Inhibitor of growth protein
Overview
Neoblast Clusters
Zeng et. al., 2018▻ Overview▻ Neoblast Population▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny App
Neoblast Population
Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Embryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30029420 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 2
Homology
BLAST of Inhibitor of growth protein vs. Ensembl Human
Match: ING5 (inhibitor of growth family member 5 [Source:HGNC Symbol;Acc:HGNC:19421]) HSP 1 Score: 81.2629 bits (199), Expect = 1.052e-16 Identity = 31/50 (62.00%), Postives = 38/50 (76.00%), Query Frame = 2 Query: 917 VYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCKIEK 1066 YC+C++ SYG+MI CD+ C IEWFH+ CVD+TT PKG WFCP C EK Sbjct: 187 TYCLCHQVSYGEMIGCDNPDCPIEWFHFACVDLTTKPKGKWFCPRCVQEK 236
BLAST of Inhibitor of growth protein vs. Ensembl Human
Match: ING1 (inhibitor of growth family member 1 [Source:HGNC Symbol;Acc:HGNC:6062]) HSP 1 Score: 79.7221 bits (195), Expect = 1.832e-16 Identity = 28/49 (57.14%), Postives = 37/49 (75.51%), Query Frame = 2 Query: 917 VYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCKIE 1063 YC+CN+ SYG+MI CD+D+C IEWFH+ CV + PKG W+CP C+ E Sbjct: 142 TYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGE 190
BLAST of Inhibitor of growth protein vs. Ensembl Human
Match: ING1 (inhibitor of growth family member 1 [Source:HGNC Symbol;Acc:HGNC:6062]) HSP 1 Score: 80.1073 bits (196), Expect = 2.725e-16 Identity = 28/49 (57.14%), Postives = 37/49 (75.51%), Query Frame = 2 Query: 917 VYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCKIE 1063 YC+CN+ SYG+MI CD+D+C IEWFH+ CV + PKG W+CP C+ E Sbjct: 167 TYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGE 215
BLAST of Inhibitor of growth protein vs. Ensembl Human
Match: ING1 (inhibitor of growth family member 1 [Source:HGNC Symbol;Acc:HGNC:6062]) HSP 1 Score: 80.1073 bits (196), Expect = 4.837e-16 Identity = 28/49 (57.14%), Postives = 37/49 (75.51%), Query Frame = 2 Query: 917 VYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCKIE 1063 YC+CN+ SYG+MI CD+D+C IEWFH+ CV + PKG W+CP C+ E Sbjct: 211 TYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGE 259
BLAST of Inhibitor of growth protein vs. Ensembl Human
Match: ING3 (inhibitor of growth family member 3 [Source:HGNC Symbol;Acc:HGNC:14587]) HSP 1 Score: 81.6481 bits (200), Expect = 4.996e-16 Identity = 28/45 (62.22%), Postives = 35/45 (77.78%), Query Frame = 2 Query: 920 YCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVC 1054 YCICN+ SYG+M+ CD+ C IEWFHY CV +T +PKG W+CP C Sbjct: 347 YCICNQVSYGEMVGCDNQDCPIEWFHYGCVGLTEAPKGKWYCPQC 391
BLAST of Inhibitor of growth protein vs. Ensembl Celegans
Match: ing-3 (Inhibitor of growth protein [Source:UniProtKB/TrEMBL;Acc:Q9XWJ8]) HSP 1 Score: 75.485 bits (184), Expect = 2.992e-14 Identity = 25/54 (46.30%), Postives = 35/54 (64.81%), Query Frame = 2 Query: 899 DHEDAKVYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCKI 1060 D ED +C CN+ SYGDM+ CD+ C + WFHY C+ + P G W+CP C++ Sbjct: 423 DEEDEMHWCFCNEKSYGDMVQCDNRHCTLRWFHYPCIGMVEPPTGKWYCPRCEV 476
BLAST of Inhibitor of growth protein vs. Ensembl Celegans
Match: lsy-13 (pep chromosome:WBcel235:IV:16864655:16865476:1 gene:WBGene00020287.1 transcript:T06A10.4b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lsy-13) HSP 1 Score: 54.6842 bits (130), Expect = 1.722e-8 Identity = 20/47 (42.55%), Postives = 28/47 (59.57%), Query Frame = 2 Query: 905 EDAKVYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFC 1045 E K+YC C MI C++ CK WFH+ C+ + T+P GDW+C Sbjct: 97 EPPKMYCWCQLDKNDTMIECENPGCKYGWFHFTCIGMITAPAGDWYC 143
BLAST of Inhibitor of growth protein vs. Ensembl Celegans
Match: lsy-13 (pep chromosome:WBcel235:IV:16863866:16865479:1 gene:WBGene00020287.1 transcript:T06A10.4a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lsy-13) HSP 1 Score: 55.4546 bits (132), Expect = 2.751e-8 Identity = 28/85 (32.94%), Postives = 44/85 (51.76%), Query Frame = 2 Query: 812 SNKRKRLSLSN-----SFIYNRRPRNQPNKSH--FWDHEDAKVYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFC 1045 S+++K+LS + S +R R + +S E K+YC C MI C++ CK WFH+ C+ + T+P GDW+C Sbjct: 134 SHRKKKLSEGDDDAPSSVDEKKRGRKKKPESEKAVAAAEPPKMYCWCQLDKNDTMIECENPGCKYGWFHFTCIGMITAPAGDWYC 218
BLAST of Inhibitor of growth protein vs. Ensembl Celegans
