Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN

Overview
NamePhosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN
Smed IDSMED30029410
Length (bp)2173
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN (SMED30029410) t-SNE clustered cells

Violin plots show distribution of expression levels for Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN (SMED30029410) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN (SMED30029410) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN (SMED30029410) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029410

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30029410h1SMcG0013344 dd_Smed_v4_8546_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029410h1SMcG0013344 dd_Smed_v4_8546_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30029410h1SMcG0013344 AY068282smed_ncbi_20240424PMID:19048075
Oviedo et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30029410h1SMcG0013344 AY068282smed_ncbi_20240424PMID:19048075
Oviedo et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
X1 cellSMED30029410h1SMcG0013344 AY068282smed_ncbi_20240424PMID:19048075
Oviedo et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
X2 cellSMED30029410h1SMcG0013344 AY068282smed_ncbi_20240424PMID:19048075
Oviedo et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
Xins cellSMED30029410h1SMcG0013344 AY068282smed_ncbi_20240424PMID:19048075
Oviedo et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30029410h1SMcG0013344 AY068282smed_ncbi_20240424PMID:19048075
Oviedo et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30029410h1SMcG0013344 dd_Smed_v4_8546_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Human
Match: PTEN (phosphatase and tensin homolog [Source:HGNC Symbol;Acc:HGNC:9588])

HSP 1 Score: 252.292 bits (643), Expect = 3.800e-76
Identity = 149/379 (39.31%), Postives = 210/379 (55.41%), Query Frame = 3
Query:  108 MPNKLKELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGKGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNGYEIQFVIYIYDREAKQLKVHHTSQFYEARKDGARSLNLLSDECFIVSDDLKFQFILK-SKFGKKENLCHCWLNTFFIVHKPQIQSFQDGIKHNSNSNKVGKSAGRKGPRFTSDNSDESKTDFSHAQSDSDSQPFLYKLRLQKHEIDKACKDLNNKTFPSTFAITFVF 1241
            M   +KE+VS+ K RY +DGFDLDL+YI   IIAMGFPA+  EG+YRN+IDDVV F   KH NHY+IYNLC ERH D  KF  N    QYPF DHNPP    +   C+++  +L  D N++ AI CKAGKGRTGV++CA LL +     A + L FYGE RT + KGVTIPSQ R++YY+ + L+  L Y    L  + ++ + +P+ SG     QFV+        QLKV   S      +   + +     +   V  D+K +F  K +K  KK+ + H W+NTFFI   P  +   + +++ S  ++                  E  +  S  ++D+D +  +  L L K+++DKA KD  N+ F   F +   F
Sbjct:    1 MTAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDTAKF--NCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYLLKNHLDYRPVALLFHKMMFETIPMFSGGTCNPQFVVC-------QLKVKIYSSNSGPTRREDKFMYFEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFI---PGPEETSEKVENGSLCDQ------------------EIDSICSIERADNDKEYLV--LTLTKNDLDKANKDKANRYFSPNFKVKLYF 347          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Human
Match: PTEN (phosphatase and tensin homolog [Source:HGNC Symbol;Acc:HGNC:9588])

HSP 1 Score: 253.832 bits (647), Expect = 8.388e-75
Identity = 148/375 (39.47%), Postives = 209/375 (55.73%), Query Frame = 3
Query:  120 LKELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGKGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNGYEIQFVIYIYDREAKQLKVHHTSQFYEARKDGARSLNLLSDECFIVSDDLKFQFILK-SKFGKKENLCHCWLNTFFIVHKPQIQSFQDGIKHNSNSNKVGKSAGRKGPRFTSDNSDESKTDFSHAQSDSDSQPFLYKLRLQKHEIDKACKDLNNKTFPSTFAITFVF 1241
            +KE+VS+ K RY +DGFDLDL+YI   IIAMGFPA+  EG+YRN+IDDVV F   KH NHY+IYNLC ERH D  KF  N    QYPF DHNPP    +   C+++  +L  D N++ AI CKAGKGRTGV++CA LL +     A + L FYGE RT + KGVTIPSQ R++YY+ + L+  L Y    L  + ++ + +P+ SG     QFV+        QLKV   S      +   + +     +   V  D+K +F  K +K  KK+ + H W+NTFFI   P  +   + +++ S  ++                  E  +  S  ++D+D +  +  L L K+++DKA KD  N+ F   F +   F
Sbjct:  178 IKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDTAKF--NCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYLLKNHLDYRPVALLFHKMMFETIPMFSGGTCNPQFVVC-------QLKVKIYSSNSGPTRREDKFMYFEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFI---PGPEETSEKVENGSLCDQ------------------EIDSICSIERADNDKEYLV--LTLTKNDLDKANKDKANRYFSPNFKVKLYF 520          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Human
Match: PTEN (phosphatase and tensin homolog [Source:HGNC Symbol;Acc:HGNC:9588])

HSP 1 Score: 253.832 bits (647), Expect = 8.388e-75
Identity = 148/375 (39.47%), Postives = 209/375 (55.73%), Query Frame = 3
Query:  120 LKELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGKGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNGYEIQFVIYIYDREAKQLKVHHTSQFYEARKDGARSLNLLSDECFIVSDDLKFQFILK-SKFGKKENLCHCWLNTFFIVHKPQIQSFQDGIKHNSNSNKVGKSAGRKGPRFTSDNSDESKTDFSHAQSDSDSQPFLYKLRLQKHEIDKACKDLNNKTFPSTFAITFVF 1241
            +KE+VS+ K RY +DGFDLDL+YI   IIAMGFPA+  EG+YRN+IDDVV F   KH NHY+IYNLC ERH D  KF  N    QYPF DHNPP    +   C+++  +L  D N++ AI CKAGKGRTGV++CA LL +     A + L FYGE RT + KGVTIPSQ R++YY+ + L+  L Y    L  + ++ + +P+ SG     QFV+        QLKV   S      +   + +     +   V  D+K +F  K +K  KK+ + H W+NTFFI   P  +   + +++ S  ++                  E  +  S  ++D+D +  +  L L K+++DKA KD  N+ F   F +   F
Sbjct:  178 IKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDTAKF--NCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYLLKNHLDYRPVALLFHKMMFETIPMFSGGTCNPQFVVC-------QLKVKIYSSNSGPTRREDKFMYFEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFI---PGPEETSEKVENGSLCDQ------------------EIDSICSIERADNDKEYLV--LTLTKNDLDKANKDKANRYFSPNFKVKLYF 520          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Human
Match: TPTE2 (transmembrane phosphoinositide 3-phosphatase and tensin homolog 2 [Source:HGNC Symbol;Acc:HGNC:17299])

HSP 1 Score: 177.178 bits (448), Expect = 4.065e-49
Identity = 86/181 (47.51%), Postives = 120/181 (66.30%), Query Frame = 3
Query:  120 LKELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNG-----KGVTIPSQIRFIYYF 647
            ++ LVS+ K RY +DGFDLDL+Y+T RIIAM FP+   +  YRN I++VV F  KKH NHY++YNLC+ER  D + F HN ++ +   +DHN P   +M+   KE+ +++  D  NIVAI CK GKGRTG +VCA L++ E   +A + L ++GERRT        +GV  PSQ R++ YF
Sbjct:   70 MRRLVSENKRRYTRDGFDLDLTYVTERIIAMSFPSSGRQSFYRNPIEEVVRFLDKKHRNHYRVYNLCSERAYDPKHF-HNRVS-RIMIDDHNVPTLHEMVVFTKEVNEWMAQDLENIVAIHCKGGKGRTGTMVCALLIASEIFLTAEESLYYFGERRTNKTHSNKFQGVETPSQNRYVGYF 248          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Human
Match: TPTE2 (transmembrane phosphoinositide 3-phosphatase and tensin homolog 2 [Source:HGNC Symbol;Acc:HGNC:17299])

HSP 1 Score: 176.022 bits (445), Expect = 6.892e-48
Identity = 86/181 (47.51%), Postives = 120/181 (66.30%), Query Frame = 3
Query:  120 LKELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNG-----KGVTIPSQIRFIYYF 647
            ++ LVS+ K RY +DGFDLDL+Y+T RIIAM FP+   +  YRN I++VV F  KKH NHY++YNLC+ER  D + F HN ++ +   +DHN P   +M+   KE+ +++  D  NIVAI CK GKGRTG +VCA L++ E   +A + L ++GERRT        +GV  PSQ R++ YF
Sbjct:   90 MRRLVSENKRRYTRDGFDLDLTYVTERIIAMSFPSSGRQSFYRNPIEEVVRFLDKKHRNHYRVYNLCSERAYDPKHF-HNRVS-RIMIDDHNVPTLHEMVVFTKEVNEWMAQDLENIVAIHCKGGKGRTGTMVCALLIASEIFLTAEESLYYFGERRTNKTHSNKFQGVETPSQNRYVGYF 268          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Celegans
Match: daf-18 (Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase daf-18 [Source:UniProtKB/Swiss-Prot;Acc:G5EE01])

HSP 1 Score: 145.976 bits (367), Expect = 7.826e-36
Identity = 78/216 (36.11%), Postives = 118/216 (54.63%), Query Frame = 3
Query:  120 LKELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHA-NHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGKGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNGYEIQFVI 764
             +  VS  + R      DLD +YIT RIIA+G+PA   E  +RN       F  ++H   + +++NL    + D   F+ N I   +   DH+PP    M   C+E +++L++D  +++A+ CKAGKGRTGV++CA L+      S   IL +Y   RT N KGVTIPSQ R+IYY+     +EL Y    ++L  V ++  P   G G +I+  +
Sbjct:   49 FRTAVSSNRCRTEYQNIDLDCAYITDRIIAIGYPATGIEANFRNSKVQTQQFLTRRHGKGNVKVFNLRGGYYYDADNFDGNVIC--FDMTDHHPPSLELMAPFCREAKEWLEADDKHVIAVHCKAGKGRTGVMICALLIYINFYPSPRQILDYYSIIRTKNNKGVTIPSQRRYIYYYHKLRERELNYLPLRMQLIGVYVERPPKTWGGGSKIKVEV 262          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Celegans
Match: tns-1 (TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L045])

