Baculoviral IAP repeat-containing protein 7

Overview
NameBaculoviral IAP repeat-containing protein 7
Smed IDSMED30029426
Length (bp)1116
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Baculoviral IAP repeat-containing protein 7 (SMED30029426) t-SNE clustered cells

Violin plots show distribution of expression levels for Baculoviral IAP repeat-containing protein 7 (SMED30029426) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Baculoviral IAP repeat-containing protein 7 (SMED30029426) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Baculoviral IAP repeat-containing protein 7 (SMED30029426) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029426

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30029426SMESG000067789.1 dd_Smed_v4_1187_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30029426SMESG000067789.1 dd_Smed_v4_1187_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30029426SMESG000067789.1 dd_Smed_v4_1187_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
anterior region of the whole animalSMED30029426SMESG000067789.1 dd_Smed_v4_1187_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30029426SMESG000067789.1 dd_Smed_v4_1187_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30029426SMESG000067789.1 dd_Smed_v6_1187_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30029426SMESG000067789.1 dd_Smed_v6_1187_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30029426SMESG000067789.1 dd_Smed_v6_1187_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30029426SMESG000067789.1 dd_Smed_v6_1187_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
GABAergic neuronSMED30029426SMESG000067789.1 dd_Smed_v6_1187_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30029426SMESG000067789.1 dd_Smed_v6_1187_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30029426SMESG000067789.1 dd_Smed_v6_1187_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30029426SMESG000067789.1 dd_Smed_v6_1187_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029426SMESG000067789.1 dd_Smed_v4_1187_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Baculoviral IAP repeat-containing protein 7 vs. Ensembl Zebrafish
Match: birc2 (baculoviral IAP repeat containing 2 [Source:ZFIN;Acc:ZDB-GENE-030825-6])

HSP 1 Score: 50.447 bits (119), Expect = 2.424e-6
Identity = 22/75 (29.33%), Postives = 46/75 (61.33%), Query Frame = 1
Query:  559 SRLFKEWIRKSD------FIEDKLTEKLNDVKKRYLTCSICKENQVSVLYLPCGHVIVCSKCQDKNNRKCQACSA 765
            + +F+ WI+K+D       ++  + E+L  +++   TC +C + +V+++++PCGH++VC +C   + RKC  C  
Sbjct:  550 AEVFRNWIKKNDVYLLRELMDLPMEEQLRRLQEER-TCKVCMDKEVNIVFIPCGHLVVCKECA-PSLRKCPICRG 622          
BLAST of Baculoviral IAP repeat-containing protein 7 vs. Ensembl Xenopus
Match: arsa.1 (arylsulfatase A, gene 1 [Source:Xenbase;Acc:XB-GENE-5959463])

HSP 1 Score: 48.521 bits (114), Expect = 9.754e-6
Identity = 21/52 (40.38%), Postives = 35/52 (67.31%), Query Frame = 1
Query:  616 EKLNDVKKRYLTCSICKENQVSVLYLPCGHVIVCSKCQDKNNRKCQACSAPI 771
            E+L  +K+  + C +C +N VS++++PCGH++VC++C   N R C  C A I
Sbjct:  309 EQLRQLKEERM-CKVCMDNDVSMVFVPCGHLVVCTECA-PNLRHCPICRAAI 358          
BLAST of Baculoviral IAP repeat-containing protein 7 vs. Ensembl Mouse
Match: Birc2 (baculoviral IAP repeat-containing 2 [Source:MGI Symbol;Acc:MGI:1197009])