Match: lsy-13 (pep chromosome:WBcel235:IV:16862396:16865476:1 gene:WBGene00020287.1 transcript:T06A10.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lsy-13) HSP 1 Score: 55.4546 bits (132), Expect = 2.751e-8 Identity = 28/85 (32.94%), Postives = 44/85 (51.76%), Query Frame = 2 Query: 812 SNKRKRLSLSN-----SFIYNRRPRNQPNKSH--FWDHEDAKVYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFC 1045 S+++K+LS + S +R R + +S E K+YC C MI C++ CK WFH+ C+ + T+P GDW+C Sbjct: 134 SHRKKKLSEGDDDAPSSVDEKKRGRKKKPESEKAVAAAEPPKMYCWCQLDKNDTMIECENPGCKYGWFHFTCIGMITAPAGDWYC 218
BLAST of Inhibitor of growth protein vs. Ensembl Celegans
Match: Y43H11AL.1 (pep chromosome:WBcel235:II:222704:223799:-1 gene:WBGene00021545.1 transcript:Y43H11AL.1e.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y43H11AL.1) HSP 1 Score: 47.7506 bits (112), Expect = 4.529e-7 Identity = 18/53 (33.96%), Postives = 33/53 (62.26%), Query Frame = 2 Query: 902 HEDAKVYCICNKPSY--GDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVC 1054 + + + +CICN + G M+ C++ C I+WFH++CV + +P +W+C C Sbjct: 12 YREQEEWCICNGMNINSGMMVECENKNCPIKWFHFECVGLLAAPLDEWYCTDC 64
BLAST of Inhibitor of growth protein vs. Ensembl Fly
Match: Ing3 (gene:FBgn0030945 transcript:FBtr0074614) HSP 1 Score: 83.5741 bits (205), Expect = 1.635e-16 Identity = 30/45 (66.67%), Postives = 34/45 (75.56%), Query Frame = 2 Query: 920 YCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVC 1054 YC CN+ SYGDM+ACD+D C EWFHY CV IT PKG W+CP C Sbjct: 630 YCTCNQVSYGDMVACDNDACPYEWFHYPCVGITQPPKGKWYCPKC 674
BLAST of Inhibitor of growth protein vs. Ensembl Fly
Match: CG7379 (gene:FBgn0038546 transcript:FBtr0083529) HSP 1 Score: 80.8777 bits (198), Expect = 6.462e-16 Identity = 29/53 (54.72%), Postives = 38/53 (71.70%), Query Frame = 2 Query: 908 DAKVYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCKIEK 1066 D YC+CN+ S+G+MI CD+D C IEWFH+ CV + PKG WFCP C+ E+ Sbjct: 356 DEPTYCVCNQISFGEMILCDNDLCPIEWFHFSCVSLVLKPKGKWFCPNCRGER 408
BLAST of Inhibitor of growth protein vs. Ensembl Fly
Match: Ing5 (gene:FBgn0032516 transcript:FBtr0080525) HSP 1 Score: 78.5666 bits (192), Expect = 8.589e-16 Identity = 28/46 (60.87%), Postives = 35/46 (76.09%), Query Frame = 2 Query: 917 VYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVC 1054 YC+C++ SYG+MI CD+ C IEWFH+ CV +TT PKG WFCP C Sbjct: 233 TYCLCHQVSYGEMIGCDNPDCPIEWFHFACVGLTTKPKGKWFCPKC 278
BLAST of Inhibitor of growth protein vs. Ensembl Fly
Match: Ing5 (gene:FBgn0032516 transcript:FBtr0080526) HSP 1 Score: 78.1814 bits (191), Expect = 9.656e-16 Identity = 28/46 (60.87%), Postives = 35/46 (76.09%), Query Frame = 2 Query: 917 VYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVC 1054 YC+C++ SYG+MI CD+ C IEWFH+ CV +TT PKG WFCP C Sbjct: 219 TYCLCHQVSYGEMIGCDNPDCPIEWFHFACVGLTTKPKGKWFCPKC 264
BLAST of Inhibitor of growth protein vs. Ensembl Fly
Match: MESR4 (gene:FBgn0034240 transcript:FBtr0340220) HSP 1 Score: 67.0106 bits (162), Expect = 3.826e-11 Identity = 27/53 (50.94%), Postives = 33/53 (62.26%), Query Frame = 2 Query: 905 EDAKVYCICNKP--SYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCK 1057 E VYC C P +MIACD D C IEWFH++CV I +P+G WFC C+ Sbjct: 2085 EGESVYCYCRCPYDEVSEMIACDGDNCLIEWFHFECVGIMVAPQGKWFCAECR 2137
BLAST of Inhibitor of growth protein vs. Ensembl Zebrafish
Match: ing5a (inhibitor of growth family, member 5a [Source:ZFIN;Acc:ZDB-GENE-031016-1]) HSP 1 Score: 79.7221 bits (195), Expect = 2.244e-16 Identity = 29/46 (63.04%), Postives = 36/46 (78.26%), Query Frame = 2 Query: 917 VYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVC 1054 YC+C++ SYG+MI CD+ C IEWFH+ CVD+TT PKG WFCP C Sbjct: 190 TYCLCHQVSYGEMIGCDNPDCPIEWFHFACVDLTTKPKGKWFCPRC 235
BLAST of Inhibitor of growth protein vs. Ensembl Zebrafish
Match: ing5a (inhibitor of growth family, member 5a [Source:ZFIN;Acc:ZDB-GENE-031016-1]) HSP 1 Score: 79.7221 bits (195), Expect = 2.244e-16 Identity = 29/46 (63.04%), Postives = 36/46 (78.26%), Query Frame = 2 Query: 917 VYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVC 1054 YC+C++ SYG+MI CD+ C IEWFH+ CVD+TT PKG WFCP C Sbjct: 190 TYCLCHQVSYGEMIGCDNPDCPIEWFHFACVDLTTKPKGKWFCPRC 235
BLAST of Inhibitor of growth protein vs. Ensembl Zebrafish
Match: ing3 (inhibitor of growth family, member 3 [Source:ZFIN;Acc:ZDB-GENE-040109-3]) HSP 1 Score: 82.0333 bits (201), Expect = 3.401e-16 Identity = 28/45 (62.22%), Postives = 35/45 (77.78%), Query Frame = 2 Query: 920 YCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVC 1054 YCICN+ SYG+M+ CD+ C IEWFHY CV +T +PKG W+CP C Sbjct: 360 YCICNQVSYGEMVGCDNQDCPIEWFHYGCVGLTEAPKGKWYCPQC 404