HSP 1 Score: 55.8398 bits (133), Expect = 1.236e-7
Identity = 65/292 (22.26%), Postives = 119/292 (40.75%), Query Frame = 3
Query:  126 ELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACL---LSQEPDKSATD--ILQFYGER-RTTNGKGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNGYEIQFVIYIYDR-----EAKQLKVHHTSQFYEARKDGARSLNLLSDECFIVSDDLKFQFILKSKFGKKENLC--HCWLNT 962
            +L  K+K++  ++G  ++  YITSR+I +   +++ E  +   +          H  H +++N+   RH      +  +I   +P      P   ++   CK +  ++   P NI  I CK G  R  ++V A +        D S  D   +Q + ER    +G     PS  R++ YF   L   +      L L++++L            I   + IY+R     ++K + ++ +S+F     DG+  L            D+ F+ I+ +        C   C LNT
Sbjct:   31 QLRLKQKMKDRKEGVQVE--YITSRLIVLSCTSETSERKFVESLLKASQQIQNAHNKHIRVWNVSQRRHDISSSLD--AIPFGWP--SETAPSLEKLCTICKNLDQWMLEHPLNIAVIFCKGGLERCAIVVNAFMRFNAISATDDSVDDRFSMQRFSERFLGPDGP----PSYKRYLGYFSSLLSGRISVNSDPLYLHNIILTFF-------EPINVFLKIYERLVPVYQSKTVALNKSSKF---EMDGSLKLR----------GDIFFKCIVAASSPGSSTRCLFTCQLNT 292          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Celegans
Match: tns-1 (TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L045])

HSP 1 Score: 53.5286 bits (127), Expect = 5.359e-7
Identity = 61/276 (22.10%), Postives = 109/276 (39.49%), Query Frame = 3
Query:  174 LDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACL---LSQEPDKSATD--ILQFYGER-RTTNGKGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNGYEIQFVIYIYDR-----EAKQLKVHHTSQFYEARKDGARSLNLLSDECFIVSDDLKFQFILKSKFGKKENLC--HCWLNT 962
            + + YITSR+I +   +++ E  +   +          H  H +++N+   RH      +  +I   +P      P   ++   CK +  ++   P NI  I CK G  R  ++V A +        D S  D   +Q + ER    +G     PS  R++ YF   L   +      L L++++L            I   + IY+R     ++K + ++ +S+F     DG+  L            D+ F+ I+ +        C   C LNT
Sbjct:    8 VQVEYITSRLIVLSCTSETSERKFVESLLKASQQIQNAHNKHIRVWNVSQRRHDISSSLD--AIPFGWP--SETAPSLEKLCTICKNLDQWMLEHPLNIAVIFCKGGLERCAIVVNAFMRFNAISATDDSVDDRFSMQRFSERFLGPDGP----PSYKRYLGYFSSLLSGRISVNSDPLYLHNIILTFF-------EPINVFLKIYERLVPVYQSKTVALNKSSKF---EMDGSLKLR----------GDIFFKCIVAASSPGSSTRCLFTCQLNT 255          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Fly
Match: Pten (gene:FBgn0026379 transcript:FBtr0089902)

HSP 1 Score: 217.624 bits (553), Expect = 2.587e-63
Identity = 134/395 (33.92%), Postives = 194/395 (49.11%), Query Frame = 3
Query:  105 IMPNKLKELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPA-QSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGKGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNGYEIQFVIYIYDREAKQLKVHHTSQFYEARKDGARSLNLLSDECFI--------VSDDLKFQFILKSKFGKKENLCHCWLNTFFIVHKPQIQSFQDGIKHNSNSNKVGKSAGRKGPRFTSDNSDESKTDFSHAQSDSDSQPFLYKLRLQKHEIDKACKDLNNKTFPSTFAITFVFENYHFNN 1262
            +M N ++ +VSKK+IRY + G+DLDL+YI   IIAMG+PA    EG++RN ++DV     + HA HY+IYNLC+ER  D  KF        YPF+DHNPP    +   C ++  +L  D +N+VA+ CKAGKGRTG ++CA L+     KSA + L +Y E+RT + KGVTIPSQ R++ YF   +   + Y K  L +  +   E   +   G                + V H S    A+ D  ++L +   + F+        VS D+KF+   KS     + +CH WLNTFF+                                           ++S  +SD     +++   L K EID   KD  +K F   F I+ VFE  +F+N
Sbjct:    7 LMSNVIRNVVSKKRIRYKEKGYDLDLTYINDNIIAMGYPAPDKLEGLFRNRLEDVFKLLEENHAQHYKIYNLCSERSYDVAKFRGRVA--VYPFDDHNPPTIELIQRFCSDVDMWLKEDSSNVVAVHCKAGKGRTGTMICAYLVFSGIKKSADEALAWYDEKRTKDRKGVTIPSQRRYVQYFSKLVCSSVPYSKVSLNVCEIRFSESSCVQNLGM-----------VECSISVLHDSATENAKPDRLKTLPIDFQKSFVLTIKPSIPVSGDVKFELTKKS---PDKIICHFWLNTFFV------------------------------------------RNYSPCESDGTVNKYIHT--LSKSEIDDVHKDSEHKRFSEEFKISIVFEAENFSN 341          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Fly
Match: Pten (gene:FBgn0026379 transcript:FBtr0089905)

HSP 1 Score: 218.394 bits (555), Expect = 1.193e-62
Identity = 134/395 (33.92%), Postives = 194/395 (49.11%), Query Frame = 3
Query:  105 IMPNKLKELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPA-QSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGKGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNGYEIQFVIYIYDREAKQLKVHHTSQFYEARKDGARSLNLLSDECFI--------VSDDLKFQFILKSKFGKKENLCHCWLNTFFIVHKPQIQSFQDGIKHNSNSNKVGKSAGRKGPRFTSDNSDESKTDFSHAQSDSDSQPFLYKLRLQKHEIDKACKDLNNKTFPSTFAITFVFENYHFNN 1262
            +M N ++ +VSKK+IRY + G+DLDL+YI   IIAMG+PA    EG++RN ++DV     + HA HY+IYNLC+ER  D  KF        YPF+DHNPP    +   C ++  +L  D +N+VA+ CKAGKGRTG ++CA L+     KSA + L +Y E+RT + KGVTIPSQ R++ YF   +   + Y K  L +  +   E   +   G                + V H S    A+ D  ++L +   + F+        VS D+KF+   KS     + +CH WLNTFF+                                           ++S  +SD     +++   L K EID   KD  +K F   F I+ VFE  +F+N
Sbjct:    7 LMSNVIRNVVSKKRIRYKEKGYDLDLTYINDNIIAMGYPAPDKLEGLFRNRLEDVFKLLEENHAQHYKIYNLCSERSYDVAKFRGRVA--VYPFDDHNPPTIELIQRFCSDVDMWLKEDSSNVVAVHCKAGKGRTGTMICAYLVFSGIKKSADEALAWYDEKRTKDRKGVTIPSQRRYVQYFSKLVCSSVPYSKVSLNVCEIRFSESSCVQNLGM-----------VECSISVLHDSATENAKPDRLKTLPIDFQKSFVLTIKPSIPVSGDVKFELTKKS---PDKIICHFWLNTFFV------------------------------------------RNYSPCESDGTVNKYIHT--LSKSEIDDVHKDSEHKRFSEEFKISIVFEAENFSN 341          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Fly
Match: Pten (gene:FBgn0026379 transcript:FBtr0089901)

HSP 1 Score: 218.394 bits (555), Expect = 1.193e-62
Identity = 134/395 (33.92%), Postives = 194/395 (49.11%), Query Frame = 3
Query:  105 IMPNKLKELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPA-QSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGKGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNGYEIQFVIYIYDREAKQLKVHHTSQFYEARKDGARSLNLLSDECFI--------VSDDLKFQFILKSKFGKKENLCHCWLNTFFIVHKPQIQSFQDGIKHNSNSNKVGKSAGRKGPRFTSDNSDESKTDFSHAQSDSDSQPFLYKLRLQKHEIDKACKDLNNKTFPSTFAITFVFENYHFNN 1262
            +M N ++ +VSKK+IRY + G+DLDL+YI   IIAMG+PA    EG++RN ++DV     + HA HY+IYNLC+ER  D  KF        YPF+DHNPP    +   C ++  +L  D +N+VA+ CKAGKGRTG ++CA L+     KSA + L +Y E+RT + KGVTIPSQ R++ YF   +   + Y K  L +  +   E   +   G                + V H S    A+ D  ++L +   + F+        VS D+KF+   KS     + +CH WLNTFF+                                           ++S  +SD     +++   L K EID   KD  +K F   F I+ VFE  +F+N
Sbjct:    7 LMSNVIRNVVSKKRIRYKEKGYDLDLTYINDNIIAMGYPAPDKLEGLFRNRLEDVFKLLEENHAQHYKIYNLCSERSYDVAKFRGRVA--VYPFDDHNPPTIELIQRFCSDVDMWLKEDSSNVVAVHCKAGKGRTGTMICAYLVFSGIKKSADEALAWYDEKRTKDRKGVTIPSQRRYVQYFSKLVCSSVPYSKVSLNVCEIRFSESSCVQNLGM-----------VECSISVLHDSATENAKPDRLKTLPIDFQKSFVLTIKPSIPVSGDVKFELTKKS---PDKIICHFWLNTFFV------------------------------------------RNYSPCESDGTVNKYIHT--LSKSEIDDVHKDSEHKRFSEEFKISIVFEAENFSN 341          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Fly
Match: Pten (gene:FBgn0026379 transcript:FBtr0300562)

