNSQNNPQKCTFGLYAEQLSGTAFTAPRHENLRSWLYRILPSVVHDPFKKYSDAPHFTNKFQSTKVNPNQLRWNPFKNDKEFNQTKVDFVNGIRTICGAGDPNIRNAIMIYVYNFNINMTNKAFFNSDGDFLIVPQEGALSVITEFGKFIIAPGEIIVIQQGIRFSVNLLDSQSASGYILEVCGNHFVLPSLGPIGANGLANPRDFQTSVAWFDEESINKNETFTVISKYQGELFTYNQNHTCFDVVAWHGNYVPYKYDLGSFMVINSVSFDHADPSIFTVLTCPSLKPGTALADFVIFPPRWSVQEHTFRPPYYHRNCMAEFMGLIYGNYEAKEKGFLPGGATLHSMMIPHGPDSNCFESASNSHLKSERIADNTLAFMFETSLSLSITDWAQENN--VDGDYYKCWQELKKNF 1522
            +    Y +GFGNE SSE  +  GSLP  QNNPQ C + LYAEQLSG+AFT PR  N RSWLYRILPSV H PF+   D    T+ +     +PNQLRW PF+  K  +Q KVDFV+G+ T+CGAGD    N + I+++  N +M N+ F+NSDGDFLIVPQ+G L + TEFGK ++ P EI VIQ+G+RFS+++   +   GYILEV G HF LP LGPIGANGLANPRDF   +AW+++  +     +TVI+KYQG+LF   Q+ + F+VVAWHGNY PYKY+L +FMVINSV+FDHADPSIFTVLT  S++PG A+ADFVIFPPRW V + TFRPPYYHRNCM+EFMGLI G+YEAK+ GFLPGG +LHS M PHGPD++CFE AS   L  ERIAD T+AFMFE+SLSL++T W  + +  +D +Y+KCW+ LK +F
Sbjct:    1 MAELKYISGFGNECSSEDPRCPGSLPEGQNNPQVCPYNLYAEQLSGSAFTCPRSTNKRSWLYRILPSVSHKPFESI-DEGQVTHNWDEVDPDPNQLRWKPFEIPKA-SQKKVDFVSGLHTLCGAGDIKSNNGLAIHIFLCNTSMENRCFYNSDGDFLIVPQKGNLLIYTEFGKMLVQPNEICVIQRGMRFSIDVF--EETRGYILEVYGVHFELPDLGPIGANGLANPRDFLIPIAWYEDRQVPGG--YTVINKYQGKLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDHADPSIFTVLTAKSVRPGVAIADFVIFPPRWGVADKTFRPPYYHRNCMSEFMGLIRGHYEAKQGGFLPGGGSLHSTMTPHGPDADCFEKASKVKLAPERIADGTMAFMFESSLSLAVTKWGLKASRCLDENYHKCWEPLKSHF 434          
BLAST of Homogentisate 1,2-dioxygenase vs. UniProt/SwissProt
Match: sp|Q5RF05|HGD_PONAB (Homogentisate 1,2-dioxygenase OS=Pongo abelii OX=9601 GN=HGD PE=2 SV=1)

HSP 1 Score: 541.576 bits (1394), Expect = 0.000e+0
Identity = 261/440 (59.32%), Postives = 325/440 (73.86%), Query Frame = 2
Query:  209 LDSYSYQNGFGNEFSSEHFKYKGSLPNSQNNPQKCTFGLYAEQLSGTAFTAPRHENLRSWLYRILPSVVHDPFKKYSDAPHFTNKFQSTKVNPNQLRWNPFKNDKEFNQTKVDFVNGIRTICGAGDPNIRNAIMIYVYNFNINMTNKAFFNSDGDFLIVPQEGALSVITEFGKFIIAPGEIIVIQQGIRFSVNLLDSQSASGYILEVCGNHFVLPSLGPIGANGLANPRDFQTSVAWFDEESINKNETFTVISKYQGELFTYNQNHTCFDVVAWHGNYVPYKYDLGSFMVINSVSFDHADPSIFTVLTCPSLKPGTALADFVIFPPRWSVQEHTFRPPYYHRNCMAEFMGLIYGNYEAKEKGFLPGGATLHSMMIPHGPDSNCFESASNSHLKSERIADNTLAFMFETSLSLSITDWAQENN--VDGDYYKCWQELKKNF 1522
            +    Y +GFGNE SSE  +  GSLP  QNNPQ C + LYAEQLSG+AFT PR  N RSWLYRI PSV H PF+   D  H T+ +     +PNQLRW PF+  K  +Q KVD V+G+ T+CGAGD    N + I+++  N +M N+ F+NSDGDFLIVPQ+G L + TEFGK ++ P EI VIQ+G+RFS+++   +   GYILEV G HF LP LGPIGANGLANPRDF   VAW+++  +     +TVI KYQG+LF   Q  + F+VVAWHGNY PYKY+L +FMVINSV+FDHADPSIFTVLT  S++PG A+ADFVIFPPRW V + TFRPPYYHRNCM+EFMGLI G+YEAK+ GFLPGG +LHS M PHGPD++CFE AS + L  ERIAD T+AFMFE+SLSL++T W  + +  +D +Y+KCW+ LK +F
Sbjct:    1 MAQLKYISGFGNECSSEDPRCPGSLPEGQNNPQVCPYNLYAEQLSGSAFTCPRSTNKRSWLYRIPPSVSHKPFESI-DEGHVTHNWDEVDPDPNQLRWKPFEIPK-VSQKKVDLVSGLHTLCGAGDIKSNNGLAIHIFLCNTSMENRCFYNSDGDFLIVPQKGNLLIYTEFGKMLVQPNEICVIQRGMRFSIDVF--EETRGYILEVYGVHFELPDLGPIGANGLANPRDFLIPVAWYEDRQVPGG--YTVIDKYQGKLFAAKQGVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDHADPSIFTVLTAKSVRPGVAIADFVIFPPRWGVADKTFRPPYYHRNCMSEFMGLIRGHYEAKQGGFLPGGGSLHSTMTPHGPDADCFEKASKAKLAPERIADGTMAFMFESSLSLAVTKWGLKASRCLDENYHKCWEPLKSHF 434          
BLAST of Homogentisate 1,2-dioxygenase vs. UniProt/SwissProt
Match: sp|O09173|HGD_MOUSE (Homogentisate 1,2-dioxygenase OS=Mus musculus OX=10090 GN=Hgd PE=1 SV=2)