HSP 1 Score: 48.9062 bits (115), Expect = 9.138e-6
Identity = 26/76 (34.21%), Postives = 42/76 (55.26%), Query Frame = 1
Query:  556 YSRLFKE----WIRKSDFIEDKLTEKLNDVKKRYLTCSICKENQVSVLYLPCGHVIVCSKCQDKNNRKCQACSAPI 771
            Y  LF E    +I   D     L E+L  +++   TC +C + +VS++++PCGH++VC +C   + RKC  C   I
Sbjct:  530 YENLFVEKNMKYIPTEDVSGLSLEEQLRRLQEER-TCKVCMDREVSIVFIPCGHLVVCQECA-PSLRKCPICRGTI 603          
BLAST of Baculoviral IAP repeat-containing protein 7 vs. Ensembl Mouse
Match: Birc2 (baculoviral IAP repeat-containing 2 [Source:MGI Symbol;Acc:MGI:1197009])

HSP 1 Score: 48.9062 bits (115), Expect = 9.138e-6
Identity = 26/76 (34.21%), Postives = 42/76 (55.26%), Query Frame = 1
Query:  556 YSRLFKE----WIRKSDFIEDKLTEKLNDVKKRYLTCSICKENQVSVLYLPCGHVIVCSKCQDKNNRKCQACSAPI 771
            Y  LF E    +I   D     L E+L  +++   TC +C + +VS++++PCGH++VC +C   + RKC  C   I
Sbjct:  530 YENLFVEKNMKYIPTEDVSGLSLEEQLRRLQEER-TCKVCMDREVSIVFIPCGHLVVCQECA-PSLRKCPICRGTI 603          
BLAST of Baculoviral IAP repeat-containing protein 7 vs. UniProt/SwissProt
Match: sp|P40629|413R_IIV6 (Putative RING finger protein 413R OS=Invertebrate iridescent virus 6 OX=176652 GN=EF2 PE=4 SV=2)

HSP 1 Score: 50.8322 bits (120), Expect = 4.459e-6
Identity = 31/90 (34.44%), Postives = 43/90 (47.78%), Query Frame = 1
Query:  538 LRLNPEYSRLFKEWIRKSDFIEDKLTEKLNDVKKRYLTCSICKENQVSVLYLPCGHVIVCSKCQ------------DKNNRKCQACSAPI 771
            + + PE   L +    K + +EDKLT        + LTC IC  NQV +L +PCGH+I+C+ C             + N  KC  C  PI
Sbjct:  115 IDITPEIEILNQNEKEKFNQVEDKLT-----TLSKNLTCIICLTNQVQILTIPCGHLIMCNPCSLNLNNSVCTRGVNSNYEKCPKCRTPI 199          
BLAST of Baculoviral IAP repeat-containing protein 7 vs. TrEMBL
Match: I1ZIH9 (IAP domain containing-1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 3.773e-9
Identity = 26/50 (52.00%), Postives = 37/50 (74.00%), Query Frame = 1
Query:  646 LTCSICKENQVSVLYLPCGHVIVCSKCQDKNNRKCQACSAPINEYHAIYV 795
            LTC+ CK+NQVS+LY PC HV++C  C   + + CQ C+ PI++YH IY+
Sbjct:    7 LTCNFCKKNQVSILYEPCYHVVICRTCFVSSMKICQVCNVPIHQYHLIYI 56          
BLAST of Baculoviral IAP repeat-containing protein 7 vs. Ensembl Cavefish
Match: birc2 (baculoviral IAP repeat containing 2 [Source:NCBI gene;Acc:103025481])

HSP 1 Score: 50.0618 bits (118), Expect = 2.670e-6
Identity = 22/75 (29.33%), Postives = 46/75 (61.33%), Query Frame = 1
Query:  559 SRLFKEWIRKSD------FIEDKLTEKLNDVKKRYLTCSICKENQVSVLYLPCGHVIVCSKCQDKNNRKCQACSA 765
            + +F+ WI+K+D       ++  + E+L  +++   TC +C + +V+++++PCGH++VC +C   + RKC  C  
Sbjct:  534 AEVFRNWIQKNDVYLLRELMDLPMEEQLRRLQEER-TCKVCMDKEVNIVFIPCGHLVVCKECA-PSLRKCPICRG 606          
BLAST of Baculoviral IAP repeat-containing protein 7 vs. Ensembl Sea Lamprey
Match: birc2 (baculoviral IAP repeat containing 2 [Source:ZFIN;Acc:ZDB-GENE-030825-6])