BLAST of Inhibitor of growth protein vs. Ensembl Zebrafish
Match: ing4 (inhibitor of growth family, member 4 [Source:ZFIN;Acc:ZDB-GENE-050522-47]) HSP 1 Score: 78.5666 bits (192), Expect = 6.944e-16 Identity = 27/50 (54.00%), Postives = 37/50 (74.00%), Query Frame = 2 Query: 917 VYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCKIEK 1066 YC+C++ SYG+MI CD+ C IEWFH+ CV +TT P+G W+CP C E+ Sbjct: 198 TYCLCHQVSYGEMIGCDNTDCSIEWFHFACVGLTTKPRGKWYCPRCSQER 247
BLAST of Inhibitor of growth protein vs. Ensembl Zebrafish
Match: ing1 (inhibitor of growth family, member 1 [Source:ZFIN;Acc:ZDB-GENE-060421-4388]) HSP 1 Score: 79.337 bits (194), Expect = 8.516e-16 Identity = 27/47 (57.45%), Postives = 36/47 (76.60%), Query Frame = 2 Query: 917 VYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCK 1057 YC+C + SYG+MI CD+D+C IEWFH+ CVD+ PKG W+CP C+ Sbjct: 241 TYCLCEQVSYGEMIGCDNDECTIEWFHFSCVDLHHKPKGKWYCPKCR 287
BLAST of Inhibitor of growth protein vs. Ensembl Xenopus
Match: lman1l (lectin, mannose-binding, 1 like [Source:Xenbase;Acc:XB-GENE-5754170]) HSP 1 Score: 81.2629 bits (199), Expect = 8.944e-17 Identity = 30/50 (60.00%), Postives = 38/50 (76.00%), Query Frame = 2 Query: 917 VYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCKIEK 1066 YC+C++ SYG+MI CD+ C IEWFH+ CVD+TT PKG WFCP C E+ Sbjct: 185 TYCLCHQVSYGEMIGCDNPDCPIEWFHFACVDLTTKPKGKWFCPRCTQER 234
BLAST of Inhibitor of growth protein vs. Ensembl Xenopus
Match: atp2b2 (ATPase, Ca++ transporting, plasma membrane 2 [Source:Xenbase;Acc:XB-GENE-950177]) HSP 1 Score: 80.8777 bits (198), Expect = 2.500e-16 Identity = 28/47 (59.57%), Postives = 37/47 (78.72%), Query Frame = 2 Query: 917 VYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCK 1057 YC+CN+ SYG+MI CD+D+C IEWFH+ CV +T PKG W+CP C+ Sbjct: 212 TYCLCNQVSYGEMIGCDNDECTIEWFHFSCVGLTYKPKGKWYCPDCR 258
BLAST of Inhibitor of growth protein vs. Ensembl Xenopus
Match: tmem192 (transmembrane protein 192 [Source:Xenbase;Acc:XB-GENE-5751968]) HSP 1 Score: 80.8777 bits (198), Expect = 1.137e-15 Identity = 27/45 (60.00%), Postives = 35/45 (77.78%), Query Frame = 2 Query: 920 YCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVC 1054 YCICN+ SYG+M+ CD+ C IEWFHY CV ++ +PKG W+CP C Sbjct: 361 YCICNQVSYGEMVGCDNQDCPIEWFHYGCVGLSEAPKGKWYCPQC 405
BLAST of Inhibitor of growth protein vs. Ensembl Xenopus
Match: ccnf (cyclin F [Source:Xenbase;Acc:XB-GENE-963729]) HSP 1 Score: 78.5666 bits (192), Expect = 1.399e-15 Identity = 27/49 (55.10%), Postives = 37/49 (75.51%), Query Frame = 2 Query: 917 VYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCKIE 1063 YC+CN+ SYG+MI CD+++C IEWFH+ CV + PKG W+CP C+ E Sbjct: 211 TYCLCNQVSYGEMIGCDNEECPIEWFHFSCVGLNHKPKGKWYCPECRGE 259
BLAST of Inhibitor of growth protein vs. Ensembl Xenopus
Match: ING4 (inhibitor of growth family member 4 [Source:NCBI gene;Acc:100491241]) HSP 1 Score: 77.7962 bits (190), Expect = 3.407e-15 Identity = 37/89 (41.57%), Postives = 49/89 (55.06%), Query Frame = 2 Query: 815 NKRKRLSLSNSFIYNRRPRNQPNKSHFWDHEDAKV------YCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCKIE 1063 N +K++ L + Y P K H D D V YC+C++ SYG+MI CD+ C IEWFH+ CV + T P+G WFCP C E Sbjct: 197 NTQKKIKLVQTAEYGA-PAGNFGKVHPSDVLDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCSIEWFHFACVGLATKPRGKWFCPRCSQE 284
BLAST of Inhibitor of growth protein vs. Ensembl Mouse
Match: Ing5 (inhibitor of growth family, member 5 [Source:MGI Symbol;Acc:MGI:1922816]) HSP 1 Score: 81.2629 bits (199), Expect = 4.130e-17 Identity = 31/50 (62.00%), Postives = 38/50 (76.00%), Query Frame = 2 Query: 917 VYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCKIEK 1066 YC+C++ SYG+MI CD+ C IEWFH+ CVD+TT PKG WFCP C EK Sbjct: 160 TYCLCHQVSYGEMIGCDNPDCPIEWFHFACVDLTTKPKGKWFCPRCVQEK 209
BLAST of Inhibitor of growth protein vs. Ensembl Mouse
Match: Ing5 (inhibitor of growth family, member 5 [Source:MGI Symbol;Acc:MGI:1922816]) HSP 1 Score: 81.6481 bits (200), Expect = 5.035e-17 Identity = 31/50 (62.00%), Postives = 38/50 (76.00%), Query Frame = 2 Query: 917 VYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCKIEK 1066 YC+C++ SYG+MI CD+ C IEWFH+ CVD+TT PKG WFCP C EK Sbjct: 187 TYCLCHQVSYGEMIGCDNPDCPIEWFHFACVDLTTKPKGKWFCPRCVQEK 236