HSP 1 Score: 541.191 bits (1393), Expect = 0.000e+0
Identity = 260/440 (59.09%), Postives = 330/440 (75.00%), Query Frame = 2
Query:  209 LDSYSYQNGFGNEFSSEHFKYKGSLPNSQNNPQKCTFGLYAEQLSGTAFTAPRHENLRSWLYRILPSVVHDPFKKYSDAPHFTNKFQSTKVNPNQLRWNPFKNDKEFNQTKVDFVNGIRTICGAGDPNIRNAIMIYVYNFNINMTNKAFFNSDGDFLIVPQEGALSVITEFGKFIIAPGEIIVIQQGIRFSVNLLDSQSASGYILEVCGNHFVLPSLGPIGANGLANPRDFQTSVAWFDEESINKNETFTVISKYQGELFTYNQNHTCFDVVAWHGNYVPYKYDLGSFMVINSVSFDHADPSIFTVLTCPSLKPGTALADFVIFPPRWSVQEHTFRPPYYHRNCMAEFMGLIYGNYEAKEKGFLPGGATLHSMMIPHGPDSNCFESASNSHLKSERIADNTLAFMFETSLSLSITDWAQE--NNVDGDYYKCWQELKKNF 1522
            +    Y +GFGNE +SE  +  GSLP  QNNPQ C + LYAEQLSG+AFT PR+ N RSWLYRILPSV H PF+   D  H T+ +     +PNQLRW PF+  K  ++ KVDFV+G+ T+CGAGD    N + ++++  N +M N+ F+NSDGDFLIVPQ+G L + TEFGK  + P EI VIQ+G+RFSV++   +   GYILEV G HF LP LGPIGANGLANPRDF   VAW+++  +     +TVI+K+QG+LF   Q+ + F+VVAWHGNY PYKY+L +FMVIN+V+FDHADPSIFTVLT  SL+PG A+ADFVIFPPRW V + TFRPPYYHRNCM+EFMGLI G+YEAK+ GFLPGG +LHS M PHGPD++CFE AS + L+ ERIAD T+AFMFE+SLSL++T W  +  + +D +YYKCW+ L+ +F
Sbjct:    1 MAELKYISGFGNECASEDPRCPGSLPKGQNNPQVCPYNLYAEQLSGSAFTCPRNTNKRSWLYRILPSVSHKPFESI-DQGHVTHNWDEVGPDPNQLRWKPFEIPKA-SEKKVDFVSGLYTLCGAGDIKSNNGLAVHIFLCNSSMENRCFYNSDGDFLIVPQKGKLLIYTEFGKMSLQPNEICVIQRGMRFSVDVF--EETRGYILEVYGVHFELPDLGPIGANGLANPRDFLIPVAWYEDRRVPGG--YTVINKFQGKLFACKQDVSPFNVVAWHGNYTPYKYNLENFMVINAVAFDHADPSIFTVLTAKSLRPGVAIADFVIFPPRWGVADKTFRPPYYHRNCMSEFMGLIKGHYEAKQGGFLPGGGSLHSAMTPHGPDADCFEKASKAKLEPERIADGTMAFMFESSLSLAVTKWGLKTCSCLDENYYKCWEPLRSHF 434          
BLAST of Homogentisate 1,2-dioxygenase vs. TrEMBL
Match: A0A0B6Z789 (Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF51599 PE=4 SV=1)

HSP 1 Score: 602.823 bits (1553), Expect = 0.000e+0
Identity = 284/433 (65.59%), Postives = 342/433 (78.98%), Query Frame = 2
Query:  224 YQNGFGNEFSSEHFKYKGSLPNSQNNPQKCTFGLYAEQLSGTAFTAPRHENLRSWLYRILPSVVHDPFKKYSDAPHFTNKFQSTKVNPNQLRWNPFKNDKEFNQTKVDFVNGIRTICGAGDPNIRNAIMIYVYNFNINMTNKAFFNSDGDFLIVPQEGALSVITEFGKFIIAPGEIIVIQQGIRFSVNLLDSQSASGYILEVCGNHFVLPSLGPIGANGLANPRDFQTSVAWFDEESINKNETFTVISKYQGELFTYNQNHTCFDVVAWHGNYVPYKYDLGSFMVINSVSFDHADPSIFTVLTCPSLKPGTALADFVIFPPRWSVQEHTFRPPYYHRNCMAEFMGLIYGNYEAKEKGFLPGGATLHSMMIPHGPDSNCFESASNSHLKSERIADNTLAFMFETSLSLSITDWAQENNVDGDYYKCWQELKKNF 1522
            Y +GFGNEF++E  +  G+LP SQNNPQKC +GLY EQLSG+AFTA RHEN R+WLYRI PSVVH PFKK       T+ + S + NPNQLRW+PF    +  +T  DFV G+ TICGAGDP  RN I IYVY  N  MTNK  +NSDGDFLIVPQ+GAL + TE G+  + P EI VIQ+GIRFSV++     + GYILEV  +HF LP+LGPIGANGLANPRDF T VAW++++ ++    FTV++KY G +F+ +Q H+ FDVVAWHGNY PYKY+L  FMVIN V+FDHADPSIFTVLTCPSLKPG A+ADFVIFPPRWSVQEHTFRPPYYHRNCM+EFMGLIYGNYEAKE+GF PGGA+LHS+M PHGPD +CFE ASN  LK ++IA+ T+AFMFE+SLS+++T+WA +  VD DY+KCWQ L K+F
Sbjct:    7 YLSGFGNEFATEDPRCVGALPESQNNPQKCPYGLYTEQLSGSAFTALRHENQRTWLYRIRPSVVHTPFKKIEKG-LITHDWDSVEPNPNQLRWSPF----DIPKTNQDFVEGLATICGAGDPKSRNGIAIYVYTCNKPMTNKCLYNSDGDFLIVPQQGALFITTEMGRMNVEPNEICVIQRGIRFSVDV--KGDSRGYILEVFSDHFQLPTLGPIGANGLANPRDFLTPVAWYEDQDLD----FTVVNKYHGHIFSASQGHSPFDVVAWHGNYAPYKYNLSKFMVINCVAFDHADPSIFTVLTCPSLKPGVAIADFVIFPPRWSVQEHTFRPPYYHRNCMSEFMGLIYGNYEAKEEGFRPGGASLHSIMTPHGPDYDCFEKASNGELKPQKIAEGTMAFMFESSLSMTVTEWANKTKVDSDYFKCWQPLTKHF 428          
BLAST of Homogentisate 1,2-dioxygenase vs. TrEMBL
Match: B4P179 (Uncharacterized protein, isoform A OS=Drosophila yakuba OX=7245 GN=Dyak\GE18517 PE=4 SV=1)