HSP 1 Score: 46.9802 bits (110), Expect = 5.161e-6
Identity = 20/50 (40.00%), Postives = 35/50 (70.00%), Query Frame = 1
Query:  616 EKLNDVKKRYLTCSICKENQVSVLYLPCGHVIVCSKCQDKNNRKCQACSA 765
            E+L  +++++ TC +C + +VSV+++PCGH++VC  C   + RKC  C A
Sbjct:  518 EELKRLQEQH-TCKVCMDKEVSVVFIPCGHLVVCRDCAS-SLRKCPICRA 565          
BLAST of Baculoviral IAP repeat-containing protein 7 vs. Planmine SMEST
Match: SMESG000067789.1 (SMESG000067789.1)

HSP 1 Score: 425.246 bits (1092), Expect = 3.400e-151
Identity = 209/211 (99.05%), Postives = 209/211 (99.05%), Query Frame = 1
Query:  163 MNFSGRIVQYDCGTADRQLKNLSKKSENENSVKTKNKTIISEQKPSMEFIELKSTVEDFINTYDTFTDKEIINILKIFKNPSIEYLIDIFNYDKCILKLSSYLMYLDKTGMDNDSLNEYFWDCMELRLNPEYSRLFKEWIRKSDFIEDKLTEKLNDVKKRYLTCSICKENQVSVLYLPCGHVIVCSKCQDKNNRKCQACSAPINEYHAIYV 795
            MN SGRIVQYDCGTADRQLKNLSKKSENENSVKTKNKTIISEQKPSMEFIE KSTVEDFINTYDTFTDKEIINILKIFKNPSIEYLIDIFNYDKCILKLSSYLMYLDKTGMDNDSLNEYFWDCMELRLNPEYSRLFKEWIRKSDFIEDKLTEKLNDVKKRYLTCSICKENQVSVLYLPCGHVIVCSKCQDKNNRKCQACSAPINEYHAIYV
Sbjct:    1 MNCSGRIVQYDCGTADRQLKNLSKKSENENSVKTKNKTIISEQKPSMEFIEFKSTVEDFINTYDTFTDKEIINILKIFKNPSIEYLIDIFNYDKCILKLSSYLMYLDKTGMDNDSLNEYFWDCMELRLNPEYSRLFKEWIRKSDFIEDKLTEKLNDVKKRYLTCSICKENQVSVLYLPCGHVIVCSKCQDKNNRKCQACSAPINEYHAIYV 211          
BLAST of Baculoviral IAP repeat-containing protein 7 vs. Planmine SMEST
Match: SMESG000067789.1 (SMESG000067789.1)

HSP 1 Score: 316.62 bits (810), Expect = 5.319e-109
Identity = 158/161 (98.14%), Postives = 159/161 (98.76%), Query Frame = 1
Query:  163 MNFSGRIVQYDCGTADRQLKNLSKKSENENSVKTKNKTIISEQKPSMEFIELKSTVEDFINTYDTFTDKEIINILKIFKNPSIEYLIDIFNYDKCILKLSSYLMYLDKTGMDNDSLNEYFWDCMELRLNPEYSRLFKEWIRKSDFIEDKLTEKLNDVKKRY 645
            MN SGRIVQYDCGTADRQLKNLSKKSENENSVKTKNKTIISEQKPSMEFIE KSTVEDFINTYDTFTDKEIINILKIFKNPSIEYLIDIFNYDKCILKLSSYLMYLDKTGMDNDSLNEYFWDCMELRLNPEYSRLFKEWIRKSDFIEDKLTEKLNDVKKR+
Sbjct:    1 MNCSGRIVQYDCGTADRQLKNLSKKSENENSVKTKNKTIISEQKPSMEFIEFKSTVEDFINTYDTFTDKEIINILKIFKNPSIEYLIDIFNYDKCILKLSSYLMYLDKTGMDNDSLNEYFWDCMELRLNPEYSRLFKEWIRKSDFIEDKLTEKLNDVKKRF 161          
BLAST of Baculoviral IAP repeat-containing protein 7 vs. Planmine SMEST
Match: SMESG000031949.1 (SMESG000031949.1)