BLAST of Inhibitor of growth protein vs. Ensembl Mouse
Match: Ing3 (inhibitor of growth family, member 3 [Source:MGI Symbol;Acc:MGI:1919027]) HSP 1 Score: 83.1889 bits (204), Expect = 1.296e-16 Identity = 32/64 (50.00%), Postives = 42/64 (65.62%), Query Frame = 2 Query: 866 PRNQPNKSHFWDHE-DAKVYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVC 1054 P + N W ++ + YCICN+ SYG+M+ CD+ C IEWFHY CV +T +PKG WFCP C Sbjct: 335 PESDSNSQVDWTYDPNEPRYCICNQVSYGEMVGCDNQDCPIEWFHYGCVGLTEAPKGKWFCPQC 398
BLAST of Inhibitor of growth protein vs. Ensembl Mouse
Match: Ing1 (inhibitor of growth family, member 1 [Source:MGI Symbol;Acc:MGI:1349481]) HSP 1 Score: 79.337 bits (194), Expect = 1.298e-16 Identity = 28/49 (57.14%), Postives = 37/49 (75.51%), Query Frame = 2 Query: 917 VYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCKIE 1063 YC+CN+ SYG+MI CD+D+C IEWFH+ CV + PKG W+CP C+ E Sbjct: 117 TYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGE 165
BLAST of Inhibitor of growth protein vs. Ensembl Mouse
Match: Ing1 (inhibitor of growth family, member 1 [Source:MGI Symbol;Acc:MGI:1349481]) HSP 1 Score: 79.337 bits (194), Expect = 1.298e-16 Identity = 28/49 (57.14%), Postives = 37/49 (75.51%), Query Frame = 2 Query: 917 VYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCKIE 1063 YC+CN+ SYG+MI CD+D+C IEWFH+ CV + PKG W+CP C+ E Sbjct: 117 TYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGE 165
BLAST of Inhibitor of growth protein vs. UniProt/SwissProt
Match: sp|P38806|YNG2_YEAST (Chromatin modification-related protein YNG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YNG2 PE=1 SV=1) HSP 1 Score: 87.0409 bits (214), Expect = 1.315e-17 Identity = 36/80 (45.00%), Postives = 51/80 (63.75%), Query Frame = 2 Query: 824 KRLSLSNSFIYNRRPRNQPNKSHFWDHEDAKVYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCKIE 1063 K+++ + F +R + Q N S + ED +YC C + S+G+M+ACD CK EWFHY CV++ PKG W+CP CKIE Sbjct: 193 KKIARTKEFKNSRNGKGQ-NGSPENEEEDKTLYCFCQRVSFGEMVACDGPNCKYEWFHYDCVNLKEPPKGTWYCPECKIE 271
BLAST of Inhibitor of growth protein vs. UniProt/SwissProt
Match: sp|Q6CXN0|YNG2_KLULA (Chromatin modification-related protein YNG2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=YNG2 PE=3 SV=1) HSP 1 Score: 84.7297 bits (208), Expect = 9.190e-17 Identity = 29/55 (52.73%), Postives = 41/55 (74.55%), Query Frame = 2 Query: 899 DHEDAKVYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCKIE 1063 + +D ++YC C + SYG+M+ACD CK EWFHY CV++T PKG W+CP C++E Sbjct: 228 EEDDKQLYCFCQRVSYGEMVACDGPNCKYEWFHYSCVNLTEPPKGQWYCPECRLE 282
BLAST of Inhibitor of growth protein vs. UniProt/SwissProt
Match: sp|Q6FSB1|YNG2_CANGA (Chromatin modification-related protein YNG2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=YNG2 PE=3 SV=1) HSP 1 Score: 83.9593 bits (206), Expect = 1.217e-16 Identity = 30/55 (54.55%), Postives = 40/55 (72.73%), Query Frame = 2 Query: 899 DHEDAKVYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCKIE 1063 + ED +YC C + S+G+M+ACD CK EWFHY+CV++T PKG W+CP CK E Sbjct: 210 EKEDQNLYCFCQRVSFGEMVACDGPNCKYEWFHYECVNLTEPPKGTWYCPDCKQE 264
BLAST of Inhibitor of growth protein vs. UniProt/SwissProt
Match: sp|Q9D8Y8|ING5_MOUSE (Inhibitor of growth protein 5 OS=Mus musculus OX=10090 GN=Ing5 PE=1 SV=1) HSP 1 Score: 81.6481 bits (200), Expect = 3.522e-16 Identity = 31/50 (62.00%), Postives = 38/50 (76.00%), Query Frame = 2 Query: 917 VYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCKIEK 1066 YC+C++ SYG+MI CD+ C IEWFH+ CVD+TT PKG WFCP C EK Sbjct: 187 TYCLCHQVSYGEMIGCDNPDCPIEWFHFACVDLTTKPKGKWFCPRCVQEK 236
BLAST of Inhibitor of growth protein vs. UniProt/SwissProt
Match: sp|Q8WYH8|ING5_HUMAN (Inhibitor of growth protein 5 OS=Homo sapiens OX=9606 GN=ING5 PE=1 SV=1) HSP 1 Score: 81.2629 bits (199), Expect = 5.050e-16 Identity = 31/50 (62.00%), Postives = 38/50 (76.00%), Query Frame = 2 Query: 917 VYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCKIEK 1066 YC+C++ SYG+MI CD+ C IEWFH+ CVD+TT PKG WFCP C EK Sbjct: 187 TYCLCHQVSYGEMIGCDNPDCPIEWFHFACVDLTTKPKGKWFCPRCVQEK 236
BLAST of Inhibitor of growth protein vs. TrEMBL
Match: A0A0V0XTK4 (Inhibitor of growth protein OS=Trichinella pseudospiralis OX=6337 GN=YNG2 PE=3 SV=1) HSP 1 Score: 94.7449 bits (234), Expect = 3.017e-17 Identity = 38/82 (46.34%), Postives = 53/82 (64.63%), Query Frame = 2 Query: 812 SNKRKRLSLSNSFIYNRRPRNQPNKSHFWDHEDAKVYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCK 1057 S+ R + S S ++ + N + D +D +YC CN+PSYG M+ACDS CK EWFHY+CV +T +PKG+WFCP C+ Sbjct: 288 SHSRSKASKKASTVHTEAAQGDAN-AEAGDVDDQSIYCYCNQPSYGSMVACDSITCKYEWFHYECVGVTEAPKGNWFCPDCR 368