HSP 1 Score: 600.897 bits (1548), Expect = 0.000e+0
Identity = 286/440 (65.00%), Postives = 336/440 (76.36%), Query Frame = 2
Query:  209 LDSYSYQNGFGNEFSSEHFKYKGSLPNSQNNPQKCTFGLYAEQLSGTAFTAPRHENLRSWLYRILPSVVHDPFKKYSDAPHFTNKFQSTKVNPNQLRWNPFKNDKEFNQTKVDFVNGIRTICGAGDPNIRNAIMIYVYNFNINMTNKAFFNSDGDFLIVPQEGALSVITEFGKFIIAPGEIIVIQQGIRFSVNLLDSQSASGYILEVCGNHFVLPSLGPIGANGLANPRDFQTSVAWFDEESINKNETFTVISKYQGELFTYNQNHTCFDVVAWHGNYVPYKYDLGSFMVINSVSFDHADPSIFTVLTCPSLKPGTALADFVIFPPRWSVQEHTFRPPYYHRNCMAEFMGLIYGNYEAKEKGFLPGGATLHSMMIPHGPDSNCFESASNSHLKSERIADNTLAFMFETSLSLSITDWAQE--NNVDGDYYKCWQELKKNF 1522
            +  Y Y +GFG+ FSSE  +Y  SLP  QN+PQ C + LYAEQLSG+AFTAPR EN+R+WLYR LPS VH PF+ +  A +F   +     NPNQLRW PF    + +  +VDFV G+ T+CGAGDP  R+ + I++Y+ N +M N AF+NSDGDFLIVPQ+G L VITEFG+  +AP EI VI QGIRF+VN+    S+ GYILEV   HFVLP LGPIGANGLANPRDF+T VAWFD+  +   + F VISK+QG LF   QNHT FDVVAWHGNYVP+KYDL  FMVINSVSFDH DPSIFTVLTCPSL+ GTA+ADFVIFPPRWSVQEHTFRPPYYHRNCM+EFMGLI G YEAKE GF  GGATLHSMM PHGPD  CFE ASN+ L +ER+A+ T AFMFE+SLSL++T W +E    +D  YY+CWQ LK NF
Sbjct:    1 MSEYKYLSGFGSHFSSEDERYPNSLPVGQNSPQVCPYKLYAEQLSGSAFTAPRTENVRTWLYRKLPSAVHLPFQPFKGADYFRQNWDEQPPNPNQLRWKPFDLPPK-DGRRVDFVEGLHTVCGAGDPRSRHGLAIHIYSCNASMENSAFYNSDGDFLIVPQQGVLDVITEFGRMSVAPNEICVIPQGIRFAVNV--DSSSRGYILEVYDGHFVLPDLGPIGANGLANPRDFETPVAWFDDRDV---KDFQVISKFQGSLFVAKQNHTVFDVVAWHGNYVPFKYDLSKFMVINSVSFDHCDPSIFTVLTCPSLRAGTAIADFVIFPPRWSVQEHTFRPPYYHRNCMSEFMGLILGKYEAKEDGFAAGGATLHSMMTPHGPDVKCFEGASNAKLVAERVAEGTQAFMFESSLSLAVTKWGEETCQKLDASYYECWQALKNNF 434          
BLAST of Homogentisate 1,2-dioxygenase vs. TrEMBL
Match: B4MWE2 (Uncharacterized protein OS=Drosophila willistoni OX=7260 GN=Dwil\GK14896 PE=4 SV=1)

HSP 1 Score: 600.512 bits (1547), Expect = 0.000e+0
Identity = 290/442 (65.61%), Postives = 334/442 (75.57%), Query Frame = 2
Query:  209 LDSYSYQNGFGNEFSSEHFKYKGSLPNSQNNPQKCTFGLYAEQLSGTAFTAPRHENLRSWLYRILPSVVHDPFKKYSDAPHFTNKFQSTKVNPNQLRWNPFKNDKEFNQTKVDFVNGIRTICGAGDPNIRNAIMIYVYNFNINMTNKAFFNSDGDFLIVPQEGALSVITEFGKFIIAPGEIIVIQQGIRFSVNLLDSQSASGYILEVCGNHFVLPSLGPIGANGLANPRDFQTSVAWFDEESINKNETFTVISKYQGELFTYNQNHTCFDVVAWHGNYVPYKYDLGSFMVINSVSFDHADPSIFTVLTCPSLKPGTALADFVIFPPRWSVQEHTFRPPYYHRNCMAEFMGLIYGNYEAKEKGFLPGGATLHSMMIPHGPDSNCFESASNSHLKSERIADNTLAFMFETSLSLSITDWAQE--NNVDGDYYKCWQELKKNFIL 1528
            +  Y Y +GFG+ FSSE  +   SLP  QN+PQ C + LYAEQLSG+AFTAPR EN R+WLYR LPS VH PFK +  A +FT  +     NPNQLRW PF    E  +  VDFV G+ T+CGAGDP +R+ + I+VY  N++M N AF+NSDGDFLIVPQ+G L + TE GK  +AP EI VI QGIRF+V + DS S  GYILEV   HF LP LGPIGANGLANPRDFQT VAWF+++ +   E F VISKYQG LF   QNHT FDVVAWHGNYVP+KYDL  FMVINSVSFDH DPSIFTVLTCPSL+PGTA+ADFVIFPPRWSVQEHTFRPPYYHRNCM+EFMGLI G YEAKE GF  GGATLHSMM PHGPD  CF+ AS + L  ERIA+ T AFMFETSLSL++T W +E    +D +YY+CWQ LK NF +
Sbjct:    1 MSEYKYLSGFGSHFSSEDERCPNSLPIGQNSPQICPYKLYAEQLSGSAFTAPRTENQRTWLYRRLPSAVHQPFKPFVGAKYFTQNWNEQPPNPNQLRWKPFDLPTE-RKKPVDFVQGLHTVCGAGDPRVRHGLAIHVYLCNVSMENSAFYNSDGDFLIVPQQGVLDITTELGKMTVAPNEICVIPQGIRFAVGV-DSVS-RGYILEVYDGHFCLPDLGPIGANGLANPRDFQTPVAWFNDKQV---EDFNVISKYQGGLFVAKQNHTVFDVVAWHGNYVPFKYDLNKFMVINSVSFDHCDPSIFTVLTCPSLRPGTAIADFVIFPPRWSVQEHTFRPPYYHRNCMSEFMGLILGRYEAKEDGFAAGGATLHSMMTPHGPDVKCFDGASKAKLVPERIAEGTQAFMFETSLSLAVTKWGEETCQKLDAEYYECWQSLKDNFTI 436          
BLAST of Homogentisate 1,2-dioxygenase vs. TrEMBL
Match: A0A484BET0 (Uncharacterized protein OS=Drosophila navojoa OX=7232 GN=AWZ03_006276 PE=4 SV=1)

HSP 1 Score: 600.127 bits (1546), Expect = 0.000e+0
Identity = 285/442 (64.48%), Postives = 330/442 (74.66%), Query Frame = 2
Query:  209 LDSYSYQNGFGNEFSSEHFKYKGSLPNSQNNPQKCTFGLYAEQLSGTAFTAPRHENLRSWLYRILPSVVHDPFKKYSDAPHFTNKFQSTKVNPNQLRWNPFKNDKEFNQTKVDFVNGIRTICGAGDPNIRNAIMIYVYNFNINMTNKAFFNSDGDFLIVPQEGALSVITEFGKFIIAPGEIIVIQQGIRFSVNLLDSQSASGYILEVCGNHFVLPSLGPIGANGLANPRDFQTSVAWFDEESINKNETFTVISKYQGELFTYNQNHTCFDVVAWHGNYVPYKYDLGSFMVINSVSFDHADPSIFTVLTCPSLKPGTALADFVIFPPRWSVQEHTFRPPYYHRNCMAEFMGLIYGNYEAKEKGFLPGGATLHSMMIPHGPDSNCFESASNSHLKSERIADNTLAFMFETSLSLSITDWAQENN--VDGDYYKCWQELKKNFIL 1528
            +  Y Y  GFG  FSSE  +   +LP  QN+PQ+C +GLYAEQLSG+AFTAPR EN+R+WLYR LPS VH PF  Y+ A H ++ +     NPNQLRW PF       +  V FV+G+ T+CGAGD   R+ + ++VY  N +M N AF+NSDGDFLIVPQEG L ++TE G+  ++P EI VI QGIRF+V L       GY+LEV   HF LP LGPIGANGLANPRDF+T VAWFD E+  +   F VISKYQG LF   Q H+ FDVVAWHGNYVPYKYDL  FMVINSVSFDH DPSIFTVLTCPSLKPGTA+ADFVIFPPRWSVQEHTFRPPYYHRNCM+EFMGLI G YEAKE+GF  GGATLHSMM PHGPD+NCFE AS + LK ERIAD T AFMFE+SLSL++T W  E +  +D  YY+CWQ LK NF L
Sbjct:    1 MSEYKYLTGFGGHFSSEDERCPNALPVGQNSPQQCPYGLYAEQLSGSAFTAPRAENVRTWLYRKLPSAVHTPFLPYAGAKHLSHNWDEQPPNPNQLRWKPFDMPGA-KEKSVTFVDGLHTVCGAGDARARHGMAVHVYLCNASMDNSAFYNSDGDFLIVPQEGTLDIVTELGRMTVSPNEICVIPQGIRFAVKL--QTPCRGYVLEVFDGHFRLPDLGPIGANGLANPRDFETPVAWFDSETYKE---FNVISKYQGSLFVAKQKHSVFDVVAWHGNYVPYKYDLSKFMVINSVSFDHCDPSIFTVLTCPSLKPGTAIADFVIFPPRWSVQEHTFRPPYYHRNCMSEFMGLILGRYEAKEEGFAAGGATLHSMMTPHGPDANCFEGASKAELKPERIADGTQAFMFESSLSLAVTKWGAETSQKLDAQYYECWQALKNNFKL 436          
BLAST of Homogentisate 1,2-dioxygenase vs. TrEMBL
Match: A0A2C9JR82 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106064570 PE=4 SV=1)