HSP 1 Score: 129.413 bits (324), Expect = 1.143e-35
Identity = 69/182 (37.91%), Postives = 104/182 (57.14%), Query Frame = 1
Query:  262 TKNKTIISEQKP-SMEFIELKSTVEDFINTYDTFTDKEII---NILKIFKNPSIEYLIDIFNYDKCILKLSSYLMYLDKTGMDNDSLNEYFWDCMELRLNPEYSRLFKEWIRKSDFIEDKLTEKLNDVKKRYLTCSICKENQVSVLYLPCGHVIVCSKCQDKNNRKCQACSAPINEYHAIYV 795
            TKN  +     P ++    +K  ++   N  D+F + + I    +LK F  P I+Y  D F YDK +LKL S+++   +  ++ D++N  FW CMELRL+ EY     +WI   + ++ K  EK  ++   YL C +CK  QVS+LYLPCGH+I+C+KC  +N + CQ C   I E H IY+
Sbjct:   12 TKNIYVSDSDGPRAIHLNNVKERIKTNANISDSFENLDFIFLGKLLKSFNEPLIQYFHDTFGYDKPLLKLVSFILNSYEIKVNKDNMNFLFWTCMELRLDFEYRSEINKWISNFEQLKLKAQEKFQNIASFYLKCFLCKIQQVSILYLPCGHLILCTKCFQRNTKYCQICQILIEEAHTIYL 193          
BLAST of Baculoviral IAP repeat-containing protein 7 vs. Planmine SMEST
Match: SMESG000067788.1 (SMESG000067788.1)

HSP 1 Score: 123.25 bits (308), Expect = 3.532e-33
Identity = 62/156 (39.74%), Postives = 97/156 (62.18%), Query Frame = 1
Query:  328 VEDFINTYDTFTDKEIINILKIFKNPSIEYLIDIFNYDKCILKLSSYLMYLDKTGMDNDSLNEYFWDCMELRLNPEYSRLFKEWIRKSDFIEDKLTEKLNDVKKRYLTCSICKENQVSVLYLPCGHVIVCSKCQDKNNRKCQACSAPINEYHAIYV 795
            +++    Y     K ++ ILK+FKN SI++  + F Y+K ILKL S+LM  +K  +++++LN+YFW  M L      S+L        D IE ++ E + +  K+ LTC  C++N VS+LYLPCGHV++C+KC   + + CQAC + I E+H IY+
Sbjct:   69 IDELFRNYAKLNSKILLEILKLFKNSSIKFCHETFGYNKKILKLCSFLMERNKVNINHENLNDYFWSFMNL------SQL--------DGIEKEMCEIVKERNKQLLTCMGCQKNSVSILYLPCGHVVMCNKCYQISTKHCQACGSSIEEFHVIYI 210          
BLAST of Baculoviral IAP repeat-containing protein 7 vs. Planmine SMEST
Match: SMESG000032006.1 (SMESG000032006.1)