HSP 1 Score: 218.394 bits (555), Expect = 1.478e-62
Identity = 134/395 (33.92%), Postives = 194/395 (49.11%), Query Frame = 3
Query:  105 IMPNKLKELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPA-QSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGKGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNGYEIQFVIYIYDREAKQLKVHHTSQFYEARKDGARSLNLLSDECFI--------VSDDLKFQFILKSKFGKKENLCHCWLNTFFIVHKPQIQSFQDGIKHNSNSNKVGKSAGRKGPRFTSDNSDESKTDFSHAQSDSDSQPFLYKLRLQKHEIDKACKDLNNKTFPSTFAITFVFENYHFNN 1262
            +M N ++ +VSKK+IRY + G+DLDL+YI   IIAMG+PA    EG++RN ++DV     + HA HY+IYNLC+ER  D  KF        YPF+DHNPP    +   C ++  +L  D +N+VA+ CKAGKGRTG ++CA L+     KSA + L +Y E+RT + KGVTIPSQ R++ YF   +   + Y K  L +  +   E   +   G                + V H S    A+ D  ++L +   + F+        VS D+KF+   KS     + +CH WLNTFF+                                           ++S  +SD     +++   L K EID   KD  +K F   F I+ VFE  +F+N
Sbjct:    7 LMSNVIRNVVSKKRIRYKEKGYDLDLTYINDNIIAMGYPAPDKLEGLFRNRLEDVFKLLEENHAQHYKIYNLCSERSYDVAKFRGRVA--VYPFDDHNPPTIELIQRFCSDVDMWLKEDSSNVVAVHCKAGKGRTGTMICAYLVFSGIKKSADEALAWYDEKRTKDRKGVTIPSQRRYVQYFSKLVCSSVPYSKVSLNVCEIRFSESSCVQNLGM-----------VECSISVLHDSATENAKPDRLKTLPIDFQKSFVLTIKPSIPVSGDVKFELTKKS---PDKIICHFWLNTFFV------------------------------------------RNYSPCESDGTVNKYIHT--LSKSEIDDVHKDSEHKRFSEEFKISIVFEAENFSN 341          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Fly
Match: Pten (gene:FBgn0026379 transcript:FBtr0301521)

HSP 1 Score: 218.394 bits (555), Expect = 1.478e-62
Identity = 134/395 (33.92%), Postives = 194/395 (49.11%), Query Frame = 3
Query:  105 IMPNKLKELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPA-QSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGKGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNGYEIQFVIYIYDREAKQLKVHHTSQFYEARKDGARSLNLLSDECFI--------VSDDLKFQFILKSKFGKKENLCHCWLNTFFIVHKPQIQSFQDGIKHNSNSNKVGKSAGRKGPRFTSDNSDESKTDFSHAQSDSDSQPFLYKLRLQKHEIDKACKDLNNKTFPSTFAITFVFENYHFNN 1262
            +M N ++ +VSKK+IRY + G+DLDL+YI   IIAMG+PA    EG++RN ++DV     + HA HY+IYNLC+ER  D  KF        YPF+DHNPP    +   C ++  +L  D +N+VA+ CKAGKGRTG ++CA L+     KSA + L +Y E+RT + KGVTIPSQ R++ YF   +   + Y K  L +  +   E   +   G                + V H S    A+ D  ++L +   + F+        VS D+KF+   KS     + +CH WLNTFF+                                           ++S  +SD     +++   L K EID   KD  +K F   F I+ VFE  +F+N
Sbjct:    7 LMSNVIRNVVSKKRIRYKEKGYDLDLTYINDNIIAMGYPAPDKLEGLFRNRLEDVFKLLEENHAQHYKIYNLCSERSYDVAKFRGRVA--VYPFDDHNPPTIELIQRFCSDVDMWLKEDSSNVVAVHCKAGKGRTGTMICAYLVFSGIKKSADEALAWYDEKRTKDRKGVTIPSQRRYVQYFSKLVCSSVPYSKVSLNVCEIRFSESSCVQNLGM-----------VECSISVLHDSATENAKPDRLKTLPIDFQKSFVLTIKPSIPVSGDVKFELTKKS---PDKIICHFWLNTFFV------------------------------------------RNYSPCESDGTVNKYIHT--LSKSEIDDVHKDSEHKRFSEEFKISIVFEAENFSN 341          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Zebrafish
Match: ptena (phosphatase and tensin homolog A [Source:ZFIN;Acc:ZDB-GENE-030131-3776])

HSP 1 Score: 278.485 bits (711), Expect = 5.853e-86
Identity = 160/388 (41.24%), Postives = 220/388 (56.70%), Query Frame = 3
Query:  102 IIMPNKLKELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGKGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNGYEIQFVIYIYDREAKQLKVH-HTSQFYEARKDGARSLNLLSDECFIVSDDLKFQFILK-SKFGKKENLCHCWLNTFFIVHKPQIQSFQDGIKHNSNSNKV------GKSAGRKGPRFTSDNSDESKTDFSHAQSDSDSQPFLYKLRLQKHEIDKACKDLNNKTFPSTFAITFVF 1241
            + M  KLKE+VS+ K RY +DGFDLDL+YI   IIAMGFPA+  EG+YRN+IDDVV F   KH NHY+IYNLC ERH D  KF  N    QYPF DHNPP    +   C+++  +L  D N++ AI CKAGKGRTGV++CA LL ++    A + L FYGE RT + KGVTIPSQ R++YY+ + L+ +L Y+   L  + +V   +P+ SG     QFV+Y       QLKV  HTS     R++  + +     +   V  D+K +F  K SK  KK+ + H W+NTFFI   P  +   D +++ S  N V       +S+  +  R        +  D    +  +D +     L L K+++DKA KD  N+ F   F +   F
Sbjct:    1 MAMTAKLKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDASKF--NCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDENHVAAIHCKAGKGRTGVMICAYLLHRKKFAEAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYLLKNKLDYKPVALLFHKMVFQTLPMFSGGTCNPQFVVY-------QLKVKIHTSNPAHTRRE-EKHMIFEFPQPLPVCGDIKVEFFHKQSKMMKKDKMFHFWINTFFI---PGPEEAGDKVENGSVVNDVDSLSCQSQSSPAERDREKERAVAAAALDRERGEQRADGEKDYLILTLTKNDLDKANKDKANRYFSPNFKVKLYF 375          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Zebrafish
Match: ptena (phosphatase and tensin homolog A [Source:ZFIN;Acc:ZDB-GENE-030131-3776])

HSP 1 Score: 271.937 bits (694), Expect = 7.910e-84
Identity = 158/380 (41.58%), Postives = 212/380 (55.79%), Query Frame = 3
Query:  108 MPNKLKELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGKGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNGYEIQFVIYIYDREAKQLKVH-HTSQFYEARKDGARSLNLLSDECFIVSDDLKFQFILK-SKFGKKENLCHCWLNTFFIVHKPQIQSFQDGIKHNSNSNKVGKSAGRKGPRFTSDNSDESKTDFSHAQSDSDSQPFLYKLRLQKHEIDKACKDLNNKTFPSTFAITFVF 1241
            M  KLKE+VS+ K RY +DGFDLDL+YI   IIAMGFPA+  EG+YRN+IDDVV F   KH NHY+IYNLC ERH D  KF  N    QYPF DHNPP    +   C+++  +L  D N++ AI CKAGKGRTGV++CA LL ++    A + L FYGE RT + KGVTIPSQ R++YY+ + L+ +L Y+   L  + +V   +P+ SG     QFV+Y       QLKV  HTS     R++  + +     +   V  D+K +F  K SK  KK+ + H W+NTFFI   P  +   D +++ S  N V K                           +D +     L L K+++DKA KD  N+ F   F +   F
Sbjct:    1 MTAKLKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDASKF--NCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDENHVAAIHCKAGKGRTGVMICAYLLHRKKFAEAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYLLKNKLDYKPVALLFHKMVFQTLPMFSGGTCNPQFVVY-------QLKVKIHTSNPAHTRRE-EKHMIFEFPQPLPVCGDIKVEFFHKQSKMMKKDKMFHFWINTFFI---PGPEEAGDKVENGSVVNDVDKQR-------------------------ADGEKDYLILTLTKNDLDKANKDKANRYFSPNFKVKLYF 342          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Zebrafish
Match: ptena (phosphatase and tensin homolog A [Source:ZFIN;Acc:ZDB-GENE-030131-3776])

HSP 1 Score: 271.937 bits (694), Expect = 7.910e-84
Identity = 158/380 (41.58%), Postives = 212/380 (55.79%), Query Frame = 3
Query:  108 MPNKLKELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGKGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNGYEIQFVIYIYDREAKQLKVH-HTSQFYEARKDGARSLNLLSDECFIVSDDLKFQFILK-SKFGKKENLCHCWLNTFFIVHKPQIQSFQDGIKHNSNSNKVGKSAGRKGPRFTSDNSDESKTDFSHAQSDSDSQPFLYKLRLQKHEIDKACKDLNNKTFPSTFAITFVF 1241
            M  KLKE+VS+ K RY +DGFDLDL+YI   IIAMGFPA+  EG+YRN+IDDVV F   KH NHY+IYNLC ERH D  KF  N    QYPF DHNPP    +   C+++  +L  D N++ AI CKAGKGRTGV++CA LL ++    A + L FYGE RT + KGVTIPSQ R++YY+ + L+ +L Y+   L  + +V   +P+ SG     QFV+Y       QLKV  HTS     R++  + +     +   V  D+K +F  K SK  KK+ + H W+NTFFI   P  +   D +++ S  N V K                           +D +     L L K+++DKA KD  N+ F   F +   F
Sbjct:    1 MTAKLKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDASKF--NCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDENHVAAIHCKAGKGRTGVMICAYLLHRKKFAEAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYLLKNKLDYKPVALLFHKMVFQTLPMFSGGTCNPQFVVY-------QLKVKIHTSNPAHTRRE-EKHMIFEFPQPLPVCGDIKVEFFHKQSKMMKKDKMFHFWINTFFI---PGPEEAGDKVENGSVVNDVDKQR-------------------------ADGEKDYLILTLTKNDLDKANKDKANRYFSPNFKVKLYF 342          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Zebrafish
Match: ptena (phosphatase and tensin homolog A [Source:ZFIN;Acc:ZDB-GENE-030131-3776])

HSP 1 Score: 268.855 bits (686), Expect = 4.934e-82
Identity = 160/401 (39.90%), Postives = 220/401 (54.86%), Query Frame = 3
Query:  102 IIMPNKLKELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGKGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNGYEIQFVIYIYDREAKQLKVH-HTSQFYEARKDGARSLNLLSDECFIVSDDLKFQFILK-SKFGKK-------------ENLCHCWLNTFFIVHKPQIQSFQDGIKHNSNSNKV------GKSAGRKGPRFTSDNSDESKTDFSHAQSDSDSQPFLYKLRLQKHEIDKACKDLNNKTFPSTFAITFVF 1241
            + M  KLKE+VS+ K RY +DGFDLDL+YI   IIAMGFPA+  EG+YRN+IDDVV F   KH NHY+IYNLC ERH D  KF  N    QYPF DHNPP    +   C+++  +L  D N++ AI CKAGKGRTGV++CA LL ++    A + L FYGE RT + KGVTIPSQ R++YY+ + L+ +L Y+   L  + +V   +P+ SG     QFV+Y       QLKV  HTS     R++  + +     +   V  D+K +F  K SK  KK             + + H W+NTFFI   P  +   D +++ S  N V       +S+  +  R        +  D    +  +D +     L L K+++DKA KD  N+ F   F +   F
Sbjct:    1 MAMTAKLKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDASKF--NCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDENHVAAIHCKAGKGRTGVMICAYLLHRKKFAEAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYLLKNKLDYKPVALLFHKMVFQTLPMFSGGTCNPQFVVY-------QLKVKIHTSNPAHTRRE-EKHMIFEFPQPLPVCGDIKVEFFHKQSKMMKKVCLTRLDLLHKPLDKMFHFWINTFFI---PGPEEAGDKVENGSVVNDVDSLSCQSQSSPAERDREKERAVAAAALDRERGEQRADGEKDYLILTLTKNDLDKANKDKANRYFSPNFKVKLYF 388          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Zebrafish
Match: ptena (phosphatase and tensin homolog A [Source:ZFIN;Acc:ZDB-GENE-030131-3776])