HSP 1 Score: 599.742 bits (1545), Expect = 0.000e+0
Identity = 283/435 (65.06%), Postives = 342/435 (78.62%), Query Frame = 2
Query:  224 YQNGFGNEFSSEHFKYKGSLPNSQNNPQKCTFGLYAEQLSGTAFTAPRHENLRSWLYRILPSVVHDPFKKYSDAPHFTNKFQSTKVNPNQLRWNPFKNDKEFNQTKVDFVNGIRTICGAGDPNIRNAIMIYVYNFNINMTNKAFFNSDGDFLIVPQEGALSVITEFGKFIIAPGEIIVIQQGIRFSVNLLDSQSASGYILEVCGNHFVLPSLGPIGANGLANPRDFQTSVAWFDEESINKNETFTVISKYQGELFTYNQNHTCFDVVAWHGNYVPYKYDLGSFMVINSVSFDHADPSIFTVLTCPSLKPGTALADFVIFPPRWSVQEHTFRPPYYHRNCMAEFMGLIYGNYEAKEKGFLPGGATLHSMMIPHGPDSNCFESASNSHLKSERIADNTLAFMFETSLSLSITDWAQENNVDGDYYKCWQELKKNFIL 1528
            Y +GFGNEF+SE  +  G+LP  QNNPQKC +GLYAEQLSG+AFTAPR+EN R+WLYRI PSV+H PFKK S     T+ + +   NPNQLRW PF    +F +++ DF  GI TICGAGDP  R+ I ++++  N  M NK F+NSDGDFLIVPQ GAL + TE G+  +AP EI VIQ+GIRFSV++   ++  GYILEV  +HF LP+LGPIGANGLANPRDF T VAWF+++ +     FTV++KY G LF   Q H+ FDVVAWHGNY PYKYDL  FMVIN V+FDHADPSIFTVLTCPSLKPGTA+ADFVIFPPRWSVQEHTFRPPYYHRNCM+EFMGLIYGNYEAKE+GF PGG +LHS+M PHGPD +CFE ASN+ L+ ++IA+ T+AFMFE+SLS+++T+WA    VD DYY+CWQ L K+F L
Sbjct:    7 YMSGFGNEFASEDSRCPGALPVGQNNPQKCAYGLYAEQLSGSAFTAPRNENERTWLYRIRPSVIHKPFKKISSG-LVTHNWDAVDPNPNQLRWQPF----DFPKSQQDFSEGIATICGAGDPKSRHGIAVHIFTCNKPMGNKCFYNSDGDFLIVPQHGALFIRTEMGRMNVAPNEICVIQRGIRFSVDV--EENTRGYILEVFSDHFQLPNLGPIGANGLANPRDFLTPVAWFEDKEVE----FTVVNKYHGHLFEATQGHSPFDVVAWHGNYAPYKYDLSKFMVINCVAFDHADPSIFTVLTCPSLKPGTAVADFVIFPPRWSVQEHTFRPPYYHRNCMSEFMGLIYGNYEAKEEGFKPGGGSLHSIMTPHGPDFDCFEKASNAKLEPQKIAEGTMAFMFESSLSMAVTEWANTTKVDSDYYQCWQPLLKHFAL 430          
BLAST of Homogentisate 1,2-dioxygenase vs. Ensembl Cavefish
Match: hgd (homogentisate 1,2-dioxygenase [Source:NCBI gene;Acc:103041476])

HSP 1 Score: 550.436 bits (1417), Expect = 0.000e+0
Identity = 263/440 (59.77%), Postives = 326/440 (74.09%), Query Frame = 2
Query:  209 LDSYSYQNGFGNEFSSEHFKYKGSLPNSQNNPQKCTFGLYAEQLSGTAFTAPRHENLRSWLYRILPSVVHDPFKKYSDAPHFTNKFQSTKVNPNQLRWNPFKNDKEFNQTKVDFVNGIRTICGAGDPNIRNAIMIYVYNFNINMTNKAFFNSDGDFLIVPQEGALSVITEFGKFIIAPGEIIVIQQGIRFSVNLLDSQSASGYILEVCGNHFVLPSLGPIGANGLANPRDFQTSVAWFDEESINKNETFTVISKYQGELFTYNQNHTCFDVVAWHGNYVPYKYDLGSFMVINSVSFDHADPSIFTVLTCPSLKPGTALADFVIFPPRWSVQEHTFRPPYYHRNCMAEFMGLIYGNYEAKEKGFLPGGATLHSMMIPHGPDSNCFESASNSHLKSERIADNTLAFMFETSLSLSITDWAQE--NNVDGDYYKCWQELKKNF 1522
            +    Y +GFGNEF+SE  +  GSLP  QNNPQ C +GLYAEQLSG+AFT PR  N RSWLYRILPSV H PF    +  + T  +   + +PNQLRW PF   K  ++ KVDFV+G+ T+CGAGD   RN I +++Y  N +M +K F NSDGDFLIVPQ+G + + TEFGK  + P EI VIQQG+RFSV++       GYILEV G HF LP LGPIGANGLANPRDFQ  VAWF++ ++     +TVI+KYQG+LF+  Q+ + F+VVAWHGNY PYKY+L +FM +N V+FDHADPSIFTVLT  S +PG A+ADFVIFPPRW V +HTFRPPYYHRNCM+EFMGLI G+YEAKE+GF PGGA+LHS+M PHGPD +CFE  S + LK ER+A+ T+AFMFE+S S+++T W  E    +D  YYKCW+ LK +F
Sbjct:    1 MAGLKYMSGFGNEFASEDPRCPGSLPEGQNNPQVCPYGLYAEQLSGSAFTCPRPTNKRSWLYRILPSVRHKPFTPV-NCGNLTENWNEVEPDPNQLRWLPFTISK-LSEKKVDFVSGLHTVCGAGDSKSRNGIGVHMYTCNTSMIDKCFQNSDGDFLIVPQKGEILITTEFGKIKVEPNEICVIQQGMRFSVDVFGE--TRGYILEVYGAHFELPDLGPIGANGLANPRDFQIPVAWFEDRTVATG--YTVINKYQGKLFSCQQDFSPFNVVAWHGNYTPYKYNLENFMAVNCVTFDHADPSIFTVLTAKSTRPGVAIADFVIFPPRWGVADHTFRPPYYHRNCMSEFMGLIKGHYEAKEEGFQPGGASLHSIMTPHGPDFDCFEKNSTAELKPERVAEGTMAFMFESSFSMAVTKWGLETCQRLDKSYYKCWEPLKSHF 434          
BLAST of Homogentisate 1,2-dioxygenase vs. Ensembl Nematostella
Match: EDO46736 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPG9])