HSP 1 Score: 120.939 bits (302), Expect = 1.431e-32
Identity = 58/159 (36.48%), Postives = 95/159 (59.75%), Query Frame = 1
Query:  316 LKSTVEDFINTYDTFTDKEIINILKIFKNPSIEYLIDIFNYDKCILKLSSYLMYLDKTGMDNDSLNEYFWDCMELRLNPEYSRLFKEWIRKSDFIEDKLTEKLNDVKKRYLTCSICKENQVSVLYLPCGHVIVCSKCQDKNNRKCQACSAPINEYHAIY 792
            +++ + DF+  Y+    K +  I+K F N  +E L + F Y++ +LKL+S ++ +++     + +NE FWDCM LRL+    ++ K W+   D I   L +  N + K YLTC  C+ N VS+LYLPCG +++CS+C + +  KCQ C   ++E H IY
Sbjct:   25 IENEIFDFLENYEILPLKTVQRIVKSFANEYVEILHEKFGYEQSVLKLASCVISINQIDESLERMNEIFWDCMNLRLDKSCGKIIKSWMLNIDRIVLDLKKISNKLSKEYLTCCACQLNPVSILYLPCGDIVICSECYNDSVVKCQGCQRHVDEMHKIY 183          
The following BLAST results are available for this feature:
BLAST of Baculoviral IAP repeat-containing protein 7 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Baculoviral IAP repeat-containing protein 7 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Baculoviral IAP repeat-containing protein 7 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Baculoviral IAP repeat-containing protein 7 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
birc22.424e-629.33baculoviral IAP repeat containing 2 [Source:ZFIN;A... [more]
back to top
BLAST of Baculoviral IAP repeat-containing protein 7 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
arsa.19.754e-640.38arylsulfatase A, gene 1 [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of Baculoviral IAP repeat-containing protein 7 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Birc29.138e-634.21baculoviral IAP repeat-containing 2 [Source:MGI Sy... [more]
Birc29.138e-634.21baculoviral IAP repeat-containing 2 [Source:MGI Sy... [more]
back to top
BLAST of Baculoviral IAP repeat-containing protein 7 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|P40629|413R_IIV64.459e-634.44Putative RING finger protein 413R OS=Invertebrate ... [more]
back to top
BLAST of Baculoviral IAP repeat-containing protein 7 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 1
Match NameE-valueIdentityDescription
I1ZIH93.773e-952.00IAP domain containing-1 (Fragment) OS=Schmidtea me... [more]
back to top
BLAST of Baculoviral IAP repeat-containing protein 7 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
birc22.670e-629.33baculoviral IAP repeat containing 2 [Source:NCBI g... [more]
back to top
BLAST of Baculoviral IAP repeat-containing protein 7 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
birc25.161e-640.00baculoviral IAP repeat containing 2 [Source:ZFIN;A... [more]
back to top
BLAST of Baculoviral IAP repeat-containing protein 7 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Baculoviral IAP repeat-containing protein 7 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Baculoviral IAP repeat-containing protein 7 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Baculoviral IAP repeat-containing protein 7 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000067789.13.400e-15199.05SMESG000067789.1[more]
SMESG000067789.15.319e-10998.14SMESG000067789.1[more]
SMESG000031949.11.143e-3537.91SMESG000031949.1[more]
SMESG000067788.13.532e-3339.74SMESG000067788.1[more]
SMESG000032006.11.431e-3236.48SMESG000032006.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029426 ID=SMED30029426|Name=Baculoviral IAP repeat-containing protein 7|organism=Schmidtea mediterranea sexual|type=transcript|length=1116bp
CTAAGCTAGAATTTAGTAATTTTAATATAAAATCGATATAATTTATAAGT
TCGTCACTAACAAATTATTTTGTCACGTGTAGCCATTTAACCAATCAAAA
TTTTGGAAAATCCAACAATATTGTATTTAAAAAACGAATGAATTAAAATA
TTTATTTTACTGATGAATTTTTCAGGCAGAATTGTTCAATATGATTGTGG
TACAGCAGATAGGCAACTGAAGAATTTATCTAAAAAGAGTGAAAATGAAA
ATTCAGTTAAAACTAAAAATAAAACAATAATTTCGGAACAAAAGCCTTCA
ATGGAATTTATAGAACTTAAAAGCACGGTTGAAGATTTTATTAATACTTA
TGATACTTTCACTGATAAGGAAATCATAAATATTTTAAAAATCTTTAAAA
ATCCATCTATTGAATATTTGATAGATATATTTAATTATGATAAATGCATT
TTGAAATTATCGAGCTATTTAATGTATTTAGACAAAACAGGTATGGACAA
CGATTCACTGAACGAATACTTTTGGGATTGTATGGAGTTAAGGTTGAACC
CAGAATATAGTAGGCTGTTTAAAGAATGGATTCGGAAATCTGATTTCATT
GAAGATAAGTTAACAGAAAAACTAAATGATGTTAAGAAAAGGTATTTGAC
TTGTTCAATTTGTAAAGAAAATCAAGTTTCGGTTTTGTATTTGCCGTGTG
GTCACGTAATTGTTTGTTCTAAGTGCCAAGACAAAAATAACCGCAAATGT
CAAGCCTGTTCAGCGCCAATTAATGAATATCATGCTATTTATGTGTAAAT
TCGCATTACTTTGATATAAAGGGATTTATATCAAATTTAAATTCATGCAC
AATTATTACCATAGGAAGAGGGTAATAATGGTGTTGCTCTAAATTGAGAG
GATTTCCATATGAAGTCGAATTTCAGGGATTCAAATAGTATGATATTCGC
ATTTAATTAGGAAATTATAAATATTGTAATTAAAGTGGTAAATACACAAA
TATATTGCAGTAGTATATAAAGATTAAATATATTTAGCAAGCATGAATAT
ATCATTGTATATATTGTTATTAAATGATTTGTTTATTATTAAATAAATTT
TTTTCTTAGCTAAAAA
back to top