HSP 1 Score: 268.47 bits (685), Expect = 8.864e-82
Identity = 160/411 (38.93%), Postives = 222/411 (54.01%), Query Frame = 3
Query:  102 IIMPNKLKELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGKGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNG-----------------------YEIQFVIYIYDREAKQLKVH-HTSQFYEARKDGARSLNLLSDECFIVSDDLKFQFILK-SKFGKKENLCHCWLNTFFIVHKPQIQSFQDGIKHNSNSNKV------GKSAGRKGPRFTSDNSDESKTDFSHAQSDSDSQPFLYKLRLQKHEIDKACKDLNNKTFPSTFAITFVF 1241
            + M  KLKE+VS+ K RY +DGFDLDL+YI   IIAMGFPA+  EG+YRN+IDDVV F   KH NHY+IYNLC ERH D  KF  N    QYPF DHNPP    +   C+++  +L  D N++ AI CKAGKGRTGV++CA LL ++    A + L FYGE RT + KGVTIPSQ R++YY+ + L+ +L Y+   L  + +V   +P+ SG                         ++ QFV+Y       QLKV  HTS     R++  + +     +   V  D+K +F  K SK  KK+ + H W+NTFFI   P  +   D +++ S  N V       +S+  +  R        +  D    +  +D +     L L K+++DKA KD  N+ F   F +   F
Sbjct:    1 MAMTAKLKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDASKF--NCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDENHVAAIHCKAGKGRTGVMICAYLLHRKKFAEAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYLLKNKLDYKPVALLFHKMVFQTLPMFSGGTCRDSTVKNRSEVNPQGFKKGSWHWDPQFVVY-------QLKVKIHTSNPAHTRRE-EKHMIFEFPQPLPVCGDIKVEFFHKQSKMMKKDKMFHFWINTFFI---PGPEEAGDKVENGSVVNDVDSLSCQSQSSPAERDREKERAVAAAALDRERGEQRADGEKDYLILTLTKNDLDKANKDKANRYFSPNFKVKLYF 398          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Xenopus
Match: pten (phosphatase and tensin homolog [Source:NCBI gene;Acc:100144716])

HSP 1 Score: 254.988 bits (650), Expect = 3.680e-77
Identity = 154/382 (40.31%), Postives = 212/382 (55.50%), Query Frame = 3
Query:  108 MPNKLKELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGKGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNGYEIQFVIYIYDREAKQLKVHHTSQFYEARKDGARSLNLLS---DECFIVSDDLKFQFILK-SKFGKKENLCHCWLNTFFIVHKPQIQSFQDGIKHNSNSNKVGKSAGRKGPRFTSDNSDESKTDFSHAQSDSDSQPFLYKLRLQKHEIDKACKDLNNKTFPSTFAITFVF 1241
            M   +KE VS+ K RY +DGFDLDL+YI   IIAMGFPA+  EG+YRN+IDDVV F   KH NHY+IYNLC ERH D  KF       QYPF DHNPP    +   C+++  +L S+  N+ AI CKAGKGRTGV++CA LL +     A + L FYGE RT + KGVTIPSQ R++YY+ + L+  L+Y    L  + +  + +P+ SG+    QFV+Y       QLKV    + + +     R   L+     +   V  D+K +F  K +K  KKE + H W+NTFFI   P  + + + ++   N   VG+               E    +S  +SD+D +     L L K+++DKA KD  N+ F   F +   F
Sbjct:    1 MTAIIKEFVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDTNKFSCRVA--QYPFEDHNPPQLELIKPFCEDLDQWL-SENENVAAIHCKAGKGRTGVMICAYLLHRGKFPRAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYLLKNNLEYRPVPLLFHKIEFETIPMFSGSTCNPQFVVY-------QLKV----KIFTSTAGPKRIEKLMYFDFPQPLPVCGDIKVEFFHKQNKVMKKEKMFHFWINTFFI---PGPEEYSEKVE---NGTLVGEQ--------------ELDGIYSTERSDNDKE--YLTLTLTKNDLDKANKDKANRLFSPNFKVKLFF 346          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Xenopus
Match: pten (phosphatase and tensin homolog [Source:NCBI gene;Acc:100144716])

HSP 1 Score: 204.142 bits (518), Expect = 1.301e-58
Identity = 135/376 (35.90%), Postives = 190/376 (50.53%), Query Frame = 3
Query:  120 LKELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGKGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNGYEIQFVIYIYDREAKQLKVH-HTSQFYEARKDGARSLNLLSDECFIVSDDLKFQFILK-SKFGKKENLCHCWLNTFFIVHKPQIQSFQDGIKHNSNSNKVGKSAGRKGPRFTSDNSDESKTDFSHAQSDSDSQPFLYKLRLQKHEIDKACKDLNNKTFPSTFAITFVF 1241
            +KE VS+ K RY +DGFDLDL+YI   IIAMGFPA+  EG+YRN+IDDV                                    YPF DHNPP    +   C+++  +L S+  N+ AI CKAGKGRTGV++CA LL +     A + L FYGE RT + KGVTIPSQ R++YY+ + L+  L+Y    L  + +  + +P+ SG+    QFV+Y       QLKV   TS     R +     +    +   V  D+K +F  K +K  KKE + H W+NTFFI   P  + + + ++   N   VG+               E    +S  +SD+D +     L L K+++DKA KD  N+ F   F +   F
Sbjct:    5 IKEFVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDV------------------------------------YPFEDHNPPQLELIKPFCEDLDQWL-SENENVAAIHCKAGKGRTGVMICAYLLHRGKFPRAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYLLKNNLEYRPVPLLFHKIEFETIPMFSGSTCNPQFVVY-------QLKVKIFTSTAGPKRIEKLMYFDF--PQPLPVCGDIKVEFFHKQNKVMKKEKMFHFWINTFFI---PGPEEYSEKVE---NGTLVGEQ--------------ELDGIYSTERSDNDKE--YLTLTLTKNDLDKANKDKANRLFSPNFKVKLFF 312          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Xenopus
Match: tpte2 (transmembrane phosphoinositide 3-phosphatase and tensin homolog 2 [Source:NCBI gene;Acc:548705])

HSP 1 Score: 176.792 bits (447), Expect = 7.132e-48
Identity = 109/298 (36.58%), Postives = 166/298 (55.70%), Query Frame = 3
Query:  123 KELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRT-----TNGKGVTIPSQIRFIYYFEHF---LRKELKYEKTVLKLNHVVLDEMPIIS-GNGYEIQFVIYIYDREAKQLKVHHTSQ----FYEARKDGARSLNLLSDECFIVSDDLKFQFILKSKFGKKENLC--HCWLNTFFI 971
            + LVS+ K RY +DGFDLDL+YIT RIIAM FP+   +  YRN I++V  F   KH +HY+IYNLC+E+  D + F H  +   +  +DHN P+   M+     ++ ++  DP N++AI CK GKGRTG +VC  L+  +  +SA + L ++GERRT     T  +GV  PSQ R++ Y+E       ++L  EK  LK+  + +  +  +   NG +++  I I  +E     V  T      F++A   G  S+ +  D C ++S D+K +F   +   K  + C  + W NT FI
Sbjct:  125 RRLVSENKRRYQKDGFDLDLTYITDRIIAMSFPSSGKQSFYRNPIEEVARFLDSKHQDHYKIYNLCSEKGYDPKYF-HYRVERVF-IDDHNVPVLADMLTFTASVRAWMAEDPQNVIAIHCKGGKGRTGTMVCTYLVDSDQFESAVESLDYFGERRTDTSVSTKFQGVETPSQSRYVAYYEVLKNKFSRQLPPEKQ-LKIRSIRIYSIQGVGRSNGTDLKVQI-IMKKEVVFQCVCETQGNCKLFFDA---GNNSIVISLDGCPVISGDIKIRFESSANIPKGYDDCAFYFWFNTSFI 415          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Xenopus
Match: tpte2 (transmembrane phosphoinositide 3-phosphatase and tensin homolog 2 [Source:NCBI gene;Acc:548705])

HSP 1 Score: 177.563 bits (449), Expect = 1.436e-47
Identity = 109/298 (36.58%), Postives = 166/298 (55.70%), Query Frame = 3
Query:  123 KELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRT-----TNGKGVTIPSQIRFIYYFEHF---LRKELKYEKTVLKLNHVVLDEMPIIS-GNGYEIQFVIYIYDREAKQLKVHHTSQ----FYEARKDGARSLNLLSDECFIVSDDLKFQFILKSKFGKKENLC--HCWLNTFFI 971
            + LVS+ K RY +DGFDLDL+YIT RIIAM FP+   +  YRN I++V  F   KH +HY+IYNLC+E+  D + F H  +   +  +DHN P+   M+     ++ ++  DP N++AI CK GKGRTG +VC  L+  +  +SA + L ++GERRT     T  +GV  PSQ R++ Y+E       ++L  EK  LK+  + +  +  +   NG +++  I I  +E     V  T      F++A   G  S+ +  D C ++S D+K +F   +   K  + C  + W NT FI
Sbjct:  183 RRLVSENKRRYQKDGFDLDLTYITDRIIAMSFPSSGKQSFYRNPIEEVARFLDSKHQDHYKIYNLCSEKGYDPKYF-HYRVERVF-IDDHNVPVLADMLTFTASVRAWMAEDPQNVIAIHCKGGKGRTGTMVCTYLVDSDQFESAVESLDYFGERRTDTSVSTKFQGVETPSQSRYVAYYEVLKNKFSRQLPPEKQ-LKIRSIRIYSIQGVGRSNGTDLKVQI-IMKKEVVFQCVCETQGNCKLFFDA---GNNSIVISLDGCPVISGDIKIRFESSANIPKGYDDCAFYFWFNTSFI 473          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Xenopus
Match: tpte2 (transmembrane phosphoinositide 3-phosphatase and tensin homolog 2 [Source:NCBI gene;Acc:548705])