HSP 1 Score: 557.755 bits (1436), Expect = 0.000e+0
Identity = 268/435 (61.61%), Postives = 327/435 (75.17%), Query Frame = 2
Query:  224 YQNGFGNEFSSEHFKYKGSLPNSQNNPQKCTFGLYAEQLSGTAFTAPRHENLRSWLYRILPSVVHDPFKKYSDAPHFTNKFQSTKVNPNQLRWNPFKNDKEFNQTKVDFVNGIRTICGAGDPNIRNAIMIYVYNFNINMTNKAFFNSDGDFLIVPQEGALSVITEFGKFIIAPGEIIVIQQGIRFSVNLLDSQSASGYILEVCGNHFVLPSLGPIGANGLANPRDFQTSVAWFDEESINKNETFTVISKYQGELFTYNQNHTCFDVVAWHGNYVPYKYDLGSFMVINSVSFDHADPSIFTVLTCPSLKPGTALADFVIFPPRWSVQEHTFRPPYYHRNCMAEFMGLIYGNYEAKEKGFLPGGATLHSMMIPHGPDSNCFESASNSHLKSERIADNTLAFMFETSLSLSITDWAQE--NNVDGDYYKCWQELKKNF 1522
            Y +GFGNEFSSE      +LP SQ  PQKC +GLYAEQLSG+AFTAPR +N RSWLYRI PSV+H PFK      + T+ ++  + +PNQ+RW PF  D       VDFV G+ T+CGAGDP  R+ I I+++  N +M NK  ++SDGDFLIVPQ+G L++ TEFGK  + P EI +IQ GIRFSV +  S+ + GYILEV   HF LP LGPIGANGLANPRDF T VAW+++  +   E FTV+SKYQG+LF   Q H+ FDVVAWHGNY PYKY L +F+ +NSVS DH DPSIFTVLTC S KPGTA+ADFVIFPPRWSV E+TFRPPYYHRNCM+EFMGLI G+YEAKE+GF+PGGA+LHSMM PHGPD  CF+ AS   LK +R+A+ T+AFMFE+SLS+++T W  E    +D +YYK WQ L+KNF
Sbjct:    6 YMSGFGNEFSSESLP--DALPKSQITPQKCPYGLYAEQLSGSAFTAPRGKNFRSWLYRIRPSVIHQPFKPIPQG-NLTHDWKGAEPDPNQMRWKPF--DLPPASDNVDFVQGLSTVCGAGDPCSRHGIAIHIFACNASMDNKCLYSSDGDFLIVPQKGTLNITTEFGKIEVKPNEICIIQLGIRFSVAV--SEPSRGYILEVFDGHFELPCLGPIGANGLANPRDFLTPVAWYEDRDV---EEFTVVSKYQGKLFAATQKHSPFDVVAWHGNYAPYKYSLDNFISVNSVSKDHMDPSIFTVLTCQSNKPGTAIADFVIFPPRWSVAENTFRPPYYHRNCMSEFMGLILGSYEAKEEGFMPGGASLHSMMTPHGPDRQCFDKASTGELKPQRVAEGTMAFMFESSLSMAVTKWGLETCQKLDQNYYKVWQSLEKNF 430          
BLAST of Homogentisate 1,2-dioxygenase vs. Ensembl Nematostella
Match: EDO28103 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7E8])

HSP 1 Score: 174.866 bits (442), Expect = 3.283e-52
Identity = 86/140 (61.43%), Postives = 104/140 (74.29%), Query Frame = 2
Query:  683 VPQEGALSVITEFGKFIIAPGEIIVIQQGIRFSVNLLDSQSASGYILEVCGNHFVLPSLGPIGANGLANPRDFQTSVAWFDEESINKNETFTVISKYQGELFTYNQNHTCFDVVAWHGNYVPYKYDLGSFMVINSVSFDH 1102
            VPQ+G L++ TEFGK  + P EI +IQ GIRFSV +  S+ + GYILEV   HF LP LGPIGANGLANPRDF T VAW+++  +   E FTV+SKYQG+LF   Q H+ FDVVAWHGNY PYKY L +F+ +NSVS DH
Sbjct:    1 VPQKGTLNITTEFGKIEVKPNEICIIQLGIRFSVAV--SEPSRGYILEVFDGHFELPCLGPIGANGLANPRDFLTPVAWYEDRDL---EEFTVVSKYQGKLFAATQKHSPFDVVAWHGNYAPYKYSLDNFISVNSVSKDH 135          
BLAST of Homogentisate 1,2-dioxygenase vs. Ensembl Medaka
Match: hgd (homogentisate 1,2-dioxygenase [Source:NCBI gene;Acc:101170627])

HSP 1 Score: 542.347 bits (1396), Expect = 0.000e+0
Identity = 260/440 (59.09%), Postives = 319/440 (72.50%), Query Frame = 2
Query:  209 LDSYSYQNGFGNEFSSEHFKYKGSLPNSQNNPQKCTFGLYAEQLSGTAFTAPRHENLRSWLYRILPSVVHDPFKKYSDAPHFTNKFQSTKVNPNQLRWNPFKNDKEFNQTKVDFVNGIRTICGAGDPNIRNAIMIYVYNFNINMTNKAFFNSDGDFLIVPQEGALSVITEFGKFIIAPGEIIVIQQGIRFSVNLLDSQSASGYILEVCGNHFVLPSLGPIGANGLANPRDFQTSVAWFDEESINKNETFTVISKYQGELFTYNQNHTCFDVVAWHGNYVPYKYDLGSFMVINSVSFDHADPSIFTVLTCPSLKPGTALADFVIFPPRWSVQEHTFRPPYYHRNCMAEFMGLIYGNYEAKEKGFLPGGATLHSMMIPHGPDSNCFESASNSHLKSERIADNTLAFMFETSLSLSITDWAQE--NNVDGDYYKCWQELKKNF 1522
            +    Y +GFGNEFSSE  +  GSLP  QNNPQ C +GLYAEQLSG+AFT PR  N RSWLYRILPSV H PF         T  +   + +PNQLRW PF   K   + KVDFV G+ TICGAG+   RN I I+V+  N +M +K F NSDGD LIVPQ+G + + TEFGK ++ P EI VIQQG+RFSV++       GYILEV G HF LP LGPIGANGLANPRDF   VAWF++ ++     +T+I+KYQG+LF   Q+ + F+VVAWHGNY PYKY+L  FM IN V+FDHADPSIFTVLT  S KPG A+ADFVIFPPRW V +HTFRPPYYHRNCM+EFMGLI G+YEAKE+GF PGG +LHS+M PHGPD++CF+  S + LK ER+A+ T+AFMFE+S S+++T W  E    +D  YY+CW+ L+ +F
Sbjct:    1 MAGLKYMSGFGNEFSSEDPRCPGSLPEGQNNPQVCPYGLYAEQLSGSAFTCPRSTNKRSWLYRILPSVKHKPFTPMPCG-DLTENWDEVEPDPNQLRWLPFTILKS-TEKKVDFVAGLHTICGAGNSKSRNGIGIHVFTCNTSMVDKCFNNSDGDLLIVPQQGDILITTEFGKMMVEPNEICVIQQGMRFSVDVFGE--TRGYILEVYGAHFELPDLGPIGANGLANPRDFLCPVAWFEDRTVPSG--YTIINKYQGKLFACQQDFSPFNVVAWHGNYTPYKYNLKHFMAINCVAFDHADPSIFTVLTAKSTKPGVAIADFVIFPPRWGVADHTFRPPYYHRNCMSEFMGLIKGHYEAKEEGFQPGGGSLHSIMTPHGPDADCFQKNSTAELKPERVAEGTMAFMFESSFSMAVTKWGLETCQRLDKTYYQCWERLRSHF 434          
BLAST of Homogentisate 1,2-dioxygenase vs. Ensembl Medaka
Match: hgd (homogentisate 1,2-dioxygenase [Source:NCBI gene;Acc:101170627])