protein sequence of SMED30029426-orf-1

>SMED30029426-orf-1 ID=SMED30029426-orf-1|Name=SMED30029426-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=212bp
MNFSGRIVQYDCGTADRQLKNLSKKSENENSVKTKNKTIISEQKPSMEFI
ELKSTVEDFINTYDTFTDKEIINILKIFKNPSIEYLIDIFNYDKCILKLS
SYLMYLDKTGMDNDSLNEYFWDCMELRLNPEYSRLFKEWIRKSDFIEDKL
TEKLNDVKKRYLTCSICKENQVSVLYLPCGHVIVCSKCQDKNNRKCQACS
APINEYHAIYV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004869cysteine-type endopeptidase inhibitor activity
GO:0016740transferase activity
GO:0030414peptidase inhibitor activity
GO:0043027cysteine-type endopeptidase inhibitor activity involved in apoptotic process
GO:0046872metal ion binding
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0004842ubiquitin-protein transferase activity
GO:0016874ligase activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006915apoptotic process
GO:0007275multicellular organism development
GO:0010466negative regulation of peptidase activity
GO:0043066negative regulation of apoptotic process
GO:0043154negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0051865protein autoubiquitination
GO:0006996organelle organization
GO:0016567protein ubiquitination
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000428musculature system
PLANA:0000463cholinergic neuron
PLANA:0000464GABAergic neuron
PLANA:0000478pharynx musculature
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR017066E3ligase_BOI-like
IPR013083Znf_RING/FYVE/PHD
IPR001841Znf_RING
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR017066E3 ubiquitin-protein ligase BOI-likePIRSFPIRSF036836SBP1_RNase_bindcoord: 141..209
e-value: 3.0E-8
score: 31.4
coord: 15..56
e-value: 1300.0
score: -3.5
NoneNo IPR availablePFAMPF13920zf-C3HC4_3coord: 162..205
e-value: 2.9E-10
score: 39.9
NoneNo IPR availablePANTHERPTHR10044:SF139DEATH-ASSOCIATED INHIBITOR OF APOPTOSIS 2coord: 25..210
NoneNo IPR availablePANTHERPTHR10044INHIBITOR OF APOPTOSIScoord: 25..210
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 159..208
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 146..211
e-value: 2.3E-12
score: 48.0
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 164..200
score: 9.583