BLAST of Inhibitor of growth protein vs. TrEMBL
Match: A0A0R3W8A6 (PHD-type domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS6577 PE=4 SV=1) HSP 1 Score: 92.8189 bits (229), Expect = 9.888e-17 Identity = 39/81 (48.15%), Postives = 52/81 (64.20%), Query Frame = 2 Query: 821 RKRLSLSNSFIYNRRPRNQPNKSHFWDHEDAKVYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCKIE 1063 R R ++S + NR+ S D ++YC+C K SYGDMIACD+ +C+IEWFH+ CVDI T PKG W+CP C+ E Sbjct: 249 RPRSRSTSSPLRNRKREVGRTSSTTADVSGERLYCLCKKLSYGDMIACDNPRCEIEWFHFACVDIKTQPKGRWYCPRCRGE 329
BLAST of Inhibitor of growth protein vs. TrEMBL
Match: A0A0R3S8H2 (PHD-type domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS444 PE=4 SV=1) HSP 1 Score: 92.4337 bits (228), Expect = 1.162e-16 Identity = 45/110 (40.91%), Postives = 63/110 (57.27%), Query Frame = 2 Query: 740 AVESSIKSKSNICLNSADSKYLSFSNKRKRLSL--SNSFIYNRRPRNQPNKSHFWDHEDAKVYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCKIE 1063 A ES + S + + S Y S + RK + +S + NRR R+ + D ++YC+C SYGDMIACD+ +CKIEWFH+ CVD+ PKG W+CP C+ E Sbjct: 221 ASESRLPPPSPEASDRSSSDYESENESRKHQASRSGSSPVRNRRQRDNGS-----DGTGERIYCLCKSYSYGDMIACDNSRCKIEWFHFACVDVKIQPKGKWYCPKCRGE 325
BLAST of Inhibitor of growth protein vs. TrEMBL
Match: A0A564YJV2 (PHD-type domain-containing protein (Fragment) OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS7097 PE=4 SV=1) HSP 1 Score: 92.0485 bits (227), Expect = 1.226e-16 Identity = 45/110 (40.91%), Postives = 63/110 (57.27%), Query Frame = 2 Query: 740 AVESSIKSKSNICLNSADSKYLSFSNKRKRLSL--SNSFIYNRRPRNQPNKSHFWDHEDAKVYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCKIE 1063 A ES + S + + S Y S + RK + +S + NRR R+ + D ++YC+C SYGDMIACD+ +CKIEWFH+ CVD+ PKG W+CP C+ E Sbjct: 216 ASESRLPPPSPEASDRSSSDYESENESRKHQASRSGSSPVRNRRQRDNGS-----DGTGERIYCLCKSYSYGDMIACDNSRCKIEWFHFACVDVKIQPKGKWYCPKCRGE 320
BLAST of Inhibitor of growth protein vs. TrEMBL
Match: A0A0R3WHJ5 (PHD-type domain-containing protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS13 PE=4 SV=1) HSP 1 Score: 92.0485 bits (227), Expect = 1.734e-16 Identity = 38/81 (46.91%), Postives = 52/81 (64.20%), Query Frame = 2 Query: 821 RKRLSLSNSFIYNRRPRNQPNKSHFWDHEDAKVYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCKIE 1063 R R ++S + +R+ S D ++YC+C K SYGDMIACD+ +C+IEWFH+ CVDI T PKG W+CP C+ E Sbjct: 247 RPRSRSTSSPLRSRKREAAGASSTAADVSGERLYCLCKKLSYGDMIACDNPRCEIEWFHFACVDIKTQPKGRWYCPRCRGE 327
BLAST of Inhibitor of growth protein vs. Ensembl Cavefish
Match: ing5b (inhibitor of growth protein 5-like [Source:NCBI gene;Acc:103037104]) HSP 1 Score: 82.0333 bits (201), Expect = 2.513e-17 Identity = 29/49 (59.18%), Postives = 39/49 (79.59%), Query Frame = 2 Query: 917 VYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCKIE 1063 YC+C++ SYG+MI CD+ C IEWFH+ CVD+TT PKG+WFCP C ++ Sbjct: 183 TYCLCSQVSYGEMIGCDNADCPIEWFHFACVDLTTKPKGEWFCPRCVLD 231
BLAST of Inhibitor of growth protein vs. Ensembl Cavefish
Match: ing5a (inhibitor of growth family member 5 [Source:NCBI gene;Acc:103024432]) HSP 1 Score: 80.8777 bits (198), Expect = 8.595e-17 Identity = 35/81 (43.21%), Postives = 50/81 (61.73%), Query Frame = 2 Query: 812 SNKRKRLSLSNSFIYNRRPRNQPNKSHFWDHEDAKVYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVC 1054 S ++K++ SN F + P + + + YC+C++ SYG+MI CD+ C IEWFH+ CVD+TT PKG WFCP C Sbjct: 154 SPRKKKMKNSNEFSDSLLPVHPSDVLDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVDLTTKPKGKWFCPRC 234
BLAST of Inhibitor of growth protein vs. Ensembl Cavefish
Match: ing3 (inhibitor of growth family member 3 [Source:NCBI gene;Acc:103046788]) HSP 1 Score: 82.0333 bits (201), Expect = 2.892e-16 Identity = 28/45 (62.22%), Postives = 35/45 (77.78%), Query Frame = 2 Query: 920 YCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVC 1054 YCICN+ SYG+M+ CD+ C IEWFHY CV +T +PKG W+CP C Sbjct: 362 YCICNQVSYGEMVGCDNQDCPIEWFHYGCVGLTEAPKGKWYCPQC 406
BLAST of Inhibitor of growth protein vs. Ensembl Cavefish
Match: ing4 (inhibitor of growth family, member 4 [Source:ZFIN;Acc:ZDB-GENE-050522-47]) HSP 1 Score: 78.1814 bits (191), Expect = 1.756e-15 Identity = 27/50 (54.00%), Postives = 37/50 (74.00%), Query Frame = 2 Query: 917 VYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCKIEK 1066 YC+C++ SYG+MI CD+ C IEWFH+ CV +TT P+G W+CP C E+ Sbjct: 245 TYCLCHQVSYGEMIGCDNTDCSIEWFHFACVGLTTKPRGKWYCPRCSQER 294