HSP 1 Score: 541.962 bits (1395), Expect = 0.000e+0
Identity = 260/437 (59.50%), Postives = 319/437 (73.00%), Query Frame = 2
Query:  218 YSYQNGFGNEFSSEHFKYKGSLPNSQNNPQKCTFGLYAEQLSGTAFTAPRHENLRSWLYRILPSVVHDPFKKYSDAPHFTNKFQSTKVNPNQLRWNPFKNDKEFNQTKVDFVNGIRTICGAGDPNIRNAIMIYVYNFNINMTNKAFFNSDGDFLIVPQEGALSVITEFGKFIIAPGEIIVIQQGIRFSVNLLDSQSASGYILEVCGNHFVLPSLGPIGANGLANPRDFQTSVAWFDEESINKNETFTVISKYQGELFTYNQNHTCFDVVAWHGNYVPYKYDLGSFMVINSVSFDHADPSIFTVLTCPSLKPGTALADFVIFPPRWSVQEHTFRPPYYHRNCMAEFMGLIYGNYEAKEKGFLPGGATLHSMMIPHGPDSNCFESASNSHLKSERIADNTLAFMFETSLSLSITDWAQE--NNVDGDYYKCWQELKKNF 1522
            + Y +GFGNEFSSE  +  GSLP  QNNPQ C +GLYAEQLSG+AFT PR  N RSWLYRILPSV H PF         T  +   + +PNQLRW PF   K   + KVDFV G+ TICGAG+   RN I I+V+  N +M +K F NSDGD LIVPQ+G + + TEFGK ++ P EI VIQQG+RFSV++       GYILEV G HF LP LGPIGANGLANPRDF   VAWF++ ++     +T+I+KYQG+LF   Q+ + F+VVAWHGNY PYKY+L  FM IN V+FDHADPSIFTVLT  S KPG A+ADFVIFPPRW V +HTFRPPYYHRNCM+EFMGLI G+YEAKE+GF PGG +LHS+M PHGPD++CF+  S + LK ER+A+ T+AFMFE+S S+++T W  E    +D  YY+CW+ L+ +F
Sbjct:   15 FQYMSGFGNEFSSEDPRCPGSLPEGQNNPQVCPYGLYAEQLSGSAFTCPRSTNKRSWLYRILPSVKHKPFTPMPCG-DLTENWDEVEPDPNQLRWLPFTILKS-TEKKVDFVAGLHTICGAGNSKSRNGIGIHVFTCNTSMVDKCFNNSDGDLLIVPQQGDILITTEFGKMMVEPNEICVIQQGMRFSVDVFGE--TRGYILEVYGAHFELPDLGPIGANGLANPRDFLCPVAWFEDRTVPSG--YTIINKYQGKLFACQQDFSPFNVVAWHGNYTPYKYNLKHFMAINCVAFDHADPSIFTVLTAKSTKPGVAIADFVIFPPRWGVADHTFRPPYYHRNCMSEFMGLIKGHYEAKEEGFQPGGGSLHSIMTPHGPDADCFQKNSTAELKPERVAEGTMAFMFESSFSMAVTKWGLETCQRLDKTYYQCWERLRSHF 445          
BLAST of Homogentisate 1,2-dioxygenase vs. Ensembl Medaka
Match: hgd (homogentisate 1,2-dioxygenase [Source:NCBI gene;Acc:101170627])

HSP 1 Score: 416.001 bits (1068), Expect = 9.528e-142
Identity = 206/338 (60.95%), Postives = 243/338 (71.89%), Query Frame = 2
Query:  221 SYQNGFGNEFSSEHFKYKGSLPNSQNNPQKCTFGLYAEQLSGTAFTAPRHENLRSWLYRILPSVVHDPFKKYSDAPHFTNKFQSTKVNPNQLRWNPFKNDKEFNQTKVDFVNGIRTICGAGDPNIRNAIMIYVYNFNINMTNKAFFNSDGDFLIVPQEGALSVITEFGKFIIAPGEIIVIQQGIRFSVNLLDSQSASGYILEVCGNHFVLPSLGPIGANGLANPRDFQTSVAWFDEESINKNETFTVISKYQGELFTYNQNHTCFDVVAWHGNYVPYKYDLGSFMVINSVSFDHADPSIFTVLTCPSLKPGTALADFVIFPPRWSVQEHTFRPPYYHR 1234
            SY +GFGNEFSSE  +  GSLP  QNNPQ C +GLYAEQLSG+AFT PR  N RSWLYRILPSV H PF         T  +   + +PNQLRW PF   K   + KVDFV G+ TICGAG+   RN I I+V+  N +M +K F NSDGD LIVPQ+G + + TEFGK ++ P EI VIQQG+RFSV++       GYILEV G HF LP LGPIGANGLANPRDF   VAWF++ ++     +T+I+KYQG+LF   Q+ + F+VVAWHGNY PYKY+L  FM IN V+FDHADPSIFTVLT  S KPG A+ADFVIFPPRW V +HTFRPPYYHR
Sbjct:    4 SYMSGFGNEFSSEDPRCPGSLPEGQNNPQVCPYGLYAEQLSGSAFTCPRSTNKRSWLYRILPSVKHKPFTPMPCG-DLTENWDEVEPDPNQLRWLPFTILKS-TEKKVDFVAGLHTICGAGNSKSRNGIGIHVFTCNTSMVDKCFNNSDGDLLIVPQQGDILITTEFGKMMVEPNEICVIQQGMRFSVDVFGE--TRGYILEVYGAHFELPDLGPIGANGLANPRDFLCPVAWFEDRTVPSG--YTIINKYQGKLFACQQDFSPFNVVAWHGNYTPYKYNLKHFMAINCVAFDHADPSIFTVLTAKSTKPGVAIADFVIFPPRWGVADHTFRPPYYHR 335          
BLAST of Homogentisate 1,2-dioxygenase vs. Planmine SMEST
Match: SMESG000033366.1 (SMESG000033366.1)