HSP 1 Score: 176.407 bits (446), Expect = 1.844e-47
Identity = 109/298 (36.58%), Postives = 166/298 (55.70%), Query Frame = 3
Query:  123 KELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRT-----TNGKGVTIPSQIRFIYYFEHF---LRKELKYEKTVLKLNHVVLDEMPIIS-GNGYEIQFVIYIYDREAKQLKVHHTSQ----FYEARKDGARSLNLLSDECFIVSDDLKFQFILKSKFGKKENLC--HCWLNTFFI 971
            + LVS+ K RY +DGFDLDL+YIT RIIAM FP+   +  YRN I++V  F   KH +HY+IYNLC+E+  D + F H  +   +  +DHN P+   M+     ++ ++  DP N++AI CK GKGRTG +VC  L+  +  +SA + L ++GERRT     T  +GV  PSQ R++ Y+E       ++L  EK  LK+  + +  +  +   NG +++  I I  +E     V  T      F++A   G  S+ +  D C ++S D+K +F   +   K  + C  + W NT FI
Sbjct:  146 RRLVSENKRRYQKDGFDLDLTYITDRIIAMSFPSSGKQSFYRNPIEEVARFLDSKHQDHYKIYNLCSEKGYDPKYF-HYRVERVF-IDDHNVPVLADMLTFTASVRAWMAEDPQNVIAIHCKGGKGRTGTMVCTYLVDSDQFESAVESLDYFGERRTDTSVSTKFQGVETPSQSRYVAYYEVLKNKFSRQLPPEKQ-LKIRSIRIYSIQGVGRSNGTDLKVQI-IMKKEVVFQCVCETQGNCKLFFDA---GNNSIVISLDGCPVISGDIKIRFESSANIPKGYDDCAFYFWFNTSFI 436          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Mouse
Match: Pten (phosphatase and tensin homolog [Source:MGI Symbol;Acc:MGI:109583])

HSP 1 Score: 252.292 bits (643), Expect = 2.350e-76
Identity = 149/379 (39.31%), Postives = 210/379 (55.41%), Query Frame = 3
Query:  108 MPNKLKELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGKGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNGYEIQFVIYIYDREAKQLKVHHTSQFYEARKDGARSLNLLSDECFIVSDDLKFQFILK-SKFGKKENLCHCWLNTFFIVHKPQIQSFQDGIKHNSNSNKVGKSAGRKGPRFTSDNSDESKTDFSHAQSDSDSQPFLYKLRLQKHEIDKACKDLNNKTFPSTFAITFVF 1241
            M   +KE+VS+ K RY +DGFDLDL+YI   IIAMGFPA+  EG+YRN+IDDVV F   KH NHY+IYNLC ERH D  KF  N    QYPF DHNPP    +   C+++  +L  D N++ AI CKAGKGRTGV++CA LL +     A + L FYGE RT + KGVTIPSQ R++YY+ + L+  L Y    L  + ++ + +P+ SG     QFV+        QLKV   S      +   + +     +   V  D+K +F  K +K  KK+ + H W+NTFFI   P  +   + +++ S  ++                  E  +  S  ++D+D +  +  L L K+++DKA KD  N+ F   F +   F
Sbjct:    1 MTAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDTAKF--NCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYLLKNHLDYRPVALLFHKMMFETIPMFSGGTCNPQFVVC-------QLKVKIYSSNSGPTRREDKFMYFEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFI---PGPEETSEKVENGSLCDQ------------------EIDSICSIERADNDKEYLV--LTLTKNDLDKANKDKANRYFSPNFKVKLYF 347          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Mouse
Match: Tpte (transmembrane phosphatase with tensin homology [Source:MGI Symbol;Acc:MGI:2446460])

HSP 1 Score: 186.037 bits (471), Expect = 3.827e-50
Identity = 94/228 (41.23%), Postives = 137/228 (60.09%), Query Frame = 3
Query:  123 KELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNG-----KGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIIS--------GNGYEIQFVIY 767
            ++LVS  K RY +DGFDLDL+Y+T RIIAM FP+   E  YRN I +VV F   KH NHYQ+YNLC+ER  D + F +     +   +DHN P   +M+   KE+ +++  DP N+VAI CK GKGRTG +VCACL++ E   +A + L F+GERRT        +G+  PSQ R++ YFE     ++ Y+ T+     +V+  + + S        G+  E+Q +++
Sbjct:  340 RKLVSGNKRRYKKDGFDLDLTYVTERIIAMSFPSSGRESFYRNPIKEVVRFLDTKHPNHYQVYNLCSERAYDPKHFHYRV--RRIMIDDHNVPTLEEMLLFSKEVNNWMAQDPENVVAIHCKGGKGRTGTMVCACLIASEIVLNAKESLYFFGERRTDKSNSSKFQGIETPSQNRYVKYFEKL---KINYQLTLPPKKVLVIKRLVVYSIHGVGKGDGSDLEVQIIMW 562          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Mouse
Match: Tpte (transmembrane phosphatase with tensin homology [Source:MGI Symbol;Acc:MGI:2446460])

HSP 1 Score: 185.652 bits (470), Expect = 1.586e-49
Identity = 110/297 (37.04%), Postives = 164/297 (55.22%), Query Frame = 3
Query:  123 KELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNG-----KGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIIS------GNGYEIQFVIYIYDREAKQL-KVHHTSQFYEARKDGARSLNLLSDECFIVSDDLKFQFILKSKFGKKENLC--HCWLNTFFI 971
            ++LVS  K RY +DGFDLDL+Y+T RIIAM FP+   E  YRN I +VV F   KH NHYQ+YNLC+ER  D + F +     +   +DHN P   +M+   KE+ +++  DP N+VAI CK GKGRTG +VCACL++ E   +A + L F+GERRT        +G+  PSQ R++ YFE     ++ Y+ T+     +V+  + + S      G+G +++  I ++           +   F++   D A  +N+    C  + DD+K +F L     K  + C    W +T FI
Sbjct:  340 RKLVSGNKRRYKKDGFDLDLTYVTERIIAMSFPSSGRESFYRNPIKEVVRFLDTKHPNHYQVYNLCSERAYDPKHFHYRV--RRIMIDDHNVPTLEEMLLFSKEVNNWMAQDPENVVAIHCKGGKGRTGTMVCACLIASEIVLNAKESLYFFGERRTDKSNSSKFQGIETPSQNRYVKYFEKL---KINYQLTLPPKKVLVIKRLVVYSIHGVGKGDGSDLEVQIIMWQETVFSFCNSRNCMIFHDPETDRA-IINVF--HCPALYDDVKVKF-LSPNLPKYYDDCPFFFWFHTSFI 627          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Mouse
Match: Tns1 (tensin 1 [Source:MGI Symbol;Acc:MGI:104552])

HSP 1 Score: 111.309 bits (277), Expect = 1.858e-24
Identity = 62/200 (31.00%), Postives = 103/200 (51.50%), Query Frame = 3
Query:  150 RYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGKGVTI--PSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNG 743
            R ++D  +LDL Y+T RIIA+ FP+ + E  +R+++ +V      KH  +Y ++NL  +R  D  K     +   +P  D + P   ++   CK +  +L++DP+N+V +  K  +GR GV++ A L       SA   L  +  +R    K V I  PSQ R+++YF   L   +K     L L+HV++  +P     G
Sbjct:  176 RAMEDSCELDLVYVTERIIAVSFPSTANEENFRSNLREVAQMLKSKHGGNYLLFNLSEQRP-DITKLHAKVLEFGWP--DLHTPALEKICSVCKAMDTWLNADPHNVVVLHNKGNRGRIGVVIAAYLHYSNISASADQALDRFAMKRFYEDKIVPIGQPSQRRYVHYFSGLLSGSIKMNNKPLFLHHVIMHGIPNFESKG 372          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Mouse
Match: Tns1 (tensin 1 [Source:MGI Symbol;Acc:MGI:104552])

HSP 1 Score: 111.309 bits (277), Expect = 1.937e-24
Identity = 62/200 (31.00%), Postives = 103/200 (51.50%), Query Frame = 3
Query:  150 RYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGKGVTI--PSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNG 743
            R ++D  +LDL Y+T RIIA+ FP+ + E  +R+++ +V      KH  +Y ++NL  +R  D  K     +   +P  D + P   ++   CK +  +L++DP+N+V +  K  +GR GV++ A L       SA   L  +  +R    K V I  PSQ R+++YF   L   +K     L L+HV++  +P     G
Sbjct:  176 RAMEDSCELDLVYVTERIIAVSFPSTANEENFRSNLREVAQMLKSKHGGNYLLFNLSEQRP-DITKLHAKVLEFGWP--DLHTPALEKICSVCKAMDTWLNADPHNVVVLHNKGNRGRIGVVIAAYLHYSNISASADQALDRFAMKRFYEDKIVPIGQPSQRRYVHYFSGLLSGSIKMNNKPLFLHHVIMHGIPNFESKG 372          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. UniProt/SwissProt
Match: sp|Q9PUT6|PTEN_XENLA (Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Xenopus laevis OX=8355 GN=pten PE=2 SV=1)