BLAST of Inhibitor of growth protein vs. Ensembl Cavefish
Match: ing2 (inhibitor of growth family member 2 [Source:NCBI gene;Acc:103031897]) HSP 1 Score: 77.7962 bits (190), Expect = 1.782e-15 Identity = 26/47 (55.32%), Postives = 36/47 (76.60%), Query Frame = 2 Query: 917 VYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCK 1057 YC+C + SYG+MI CD+++C IEWFH+ CV +T PKG W+CP C+ Sbjct: 213 TYCLCEQVSYGEMIGCDNEQCPIEWFHFSCVGLTYKPKGRWYCPKCR 259
BLAST of Inhibitor of growth protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008794.1 (pep scaffold:Pmarinus_7.0:GL476329:1735629:1740570:1 gene:ENSPMAG00000007965.1 transcript:ENSPMAT00000008794.1 gene_biotype:protein_coding transcript_biotype:protein_coding) HSP 1 Score: 84.3445 bits (207), Expect = 1.611e-19 Identity = 29/50 (58.00%), Postives = 37/50 (74.00%), Query Frame = 2 Query: 908 DAKVYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCK 1057 D YC+CN+ SYGDMI CD++ C IEWFH+ CV ++ PKG WFCP C+ Sbjct: 57 DEPTYCLCNQVSYGDMIGCDNEACAIEWFHFGCVGLSHKPKGKWFCPRCR 106
BLAST of Inhibitor of growth protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000234.1 (pep scaffold:Pmarinus_7.0:GL482739:14:2848:1 gene:ENSPMAG00000000213.1 transcript:ENSPMAT00000000234.1 gene_biotype:protein_coding transcript_biotype:protein_coding) HSP 1 Score: 75.485 bits (184), Expect = 1.542e-16 Identity = 27/47 (57.45%), Postives = 35/47 (74.47%), Query Frame = 2 Query: 920 YCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCKI 1060 YCICN+ SYG+M+ CD+ C IEWFHY CV + +PKG W+CP C + Sbjct: 86 YCICNQVSYGEMVGCDNQDCPIEWFHYGCVGLKEAPKGKWYCPQCTV 132
BLAST of Inhibitor of growth protein vs. Ensembl Yeast
Match: YNG2 (Subunit of NuA4, an essential histone acetyltransferase complex; positions Piccolo NuA4 for efficient acetylation of histone H4 or histone H2A; relocalizes to the cytosol in response to hypoxia; similar to human tumor suppressor ING1 and its isoforms ING4 and ING5 [Source:SGD;Acc:S000001132]) HSP 1 Score: 87.0409 bits (214), Expect = 1.893e-19 Identity = 36/80 (45.00%), Postives = 51/80 (63.75%), Query Frame = 2 Query: 824 KRLSLSNSFIYNRRPRNQPNKSHFWDHEDAKVYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCKIE 1063 K+++ + F +R + Q N S + ED +YC C + S+G+M+ACD CK EWFHY CV++ PKG W+CP CKIE Sbjct: 193 KKIARTKEFKNSRNGKGQ-NGSPENEEEDKTLYCFCQRVSFGEMVACDGPNCKYEWFHYDCVNLKEPPKGTWYCPECKIE 271
BLAST of Inhibitor of growth protein vs. Ensembl Yeast
Match: PHO23 (Component of the Rpd3L histone deacetylase complex; involved in transcriptional regulation of PHO5; affects termination of snoRNAs and cryptic unstable transcripts (CUTs); C-terminus shares significant sequence identity with the human candidate tumor suppressor p33-ING1 and its isoform ING3 [Source:SGD;Acc:S000005041]) HSP 1 Score: 70.4774 bits (171), Expect = 1.072e-13 Identity = 23/47 (48.94%), Postives = 33/47 (70.21%), Query Frame = 2 Query: 917 VYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCK 1057 +YC CN+ +YG+M+ CD C++EWFH C+ + T PKG W+C CK Sbjct: 281 LYCYCNQVAYGEMVGCDGADCELEWFHLPCIGLETLPKGKWYCDDCK 327
BLAST of Inhibitor of growth protein vs. Ensembl Yeast
Match: YNG1 (Subunit of the NuA3 histone acetyltransferase complex; this complex acetylates histone H3; contains PHD finger domain that interacts with methylated histone H3; shares significant sequence identity with the human candidate tumor suppressor p33-ING1 in C-terminal region [Source:SGD;Acc:S000005590]) HSP 1 Score: 67.781 bits (164), Expect = 1.911e-13 Identity = 24/44 (54.55%), Postives = 30/44 (68.18%), Query Frame = 2 Query: 914 KVYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFC 1045 +VYC C SYG M+ACD+ C EWFHY CV + +PKG W+C Sbjct: 155 EVYCFCRNVSYGPMVACDNPACPFEWFHYGCVGLKQAPKGKWYC 198
BLAST of Inhibitor of growth protein vs. Ensembl Nematostella
Match: EDO40594 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6P9]) HSP 1 Score: 73.9442 bits (180), Expect = 1.400e-16 Identity = 27/48 (56.25%), Postives = 37/48 (77.08%), Query Frame = 2 Query: 920 YCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCKIE 1063 YC+CN+ SYG+M+ CD++ C IEWFHY CV +T +PKG W+CP C + Sbjct: 13 YCLCNQVSYGEMVGCDNNDCPIEWFHYGCVGLTDAPKGKWYCPQCSTQ 60