HSP 1 Score: 932.554 bits (2409), Expect = 0.000e+0
Identity = 444/449 (98.89%), Postives = 447/449 (99.55%), Query Frame = 2
Query:  182 MPIVLHKHRLDSYSYQNGFGNEFSSEHFKYKGSLPNSQNNPQKCTFGLYAEQLSGTAFTAPRHENLRSWLYRILPSVVHDPFKKYSDAPHFTNKFQSTKVNPNQLRWNPFKNDKEFNQTKVDFVNGIRTICGAGDPNIRNAIMIYVYNFNINMTNKAFFNSDGDFLIVPQEGALSVITEFGKFIIAPGEIIVIQQGIRFSVNLLDSQSASGYILEVCGNHFVLPSLGPIGANGLANPRDFQTSVAWFDEESINKNETFTVISKYQGELFTYNQNHTCFDVVAWHGNYVPYKYDLGSFMVINSVSFDHADPSIFTVLTCPSLKPGTALADFVIFPPRWSVQEHTFRPPYYHRNCMAEFMGLIYGNYEAKEKGFLPGGATLHSMMIPHGPDSNCFESASNSHLKSERIADNTLAFMFETSLSLSITDWAQENNVDGDYYKCWQELKKNFIL 1528
            MPIVLHKHRLDSYSYQNGFGNEFSSEHFKYKGSLPNSQNNPQKC FGLYAEQLSGTAFTAPRHENLRSWLYRILPSVVHDPFKKYSDAPHFTNKFQSTKVNPNQLRWNPFKNDKEFNQTKVDFVNGIRTICGAGDPNIRNAIM+YVYNFNINMTNKAFFNSDGDFLIVPQ GALSVITEFGKFIIAPGEIIVIQQGIRFSVNLLDSQSASGYILEVCGNHFVLPSLGPIGANGLANPRDFQTSVAWFDEESINKNETFTVISKYQGELFTYNQNHTCFDVVAWHGNYVPYKYDLGSFMVINSVSFDHADPSIFTVLTCPSLKPGTALADFVIFPPRWSVQEHTFRPPYYHRNCMAEFMGLIYGNYEAKEKGFLPGGATLHSMMIPHGPDSNCFESASNSHLKSERIADNTLAFMFETSLSLS+TDWAQENNVDGDYYKCWQELKKNFI+
Sbjct:    1 MPIVLHKHRLDSYSYQNGFGNEFSSEHFKYKGSLPNSQNNPQKCAFGLYAEQLSGTAFTAPRHENLRSWLYRILPSVVHDPFKKYSDAPHFTNKFQSTKVNPNQLRWNPFKNDKEFNQTKVDFVNGIRTICGAGDPNIRNAIMMYVYNFNINMTNKAFFNSDGDFLIVPQGGALSVITEFGKFIIAPGEIIVIQQGIRFSVNLLDSQSASGYILEVCGNHFVLPSLGPIGANGLANPRDFQTSVAWFDEESINKNETFTVISKYQGELFTYNQNHTCFDVVAWHGNYVPYKYDLGSFMVINSVSFDHADPSIFTVLTCPSLKPGTALADFVIFPPRWSVQEHTFRPPYYHRNCMAEFMGLIYGNYEAKEKGFLPGGATLHSMMIPHGPDSNCFESASNSHLKSERIADNTLAFMFETSLSLSLTDWAQENNVDGDYYKCWQELKKNFIV 449          
The following BLAST results are available for this feature:
BLAST of Homogentisate 1,2-dioxygenase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HGD0.000e+059.32homogentisate 1,2-dioxygenase [Source:HGNC Symbol;... [more]
HGD6.444e-6367.86homogentisate 1,2-dioxygenase [Source:HGNC Symbol;... [more]
HGD2.184e-3752.76homogentisate 1,2-dioxygenase [Source:HGNC Symbol;... [more]
HGD4.002e-1654.55homogentisate 1,2-dioxygenase [Source:HGNC Symbol;... [more]
HGD1.158e-1349.25homogentisate 1,2-dioxygenase [Source:HGNC Symbol;... [more]
back to top
BLAST of Homogentisate 1,2-dioxygenase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
hgo-10.000e+060.18Homogentisate 1,2-dioxygenase [Source:UniProtKB/S... [more]
back to top
BLAST of Homogentisate 1,2-dioxygenase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
hgo0.000e+064.55gene:FBgn0040211 transcript:FBtr0080201[more]
back to top
BLAST of Homogentisate 1,2-dioxygenase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
hgd0.000e+060.45homogentisate 1,2-dioxygenase [Source:ZFIN;Acc:ZDB... [more]
hgd0.000e+056.72homogentisate 1,2-dioxygenase [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Homogentisate 1,2-dioxygenase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cebpb0.000e+057.93CCAAT enhancer binding protein beta [Source:Xenbas... [more]
cebpb8.264e-18056.33CCAAT enhancer binding protein beta [Source:Xenbas... [more]
cebpb6.658e-17956.78CCAAT enhancer binding protein beta [Source:Xenbas... [more]
cebpb2.115e-17856.81CCAAT enhancer binding protein beta [Source:Xenbas... [more]
cebpb6.506e-17454.17CCAAT enhancer binding protein beta [Source:Xenbas... [more]
back to top
BLAST of Homogentisate 1,2-dioxygenase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Hgd0.000e+059.09homogentisate 1, 2-dioxygenase [Source:MGI Symbol;... [more]
Hgd8.203e-16559.42homogentisate 1, 2-dioxygenase [Source:MGI Symbol;... [more]
back to top
BLAST of Homogentisate 1,2-dioxygenase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VKJ0|HGD_DROME0.000e+064.55Homogentisate 1,2-dioxygenase OS=Drosophila melano... [more]
sp|Q9Y041|HGD_CAEEL0.000e+060.18Homogentisate 1,2-dioxygenase OS=Caenorhabditis el... [more]
sp|Q93099|HGD_HUMAN0.000e+059.32Homogentisate 1,2-dioxygenase OS=Homo sapiens OX=9... [more]
sp|Q5RF05|HGD_PONAB0.000e+059.32Homogentisate 1,2-dioxygenase OS=Pongo abelii OX=9... [more]
sp|O09173|HGD_MOUSE0.000e+059.09Homogentisate 1,2-dioxygenase OS=Mus musculus OX=1... [more]
back to top
BLAST of Homogentisate 1,2-dioxygenase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0B6Z7890.000e+065.59Uncharacterized protein OS=Arion vulgaris OX=10286... [more]
B4P1790.000e+065.00Uncharacterized protein, isoform A OS=Drosophila y... [more]
B4MWE20.000e+065.61Uncharacterized protein OS=Drosophila willistoni O... [more]
A0A484BET00.000e+064.48Uncharacterized protein OS=Drosophila navojoa OX=7... [more]
A0A2C9JR820.000e+065.06Uncharacterized protein OS=Biomphalaria glabrata O... [more]
back to top
BLAST of Homogentisate 1,2-dioxygenase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
hgd0.000e+059.77homogentisate 1,2-dioxygenase [Source:NCBI gene;Ac... [more]
back to top
BLAST of Homogentisate 1,2-dioxygenase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Homogentisate 1,2-dioxygenase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Homogentisate 1,2-dioxygenase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO467360.000e+061.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO281033.283e-5261.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Homogentisate 1,2-dioxygenase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
hgd0.000e+059.09homogentisate 1,2-dioxygenase [Source:NCBI gene;Ac... [more]
hgd0.000e+059.50homogentisate 1,2-dioxygenase [Source:NCBI gene;Ac... [more]
hgd9.528e-14260.95homogentisate 1,2-dioxygenase [Source:NCBI gene;Ac... [more]
back to top
BLAST of Homogentisate 1,2-dioxygenase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000033366.10.000e+098.89SMESG000033366.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029427 ID=SMED30029427|Name=Homogentisate 1,2-dioxygenase|organism=Schmidtea mediterranea sexual|type=transcript|length=1774bp
AAAGCTCTGCATAATTATGCAGTAGAAATTATGAAATCCAGATAAATAAA
TTTTTAAGGAATAAAAGAAATCTGAAATTGTTAAATTTTGATTTTTTGGT
TTTATTTGTTAAAATGTATCAAATAAATCTTTAAAATAATATATTTTATT
CAAACCATTCATTATTTTATTACAAATATTAATGCCTATCGTACTCCATA
AACACAGATTAGATTCTTATTCGTATCAAAACGGATTCGGAAACGAATTC
TCAAGTGAACATTTTAAATATAAAGGTTCTCTACCTAATTCTCAAAATAA
TCCTCAAAAATGTACGTTTGGATTGTATGCTGAACAGTTATCTGGAACTG
CTTTTACAGCTCCGAGACATGAAAATTTGAGAAGCTGGCTTTATCGAATA
CTTCCTTCAGTTGTTCACGATCCGTTTAAGAAGTACTCTGATGCTCCACA
TTTTACTAATAAATTCCAATCTACAAAAGTAAATCCGAATCAATTGAGAT
GGAACCCTTTCAAAAACGACAAAGAATTTAATCAAACTAAGGTTGATTTC
GTCAATGGAATTCGAACAATATGTGGGGCTGGGGATCCAAATATTAGAAA
TGCAATAATGATATATGTTTACAATTTTAATATAAATATGACAAATAAAG
CATTTTTCAACTCTGATGGGGATTTCTTGATTGTTCCGCAAGAGGGAGCC
TTATCTGTAATCACAGAATTTGGAAAATTCATTATTGCTCCTGGTGAAAT
TATTGTTATTCAACAAGGAATTAGATTTTCTGTAAATCTTTTGGATTCTC
AATCTGCAAGTGGATACATTTTGGAAGTATGTGGAAATCACTTCGTTTTG
CCGAGTCTGGGTCCCATTGGTGCCAATGGACTAGCCAATCCAAGAGATTT
TCAAACTTCTGTCGCGTGGTTCGATGAAGAATCTATTAATAAAAACGAAA
CTTTTACAGTTATAAGTAAATATCAAGGAGAATTATTTACCTATAATCAA
AATCACACTTGTTTCGATGTAGTTGCTTGGCATGGCAACTATGTGCCTTA
CAAATATGACCTTGGGTCATTCATGGTAATAAATTCGGTCAGCTTTGACC
ATGCTGATCCATCAATATTCACTGTACTTACTTGTCCATCATTAAAACCT
GGAACTGCTTTAGCTGATTTTGTAATTTTCCCTCCAAGATGGTCTGTACA
AGAACACACTTTTAGACCTCCATATTATCACCGCAATTGTATGGCAGAGT
TTATGGGTCTTATCTACGGTAACTATGAAGCAAAAGAAAAAGGATTCCTC
CCAGGAGGTGCCACATTGCATAGTATGATGATTCCTCACGGCCCCGATAG
TAATTGCTTTGAAAGTGCTAGTAACAGCCACCTGAAATCGGAACGGATCG
CCGATAATACTTTAGCATTCATGTTTGAAACCTCTCTTAGCTTGTCAATT
ACAGATTGGGCACAAGAAAATAATGTTGATGGTGACTACTACAAGTGTTG
GCAAGAATTAAAAAAGAATTTCATACTATAACTAATTTATATAGATCTAA
GTTAGTGCCGAACTGATTTTAAAATAAATAATATAGAAAATTAGATTTTG
TTTACAATGTGTTAATGGATAGGTTGTAAATATTAAACGGTTAAAGTCCA
AACAATGGCCATAGAAATAGTTAAAGGCCGAAGTTTTGGCCATGATAATA
AAATATAATTACATATGCGTCGTGTAAAGTTTATTGACCTTTTTATTTTA
ATTATTTGTTTATATCATTGTGCC
back to top