HSP 1 Score: 256.144 bits (653), Expect = 6.493e-77
Identity = 155/382 (40.58%), Postives = 213/382 (55.76%), Query Frame = 3
Query:  108 MPNKLKELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGKGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNGYEIQFVIYIYDREAKQLKVHHTSQFYEARKDGARSLNLLS---DECFIVSDDLKFQFILK-SKFGKKENLCHCWLNTFFIVHKPQIQSFQDGIKHNSNSNKVGKSAGRKGPRFTSDNSDESKTDFSHAQSDSDSQPFLYKLRLQKHEIDKACKDLNNKTFPSTFAITFVF 1241
            M   +KE VS+ K RY +DGFDLDL+YI   IIAMGFPA+  EG+YRN+IDDVV F   KH NHY+IYNLC ERH D  KF       QYPF DHNPP    +   C+++ D L S+  N+ AI CKAGKGRTGV++CA LL +     A + L FYGE RT + KGVTIPSQ R++YY+ + L+  L+Y    L  + +  + +P+ SG+    QFV+Y       QLKV    + + +     R+  L+     +   V  D+K +F  K +K  KKE + H W+NTFFI   P  + + + ++   N   VG+               E    +S  +SD+D +     L L K+++DKA KD  N+ F   F +   F
Sbjct:    1 MTAIIKEFVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDTNKFSCRVA--QYPFEDHNPPQLELIKPFCEDL-DQLLSENENVAAIHCKAGKGRTGVMICAYLLHRGKFPRAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYLLKNSLEYRPVPLLFHKIEFETIPMFSGSTCNPQFVVY-------QLKV----KIFTSTAGPKRAEKLMYFDFPQPLPVCGDIKVEFFHKQNKVMKKEKMFHFWVNTFFI---PGPEEYSEKVE---NGTLVGEQ--------------ELDGIYSTERSDNDKE--YLTLALTKNDLDKANKDKANRLFSPNFKVKLFF 346          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. UniProt/SwissProt
Match: sp|O08586|PTEN_MOUSE (Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Mus musculus OX=10090 GN=Pten PE=1 SV=1)

HSP 1 Score: 252.292 bits (643), Expect = 1.644e-75
Identity = 149/379 (39.31%), Postives = 210/379 (55.41%), Query Frame = 3
Query:  108 MPNKLKELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGKGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNGYEIQFVIYIYDREAKQLKVHHTSQFYEARKDGARSLNLLSDECFIVSDDLKFQFILK-SKFGKKENLCHCWLNTFFIVHKPQIQSFQDGIKHNSNSNKVGKSAGRKGPRFTSDNSDESKTDFSHAQSDSDSQPFLYKLRLQKHEIDKACKDLNNKTFPSTFAITFVF 1241
            M   +KE+VS+ K RY +DGFDLDL+YI   IIAMGFPA+  EG+YRN+IDDVV F   KH NHY+IYNLC ERH D  KF  N    QYPF DHNPP    +   C+++  +L  D N++ AI CKAGKGRTGV++CA LL +     A + L FYGE RT + KGVTIPSQ R++YY+ + L+  L Y    L  + ++ + +P+ SG     QFV+        QLKV   S      +   + +     +   V  D+K +F  K +K  KK+ + H W+NTFFI   P  +   + +++ S  ++                  E  +  S  ++D+D +  +  L L K+++DKA KD  N+ F   F +   F
Sbjct:    1 MTAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDTAKF--NCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYLLKNHLDYRPVALLFHKMMFETIPMFSGGTCNPQFVVC-------QLKVKIYSSNSGPTRREDKFMYFEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFI---PGPEETSEKVENGSLCDQ------------------EIDSICSIERADNDKEYLV--LTLTKNDLDKANKDKANRYFSPNFKVKLYF 347          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. UniProt/SwissProt
Match: sp|P60484|PTEN_HUMAN (Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Homo sapiens OX=9606 GN=PTEN PE=1 SV=1)

HSP 1 Score: 252.292 bits (643), Expect = 1.825e-75
Identity = 149/379 (39.31%), Postives = 210/379 (55.41%), Query Frame = 3
Query:  108 MPNKLKELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGKGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNGYEIQFVIYIYDREAKQLKVHHTSQFYEARKDGARSLNLLSDECFIVSDDLKFQFILK-SKFGKKENLCHCWLNTFFIVHKPQIQSFQDGIKHNSNSNKVGKSAGRKGPRFTSDNSDESKTDFSHAQSDSDSQPFLYKLRLQKHEIDKACKDLNNKTFPSTFAITFVF 1241
            M   +KE+VS+ K RY +DGFDLDL+YI   IIAMGFPA+  EG+YRN+IDDVV F   KH NHY+IYNLC ERH D  KF  N    QYPF DHNPP    +   C+++  +L  D N++ AI CKAGKGRTGV++CA LL +     A + L FYGE RT + KGVTIPSQ R++YY+ + L+  L Y    L  + ++ + +P+ SG     QFV+        QLKV   S      +   + +     +   V  D+K +F  K +K  KK+ + H W+NTFFI   P  +   + +++ S  ++                  E  +  S  ++D+D +  +  L L K+++DKA KD  N+ F   F +   F
Sbjct:    1 MTAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDTAKF--NCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYLLKNHLDYRPVALLFHKMMFETIPMFSGGTCNPQFVVC-------QLKVKIYSSNSGPTRREDKFMYFEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFI---PGPEETSEKVENGSLCDQ------------------EIDSICSIERADNDKEYLV--LTLTKNDLDKANKDKANRYFSPNFKVKLYF 347          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. UniProt/SwissProt
Match: sp|P60483|PTEN_CANLF (Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Canis lupus familiaris OX=9615 GN=PTEN PE=2 SV=1)

HSP 1 Score: 252.292 bits (643), Expect = 1.825e-75
Identity = 149/379 (39.31%), Postives = 210/379 (55.41%), Query Frame = 3
Query:  108 MPNKLKELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGKGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNGYEIQFVIYIYDREAKQLKVHHTSQFYEARKDGARSLNLLSDECFIVSDDLKFQFILK-SKFGKKENLCHCWLNTFFIVHKPQIQSFQDGIKHNSNSNKVGKSAGRKGPRFTSDNSDESKTDFSHAQSDSDSQPFLYKLRLQKHEIDKACKDLNNKTFPSTFAITFVF 1241
            M   +KE+VS+ K RY +DGFDLDL+YI   IIAMGFPA+  EG+YRN+IDDVV F   KH NHY+IYNLC ERH D  KF  N    QYPF DHNPP    +   C+++  +L  D N++ AI CKAGKGRTGV++CA LL +     A + L FYGE RT + KGVTIPSQ R++YY+ + L+  L Y    L  + ++ + +P+ SG     QFV+        QLKV   S      +   + +     +   V  D+K +F  K +K  KK+ + H W+NTFFI   P  +   + +++ S  ++                  E  +  S  ++D+D +  +  L L K+++DKA KD  N+ F   F +   F
Sbjct:    1 MTAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDTAKF--NCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYLLKNHLDYRPVALLFHKMMFETIPMFSGGTCNPQFVVC-------QLKVKIYSSNSGPTRREDKFMYFEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFI---PGPEETSEKVENGSLCDQ------------------EIDSICSIERADNDKEYLV--LTLTKNDLDKANKDKANRYFSPNFKVKLYF 347          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. UniProt/SwissProt
Match: sp|Q8T9S7|PTEN_DICDI (Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Dictyostelium discoideum OX=44689 GN=pteN PE=2 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 4.293e-53
Identity = 97/221 (43.89%), Postives = 141/221 (63.80%), Query Frame = 3
Query:  108 MPNKLKELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGKGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNGYEIQFVIYI 770
            M N L+  VSK+K RY ++G+DLDL+YIT  I+AMGFP++  EG++RN + DV  F  + H +H+++YNLC+ER  D  KF +  + + YPF+DHN P F  +   C+++  ++  D  NI  I CKAGKGRTG+++C  L+     K+  D L+FY   RT N KGVTIPSQIR++ YF   +R+ +KY    + L  +VL  +P    N  E+QF I +
Sbjct:    1 MSNLLRVAVSKQKRRYQKNGYDLDLAYITDNIVAMGFPSEKVEGVFRNPMKDVQRFLDQYHKDHFKVYNLCSERVYDHSKF-YGRVGY-YPFDDHNAPQFEMIDAFCRDVDAWMKEDSKNIAVIHCKAGKGRTGLMICCWLMYCGMWKNTEDSLRFYAALRTYNQKGVTIPSQIRYVGYFGRSIRESIKYVPRNVTLKKIVLRPLP-KEINLSEVQFNISV 218          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. TrEMBL
Match: Q6TGR7 (Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Danio rerio OX=7955 GN=ptena PE=2 SV=1)

HSP 1 Score: 278.485 bits (711), Expect = 1.310e-82
Identity = 160/388 (41.24%), Postives = 220/388 (56.70%), Query Frame = 3
Query:  102 IIMPNKLKELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGKGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNGYEIQFVIYIYDREAKQLKVH-HTSQFYEARKDGARSLNLLSDECFIVSDDLKFQFILK-SKFGKKENLCHCWLNTFFIVHKPQIQSFQDGIKHNSNSNKV------GKSAGRKGPRFTSDNSDESKTDFSHAQSDSDSQPFLYKLRLQKHEIDKACKDLNNKTFPSTFAITFVF 1241
            + M  KLKE+VS+ K RY +DGFDLDL+YI   IIAMGFPA+  EG+YRN+IDDVV F   KH NHY+IYNLC ERH D  KF  N    QYPF DHNPP    +   C+++  +L  D N++ AI CKAGKGRTGV++CA LL ++    A + L FYGE RT + KGVTIPSQ R++YY+ + L+ +L Y+   L  + +V   +P+ SG     QFV+Y       QLKV  HTS     R++  + +     +   V  D+K +F  K SK  KK+ + H W+NTFFI   P  +   D +++ S  N V       +S+  +  R        +  D    +  +D +     L L K+++DKA KD  N+ F   F +   F
Sbjct:    1 MAMTAKLKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDASKF--NCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDENHVAAIHCKAGKGRTGVMICAYLLHRKKFAEAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYLLKNKLDYKPVALLFHKMVFQTLPMFSGGTCNPQFVVY-------QLKVKIHTSNPAHTRRE-EKHMIFEFPQPLPVCGDIKVEFFHKQSKMMKKDKMFHFWINTFFI---PGPEEAGDKVENGSVVNDVDSLSCQSQSSPAERDREKERAVAAAALDRERGEQRADGEKDYLILTLTKNDLDKANKDKANRYFSPNFKVKLYF 375          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. TrEMBL
Match: A0A3S6CXE8 (Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Epinephelus coioides OX=94232 PE=2 SV=1)