BLAST of Inhibitor of growth protein vs. Ensembl Nematostella
Match: EDO43857 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXJ4]) HSP 1 Score: 78.1814 bits (191), Expect = 3.100e-16 Identity = 26/50 (52.00%), Postives = 40/50 (80.00%), Query Frame = 2 Query: 917 VYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCKIEK 1066 YC+CN+ S+G+MI CD+++C+IEWFH++CV ++ PKG W+CP C E+ Sbjct: 204 TYCLCNQVSFGEMIGCDNEECQIEWFHFQCVGLSHKPKGKWYCPRCMQER 253
BLAST of Inhibitor of growth protein vs. Ensembl Nematostella
Match: EDO35780 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKJ2]) HSP 1 Score: 62.3882 bits (150), Expect = 8.082e-13 Identity = 24/46 (52.17%), Postives = 31/46 (67.39%), Query Frame = 2 Query: 920 YCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCK 1057 YC+C + G+MIACDS C I WFH C+ +TT+P G+W C V K Sbjct: 1 YCLCGQGESGEMIACDSPSCPIVWFHMDCIGMTTAPDGEWLCRVSK 46
BLAST of Inhibitor of growth protein vs. Ensembl Nematostella
Match: EDO37532 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFP0]) HSP 1 Score: 63.5438 bits (153), Expect = 9.322e-12 Identity = 22/38 (57.89%), Postives = 28/38 (73.68%), Query Frame = 2 Query: 941 SYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVC 1054 SYG+MI CD+ +C IEWFH+ CV + PKG W+CP C Sbjct: 136 SYGEMIGCDNMECPIEWFHFPCVGLVAKPKGKWYCPKC 173
BLAST of Inhibitor of growth protein vs. Ensembl Nematostella
Match: EDO33191 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSY4]) HSP 1 Score: 53.9138 bits (128), Expect = 1.129e-9 Identity = 22/48 (45.83%), Postives = 32/48 (66.67%), Query Frame = 2 Query: 920 YCICNKPS-YGD-MIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCK 1057 +C+C +P GD MI CD+ CK +WFH+ C+ + +PKG W+C CK Sbjct: 1 FCVCQQPECEGDEMIGCDNPSCKYKWFHFTCIKLKRAPKGGWYCKFCK 48
BLAST of Inhibitor of growth protein vs. Ensembl Medaka
Match: ing3 (inhibitor of growth family member 3 [Source:NCBI gene;Acc:101168096]) HSP 1 Score: 81.6481 bits (200), Expect = 3.023e-16 Identity = 31/64 (48.44%), Postives = 42/64 (65.62%), Query Frame = 2 Query: 866 PRNQPNKSHFWDHE-DAKVYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVC 1054 P + N W ++ + YCICN+ SYG+M+ CD+ C IEWFHY CV +T +PKG W+CP C Sbjct: 341 PEAEANSQVDWTYDPNEPRYCICNQVSYGEMVGCDNTDCPIEWFHYGCVGLTEAPKGKWYCPQC 404
BLAST of Inhibitor of growth protein vs. Ensembl Medaka
Match: ing5a (inhibitor of growth family member 5 [Source:NCBI gene;Acc:101171565]) HSP 1 Score: 79.337 bits (194), Expect = 3.067e-16 Identity = 28/46 (60.87%), Postives = 35/46 (76.09%), Query Frame = 2 Query: 917 VYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVC 1054 YC+C++ SYG+MI CD+ C IEWFH+ CVD+ T PKG WFCP C Sbjct: 189 TYCLCHQVSYGEMIGCDNPDCPIEWFHFACVDLATKPKGKWFCPRC 234
BLAST of Inhibitor of growth protein vs. Ensembl Medaka
Match: ing1 (inhibitor of growth family member 1 [Source:NCBI gene;Acc:101155310]) HSP 1 Score: 78.9518 bits (193), Expect = 8.424e-16 Identity = 28/52 (53.85%), Postives = 37/52 (71.15%), Query Frame = 2 Query: 908 DAKVYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCKIE 1063 D YC+C + SYG+MI CD+D+C IEWFH+ CV + PKG W+CP C+ E Sbjct: 233 DEPTYCLCEQVSYGEMIGCDNDECPIEWFHFSCVGLHHKPKGKWYCPKCRGE 284
BLAST of Inhibitor of growth protein vs. Ensembl Medaka
Match: ing4 (inhibitor of growth family member 4 [Source:NCBI gene;Acc:105355951]) HSP 1 Score: 77.411 bits (189), Expect = 1.223e-15 Identity = 26/46 (56.52%), Postives = 36/46 (78.26%), Query Frame = 2 Query: 917 VYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVC 1054 YC+C++ SYG+MI CD+ +C IEWFH+ CV +TT P+G W+CP C Sbjct: 197 TYCLCHQVSYGEMIGCDNTECSIEWFHFACVGLTTKPRGKWYCPRC 242
BLAST of Inhibitor of growth protein vs. Ensembl Medaka
Match: ing2 (inhibitor of growth family member 2 [Source:NCBI gene;Acc:101160358]) HSP 1 Score: 77.7962 bits (190), Expect = 1.590e-15 Identity = 26/47 (55.32%), Postives = 36/47 (76.60%), Query Frame = 2 Query: 917 VYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCK 1057 YC+C + SYG+MI CD+++C IEWFH+ CV +T PKG W+CP C+ Sbjct: 216 TYCLCEQVSYGEMIGCDNEQCPIEWFHFSCVGLTYKPKGKWYCPKCR 262
BLAST of Inhibitor of growth protein vs. Planmine SMEST