protein sequence of SMED30029427-orf-1

>SMED30029427-orf-1 ID=SMED30029427-orf-1|Name=SMED30029427-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=450bp
MPIVLHKHRLDSYSYQNGFGNEFSSEHFKYKGSLPNSQNNPQKCTFGLYA
EQLSGTAFTAPRHENLRSWLYRILPSVVHDPFKKYSDAPHFTNKFQSTKV
NPNQLRWNPFKNDKEFNQTKVDFVNGIRTICGAGDPNIRNAIMIYVYNFN
INMTNKAFFNSDGDFLIVPQEGALSVITEFGKFIIAPGEIIVIQQGIRFS
VNLLDSQSASGYILEVCGNHFVLPSLGPIGANGLANPRDFQTSVAWFDEE
SINKNETFTVISKYQGELFTYNQNHTCFDVVAWHGNYVPYKYDLGSFMVI
NSVSFDHADPSIFTVLTCPSLKPGTALADFVIFPPRWSVQEHTFRPPYYH
RNCMAEFMGLIYGNYEAKEKGFLPGGATLHSMMIPHGPDSNCFESASNSH
LKSERIADNTLAFMFETSLSLSITDWAQENNVDGDYYKCWQELKKNFIL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000421tail
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR005708Homogentis_dOase
IPR014710RmlC-like_jellyroll
IPR011051RmlC_Cupin_sf
Vocabulary: biological process
TermDefinition
GO:0006559L-phenylalanine catabolic process
GO:0055114oxidation-reduction process
GO:0006570tyrosine metabolic process
GO:0006572tyrosine catabolic process
Vocabulary: molecular function
TermDefinition
GO:0004411homogentisate 1,2-dioxygenase activity
GO:0016491oxidoreductase activity
GO:0046872metal ion binding
GO:0051213dioxygenase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR014710RmlC-like jelly roll foldGENE3DG3DSA:2.60.120.10coord: 283..419
e-value: 4.5E-65
score: 219.5
IPR005708Homogentisate 1,2-dioxygenaseTIGRFAMTIGR01015TIGR01015coord: 13..447
e-value: 1.5E-205
score: 680.9
IPR005708Homogentisate 1,2-dioxygenasePFAMPF04209HgmAcoord: 14..447
e-value: 2.9E-203
score: 675.3
IPR005708Homogentisate 1,2-dioxygenasePANTHERPTHR11056HOMOGENTISATE 1,2-DIOXYGENASEcoord: 10..447
IPR011051RmlC-like cupin domain superfamilySUPERFAMILYSSF51182RmlC-like cupinscoord: 13..447