HSP 1 Score: 277.33 bits (708), Expect = 3.346e-82
Identity = 158/381 (41.47%), Postives = 222/381 (58.27%), Query Frame = 3
Query:  108 MPNKLKELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGKGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNGYEIQFVIYIYDREAKQLKVH-HTSQFYEARKDGARSLNLLSDECFIVSDDLKFQFILK-SKFGKKENLCHCWLNTFFIVHKPQI-QSFQDGIKHNSNSNKVGKSAGRKGPRFTSDNSDESKTDFSHAQSDSDSQPFLYKLRLQKHEIDKACKDLNNKTFPSTFAITFVF 1241
            M + LKE+VS+ K RY +DGFDLDL+YI   IIAMGFPA+  EG+YRN+IDDVV F   KH NHY+IYNLC ERH D  KF  N    QYPF DHNPP    +   C+++  +L  D N++ AI CKAGKGRTGV++CA LL +     A + L FYGE RT + KGVTIPSQ R++YY+ + L+ +L+Y+   L  + +V + +P+ SG     QFV+Y       QLKV  HTS     R++  + +     +   V  D+K +F  K +K  KK+ + H W+NTFFI    +     ++G  +N++S +   + G+  P+     S E +     +  +SD       L L K+++DKA KD  N+ F   F +   F
Sbjct:    1 MASLLKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDAAKF--NCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLEAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYLLKNQLEYKPVALLFHKMVFETLPMFSGGTCNPQFVVY-------QLKVKIHTSNPARTRRED-KHMFFEFPQPLPVCGDIKVEFFHKQNKMMKKDKMFHFWVNTFFIPGPEESGDKMENGAVNNADSQQGVPAQGQGQPQ-----SAECRDSCRESGRESDRDRDYLILTLTKNDLDKANKDKANRYFSPNFKVKLYF 366          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. TrEMBL
Match: A0A3Q3K1X2 (Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Monopterus albus OX=43700 PE=3 SV=1)

HSP 1 Score: 275.789 bits (704), Expect = 7.943e-82
Identity = 161/380 (42.37%), Postives = 219/380 (57.63%), Query Frame = 3
Query:  108 MPNKLKELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGKGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNGYEIQFVIYIYDREAKQLKVH-HTSQFYEARKDGARSLNLLSDECFIVSDDLKFQFILK-SKFGKKENLCHCWLNTFFIVHKPQIQSFQDGIKHNSNSNKVGKSAGRKGPRFTSDNSDESKTDFSHAQSDSDSQPFLYKLRLQKHEIDKACKDLNNKTFPSTFAITFVF 1241
            M   +KE+VS+ K RY +DGFDLDL+YI   IIAMGFPA+  EG+YRN+IDDVV F   KH NHY+IYNLC ERH D  KF  N    QYPF DHNPP    +   C+++  +L  D N++ AI CKAGKGRTGV++CA LL +     A + L FYGE RT + KGVTIPSQ R++YY+ + L+ +L+Y+   L  + +V + +P+ SG     QFV+Y       QLKV  HTS     R++    L     +   V  D+K +F  K +K  KK+ + H W+NTFFI   P  +   D +++ + +N   +  G  GP     +S E +      QSD D       L L K+++DKA KD  N+ F   F +   F
Sbjct:    1 MAAIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDAAKF--NCRVAQYPFEDHNPPQLELIKPFCEDLDKWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRRKFHEAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYLLKNQLEYKPVALLFHKMVFETLPMFSGGTCNPQFVVY-------QLKVKIHTSNPTHTRREDKHMLFEFP-QPLPVCGDIKVEFFHKQNKMMKKDKMFHFWVNTFFI---PGPEESGDKMENGAVNNAESQQGG-PGPDQGQPHSAEVR------QSDRD----YLILTLTKNDLDKANKDKANRYFSPNFKVKLYF 356          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. TrEMBL
Match: A0A2I4AQK2 (Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Austrofundulus limnaeus OX=52670 GN=LOC106513467 PE=3 SV=1)

HSP 1 Score: 275.404 bits (703), Expect = 1.685e-81
Identity = 158/381 (41.47%), Postives = 225/381 (59.06%), Query Frame = 3
Query:  108 MPNKLKELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGKGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNGYEIQFVIYIYDREAKQLKVH-HTSQFYEARKDGARSLNLLSDECFIVSDDLKFQFILK-SKFGKKENLCHCWLNTFFIVHKPQI-QSFQDGIKHNSNSNKVGKSAGRKGPRFTSDNSDESKTDFSHAQSDSDSQPFLYKLRLQKHEIDKACKDLNNKTFPSTFAITFVF 1241
            M  K+KE+VS+ K RY +DGFDLDL+YI   IIAMGFPA+  EG+YRN+IDDVV F   KH NHY+IYNLC ERH D  KF  N    QYPF DHNPP    +   C+++  +L  D N++ AI CKAGKGRTGV++CA LL ++    A + L FYGE RT + KGVTIPSQ R+++Y+ + L+K L Y+   L  + +V + +P+ SG     QFV+Y       QLKV  HTS     R++  + +     +   V  D+K +F  K +K  KK+ + H W+NTFFI    +  +  ++G  +N  S + G   G +G + ++++ D  +      + D D +  +  L L K+++DKA KD  N+ F   F +   F
Sbjct:    4 MTAKIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDAAKF--NCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRKKFPEAQEALDFYGEVRTRDKKGVTIPSQRRYVHYYNYLLKKGLDYKPVALLFHKMVFETLPMFSGGTCNPQFVVY-------QLKVKIHTSNPAHTRRED-KHMIFEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPDESGEKMENGAVNNVESQQGGAVPG-QGQQQSAESKDGCR------EGDRDKEYLI--LTLTKNDLDKANKDKANRYFSPNFKVKLYF 365          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. TrEMBL
Match: A0A1B6IPR6 (Uncharacterized protein OS=Homalodisca liturata OX=320908 GN=g.22824 PE=4 SV=1)

HSP 1 Score: 275.404 bits (703), Expect = 2.157e-81
Identity = 152/383 (39.69%), Postives = 219/383 (57.18%), Query Frame = 3
Query:   99 NIIMPNKLKELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGKGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPI-ISGNGYEIQFVIYIYDREAKQLKVHHTSQFYEARKDGARSLNLLSDECFIVSDDLKFQFILKSKFGKKENLCHCWLNTFFIVHKPQIQSFQDGIKHNSNSNKVGKSAGRKGPRFTSDNSDESKTDFSHAQSDSDSQPFLYKLRLQKHEIDKACKDLNNKTFPSTFAITFVFE 1244
            N+ M N LK LVSK++ RY QDGF+LDLSYI   +IAMGFPA+  EG+YRNHIDDVV F   KH +HY+IYNLC+ER  D  KF+    N  YPF+DHNPP    +   C ++  +L  D  N+ A+ CKAGKGRTGV+VC  +L     +SA + L FYG++RTT+ KGVTIPSQ R++ Y+   +++ L Y + V+ +  V L+ +P   SG    IQ VIY    E    KV  +    +  K G   +++   +  IV  D+K +F  K K  +KE + H W NTFF+  +  +    +    +   ++  +S   +     S  ++      S +   +DS+P +  LR+ K ++D A KD  NK + S F ++ V E
Sbjct:    7 NMKMTNPLKGLVSKRRKRYTQDGFNLDLSYIQENLIAMGFPAEKLEGVYRNHIDDVVKFLESKHKDHYKIYNLCSERSYDVNKFQQRVAN--YPFDDHNPPRIEVIRPFCDDVHKWLTKDKRNVAAVHCKAGKGRTGVMVCCYMLHSRQFQSANEALSFYGQKRTTDRKGVTIPSQRRYVDYYATLVQENLDYHQVVVSIRDVFLEPVPSQFSGGQGNIQLVIYNKVEEGTN-KVFSSPP--QEVKRGETRISIHLGDNVIVQGDVKLEFFSKPKMMRKEKMFHFWFNTFFVRDQAPVPEPTENGNSDLIPDRSSRSLSYEEQSHHSTFNETKPRGGSLSLDSADSRPLI--LRIGKWDLDDAHKDKTNKLYSSDFKVSLVLE 382          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Cavefish
Match: ENSAMXT00000007968.2 (phosphatase and tensin homolog [Source:NCBI gene;Acc:103025186])

HSP 1 Score: 262.692 bits (670), Expect = 2.402e-80
Identity = 153/398 (38.44%), Postives = 219/398 (55.03%), Query Frame = 3
Query:  108 MPNKLKELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGKGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNGYEIQFVIYIYDREAKQLKVH-HTSQFYEARKDGARSLNLLSDECFIVSDDLKFQFI-LKSKFGKKENLCHCWLNTFFIVHKPQIQSFQDGIKHNSNSNKVGKSAGRKGPRFTSDNSDESKTDFSHAQSDSDSQPFLYKLRLQKHEIDKACKDLNNKTFPSTFAITFVFENY---HFNNQKSPSKMI 1286
            M   ++++VS+ K RY +DGFDLDL+YI   +IAMGFPA+  EG+YRN+IDDVV F   KH NHY+IYNLC ERH D  KF  N    QYPF DHNPP    +   C+++  +L    N++ AI CKAGKGRTGV++CA LL Q   K A + L FYGE RT + KGVTIPSQ R++YY+ + L+ +L Y+   L  + ++ + +P+ SG      FV+Y       QLKV  HTS     R++  + ++    +   V  D+K +F   ++K  KK+ + H W+NTFFI    +++  ++G                       D   E     S  + ++D    +  L L KH++DKA KD  N+ F   F +   F        N++ SPS  +
Sbjct:    1 MATIIQKMVSRNKRRYQEDGFDLDLTYIYPNLIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDTAKF--NCRVAQYPFEDHNPPQLELIRPFCEDLDKWLGEHDNHVAAIHCKAGKGRTGVMICAYLLHQGKFKKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYLLKNKLDYKPVALLFHKMMFETVPMFSGGNCNPHFVVY-------QLKVKIHTSNPGNTRREDNKCMHFEFPQPLPVCGDIKVEFFNRQNKMLKKDKMFHFWVNTFFIPGPEKLEKVENG-----------------------DLPKELDEIQSLEKGENDKDYLI--LTLTKHDLDKANKDKANRLFSPNFKVKLYFTKTLEETSNSEASPSTSV 364          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Cavefish
Match: ENSAMXT00000043891.1 (phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN-like [Source:NCBI gene;Acc:103046962])