Match: SMESG000015211.1 (SMESG000015211.1) HSP 1 Score: 546.969 bits (1408), Expect = 0.000e+0 Identity = 304/306 (99.35%), Postives = 305/306 (99.67%), Query Frame = 2 Query: 152 MANNCIQLLNDLYCSLSNKMSCFVSAHINFNINFDHKLKEINSLLINDQLENINLIXXXXXXXXXXXXXXXXXXCTEEMNTVCSLQNQVFQDCNNDVNIIEMERSPVSLFVNDNLSCEVNQTKLKFREISLPRTKLCDVKNSIVVNKHDHCTKEKFPLYRSKGGSFLHKKLNFNAKQTXXXXXXXXXXXXQNLFKNAVESSIKSKSNICLNSADSKYLSFSNKRKRLSLSNSFIYNRRPRNQPNKSHFWDHEDAKVYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCKIEKY 1069 MANNCIQLLNDLYCSLSNKMSCFVSAHINFNINFDHKLKEINSLLINDQLENINLIKLGSELSELHSLLDLKLKCTEEMNTVCS+QNQVFQDCNNDVNIIEMERSP SLFVNDNLSCEVNQTKLKFREISLPRTKLCDVKNSIVVNKHDHCTKEKFPLYRSKGGSFLHKKLNFNAKQTKHKSKKFISFKKQNLFKNAVESSIKSKSNICLNSADSKYLSFSNKRKRLSLSNSFIYNRRPRNQPNKSHFWDHEDAKVYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCKIEKY Sbjct: 1 MANNCIQLLNDLYCSLSNKMSCFVSAHINFNINFDHKLKEINSLLINDQLENINLIKLGSELSELHSLLDLKLKCTEEMNTVCSMQNQVFQDCNNDVNIIEMERSPGSLFVNDNLSCEVNQTKLKFREISLPRTKLCDVKNSIVVNKHDHCTKEKFPLYRSKGGSFLHKKLNFNAKQTKHKSKKFISFKKQNLFKNAVESSIKSKSNICLNSADSKYLSFSNKRKRLSLSNSFIYNRRPRNQPNKSHFWDHEDAKVYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCKIEKY 306
BLAST of Inhibitor of growth protein vs. Planmine SMEST
Match: SMESG000073543.1 (SMESG000073543.1) HSP 1 Score: 75.485 bits (184), Expect = 1.885e-15 Identity = 27/47 (57.45%), Postives = 38/47 (80.85%), Query Frame = 2 Query: 917 VYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCK 1057 VYC+C++ S+G+M+ACD+ C IEWFH+ CV +T+ PKG WFCP C+ Sbjct: 156 VYCLCHQVSFGEMVACDNKNCSIEWFHFSCVSLTSKPKGMWFCPNCR 202
BLAST of Inhibitor of growth protein vs. Planmine SMEST
Match: SMESG000025474.1 (SMESG000025474.1) HSP 1 Score: 75.8702 bits (185), Expect = 4.263e-15 Identity = 28/46 (60.87%), Postives = 34/46 (73.91%), Query Frame = 2 Query: 920 YCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCK 1057 YC C K +YG MIACD+ CKIEWFH KCV++ P G+WFCP C+ Sbjct: 212 YCYCKKGAYGKMIACDNSGCKIEWFHNKCVNVIDVPNGEWFCPECR 257
BLAST of Inhibitor of growth protein vs. Planmine SMEST
Match: SMESG000025459.1 (SMESG000025459.1) HSP 1 Score: 75.0998 bits (183), Expect = 6.689e-15 Identity = 28/46 (60.87%), Postives = 34/46 (73.91%), Query Frame = 2 Query: 920 YCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCK 1057 YC C K +YG MIACD+ CKIEWFH KCV++ P G+WFCP C+ Sbjct: 212 YCYCKKGAYGKMIACDNSGCKIEWFHNKCVNVIDVPNGEWFCPECR 257
BLAST of Inhibitor of growth protein vs. Planmine SMEST
Match: SMESG000056794.1 (SMESG000056794.1) HSP 1 Score: 76.2554 bits (186), Expect = 1.316e-14 Identity = 30/54 (55.56%), Postives = 35/54 (64.81%), Query Frame = 2 Query: 896 WDHEDAKVYCICNKPSYGDMIACDSDKCKIEWFHYKCVDITTSPKGDWFCPVCK 1057 +D + YC CN SYGDMIACD C EWFHY CV++ +PKG WFC CK Sbjct: 353 FDTNEELRYCFCNDVSYGDMIACDGVGCPREWFHYGCVNLVVAPKGSWFCRDCK 406 The following BLAST results are available for this feature:
BLAST of Inhibitor of growth protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 5
BLAST of Inhibitor of growth protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 5
BLAST of Inhibitor of growth protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 5
BLAST of Inhibitor of growth protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 5
BLAST of Inhibitor of growth protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 5
BLAST of Inhibitor of growth protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 5
BLAST of Inhibitor of growth protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 5
BLAST of Inhibitor of growth protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 5
BLAST of Inhibitor of growth protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 5
BLAST of Inhibitor of growth protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 2
BLAST of Inhibitor of growth protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 3
BLAST of Inhibitor of growth protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 5
BLAST of Inhibitor of growth protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 5
BLAST of Inhibitor of growth protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 5
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30029420 ID=SMED30029420|Name=Inhibitor of growth protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1666bpback to top protein sequence of SMED30029420-orf-1 >SMED30029420-orf-1 ID=SMED30029420-orf-1|Name=SMED30029420-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=307bp MANNCIQLLNDLYCSLSNKMSCFVSAHINFNINFDHKLKEINSLLINDQLback to top Annotated Terms
The following terms have been associated with this transcript:
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
|