HSP 1 Score: 262.307 bits (669), Expect = 1.382e-79
Identity = 137/290 (47.24%), Postives = 183/290 (63.10%), Query Frame = 3
Query:  108 MPNKLKELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGKGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNGYEIQFVIYIYDREAKQLKVH-HTSQFYEARKDGARSLNLLSDECFIVSDDLKFQFILK-SKFGKKENLCHCWLNTFFI 971
            M   +KE+VS+ K RY +DGFDLDL+YI   IIAMGFPA+  EG+YRN+IDDVV F   KH NHY+IYNLC ERH D  KF  N    QYPF DHNPP    +   C+++  +L  D N++ AI CKAGKGRTGV++CA LL ++    A + L FYGE RT + KGVTIPSQ R++YY+ H L+ +L+Y+   L  + +V + +P+ SG     QFV+Y       QLKV  HTS     R++  + +     +   V  D+K +F  K +K  KK+ + H W+NTFFI
Sbjct:    1 MAAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHRNHYKIYNLCAERHYDAAKF--NCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDENHVAAIHCKAGKGRTGVMICAYLLHRQKFMEAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSHLLKNQLEYKPVALLFHKMVFETLPMFSGGTCNPQFVVY-------QLKVKIHTSNPSHTRRED-KHMFFEFPQPLPVCGDIKVEFFHKQNKMMKKDKMFHFWVNTFFI 280          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Cavefish
Match: ENSAMXT00000055423.1 (phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN-like [Source:NCBI gene;Acc:103046962])

HSP 1 Score: 252.292 bits (643), Expect = 1.404e-75
Identity = 137/313 (43.77%), Postives = 185/313 (59.11%), Query Frame = 3
Query:  108 MPNKLKELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGKGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNG-----------------------YEIQFVIYIYDREAKQLKVH-HTSQFYEARKDGARSLNLLSDECFIVSDDLKFQFILK-SKFGKKENLCHCWLNTFFI 971
            M   +KE+VS+ K RY +DGFDLDL+YI   IIAMGFPA+  EG+YRN+IDDVV F   KH NHY+IYNLC ERH D  KF  N    QYPF DHNPP    +   C+++  +L  D N++ AI CKAGKGRTGV++CA LL ++    A + L FYGE RT + KGVTIPSQ R++YY+ H L+ +L+Y+   L  + +V + +P+ SG                         ++ QFV+Y       QLKV  HTS     R++  + +     +   V  D+K +F  K +K  KK+ + H W+NTFFI
Sbjct:    1 MAAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHRNHYKIYNLCAERHYDAAKF--NCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDENHVAAIHCKAGKGRTGVMICAYLLHRQKFMEAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSHLLKNQLEYKPVALLFHKMVFETLPMFSGGTCRDSTVKNRSEANPQGFKKGNWHWDPQFVVY-------QLKVKIHTSNPSHTRRED-KHMFFEFPQPLPVCGDIKVEFFHKQNKMMKKDKMFHFWVNTFFI 303          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Cavefish
Match: ENSAMXT00000038725.1 (phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN-like [Source:NCBI gene;Acc:103046962])

HSP 1 Score: 189.889 bits (481), Expect = 1.561e-53
Identity = 125/380 (32.89%), Postives = 189/380 (49.74%), Query Frame = 3
Query:  108 MPNKLKELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGKGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNGYEIQFVIYIYDREAKQLKVH-HTSQFYEARKDGARSLNLLSDECFIVSDDLKFQFILK-SKFGKKENLCHCWLNTFFIVHKPQIQSFQDGIKHNSNSNKVGKSAGRKGPRFTSDNSDESKTDFSHAQSDSDSQPFLYKLRLQKHEIDKACKDLNNKTFPSTFAITFVF 1241
            M   +KE+VS+ K RY +DGFDLDL+YI   IIAM         ++  H+           A + ++Y                    +YPF DHNPP    +   C+++  +L  D N++ AI CKAGKGRTGV++CA LL ++    A + L FYGE RT + KGVTIPSQ R++YY+ H L+ +L+Y+   L  + +V + +P+ SG     QFV+Y       QLKV  HTS     R++  + +     +   V  D+K +F  K +K  KK+ + H W+NTFFI   P  +   +  ++ S  N +  ++ + G                    D+D    +  L L K+++DKA KD  N+ F   F +   F
Sbjct:    1 MAAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAM---------VHLQHV--------HTPAQNTRVY------------------QEEYPFEDHNPPQLELIKPFCEDLDQWLSEDENHVAAIHCKAGKGRTGVMICAYLLHRQKFMEAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSHLLKNQLEYKPVALLFHKMVFETLPMFSGGTCNPQFVVY-------QLKVKIHTSNPSHTRRED-KHMFFEFPQPLPVCGDIKVEFFHKQNKMMKKDKMFHFWVNTFFI---PGPEESPEKWENGSVVNDIDSNSSQTG------------------APDADRDYLI--LTLTKNDLDKANKDKANRYFSPNFKVKLYF 314          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Cavefish
Match: ENSAMXT00000047718.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001063.1:308295:333196:1 gene:ENSAMXG00000032162.1 transcript:ENSAMXT00000047718.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 118.242 bits (295), Expect = 1.228e-28
Identity = 67/234 (28.63%), Postives = 122/234 (52.14%), Query Frame = 3
Query:  156 VQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGK--GVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNGYEIQFV-------------IYIYDREAKQLKVHHTS 812
            +++G++LDL+Y+T RIIA+ FP    E  Y +++ DV      KHA++Y + NL  +RH D  +    +++  +P + H PP+  ++   CK ++++L++DP ++V I C+ GKGR GV++C+ +   +   SA   L  +  R+  + K   +  PSQ R+++     L   +K   + L L+ ++L  +P    +G    F+             +Y Y     Q+K  H S
Sbjct:    8 MEEGYELDLTYVTERIIAVSFPQSCSEETYLHNLKDVTRMLKSKHADNYLVINLSEKRH-DLTRMNPKTLDTGWP-DLHAPPL-DKICTICKAMENWLNADPLHVVVIHCRGGKGRIGVVICSFVHFTDISASADQALDRFAMRKFYDDKVSALMTPSQKRYVWILNSLLSGSMKMNASPLFLHCIILHGIPNFDNSGVCRPFIKVYQAMQAVYYSGVYKYSVIGLQVKCFHKS 238          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Sea Lamprey
Match: TNS1 (tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973])

HSP 1 Score: 109.383 bits (272), Expect = 9.441e-25
Identity = 65/199 (32.66%), Postives = 105/199 (52.76%), Query Frame = 3
Query:  156 VQDGFDLDLSYITSRIIAMGFPAQSWEGI-YRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGK--GVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNG 743
            ++ G DL+L+YIT RII++  P      + Y   + DV    H KHAN Y + NL   RH D +KF  +  +  +P + H PP+   +   CK +  +L++DP ++V I CK  K RTGV+V + +       SA+  L  Y  ++  + K   ++ PSQ R++ YF   L   +K     L L+H+V+  +P +  +G
Sbjct:    7 MEGGRDLELTYITERIISLCAPTGGDSHVAYHQQMRDVARMLHSKHANGYLVINLSERRH-DIEKFNVHVRDFGWP-DLHAPPL-DVLCSICKAMDSWLNADPAHVVVIHCKGNKCRTGVVVASYMYYNGICASASQALDRYAMKKFYDDKVAKLSQPSQRRYVSYFSELLSGRVKVNNLPLFLHHIVIHGLPNLEDDG 202          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010484.1 (pep scaffold:Pmarinus_7.0:GL477590:9709:49115:-1 gene:ENSPMAG00000009496.1 transcript:ENSPMAT00000010484.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 94.3597 bits (233), Expect = 1.671e-20
Identity = 62/233 (26.61%), Postives = 105/233 (45.06%), Query Frame = 3
Query:  168 FDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERR--TTNGKGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEM---PIISGNGYEIQFVIYIYDREAKQLKVHHTSQFYEAR---KDGA 842
            F+ DL+YIT RIIA   P    E  +++ + D+      KHA+ Y I NL   R+   +  + N     + +   + P    +   CK I  +L+S P ++  + C    G  GV++ A +       SA   L  +  +R        +T PSQ R++YYF   L   +K     + L+H++L      P  + +G   +  + +Y    + L +++TS  Y  R   +DGA
Sbjct:    7 FEFDLTYITERIIATTLPPGIAEHAHQSSLRDIAGMLTSKHADKYLIINLSGRRN---EMLQLNPQVLDFGWPSRHAPHLDTLCSICKAIDSWLNSHPLHVAVLHCAGNSGSAGVVIAAFMHYSAICASADQALDRFAMKRFYVEKFASLTQPSQQRYVYYFNGLLSGSIKMNSAPVYLSHILLHGAWGPPTTAFSGCGGRVFLRVY----QGLHLYYTSPVYTVRAEVRDGA 232          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010485.1 (pep scaffold:Pmarinus_7.0:GL477590:24098:49109:-1 gene:ENSPMAG00000009496.1 transcript:ENSPMAT00000010485.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 91.6633 bits (226), Expect = 3.037e-20
Identity = 61/230 (26.52%), Postives = 103/230 (44.78%), Query Frame = 3
Query:  168 FDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERR--TTNGKGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNGYEIQFVIYIYDREAKQLKVHHTSQFYEAR---KDGA 842
            F+ DL+YIT RIIA   P    E  +++ + D+      KHA+ Y I NL   R+   +  + N     + +   + P    +   CK I  +L+S P ++  + C    G  GV++ A +       SA   L  +  +R        +T PSQ R++YYF   L   +K     + L+H++L           + + V  ++ R  + L +++TS  Y  R   +DGA
Sbjct:    5 FEFDLTYITERIIATTLPPGIAEHAHQSSLRDIAGMLTSKHADKYLIINLSGRRN---EMLQLNPQVLDFGWPSRHAPHLDTLCSICKAIDSWLNSHPLHVAVLHCAGNSGSAGVVIAAFMHYSAICASADQALDRFAMKRFYVEKFASLTQPSQQRYVYYFNGLLSGSIKMNSAPVYLSHILLHGA-WGPPPRLDTRSVKRVFLRVYQGLHLYYTSPVYTVRAEVRDGA 230          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009584.1 (pep scaffold:Pmarinus_7.0:GL480473:6650:34123:1 gene:ENSPMAG00000008668.1 transcript:ENSPMAT00000009584.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.9745 bits (232), Expect = 3.954e-20
Identity = 49/144 (34.03%), Postives = 76/144 (52.78%), Query Frame = 3
Query:  171 DLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNG 602
            DLD+SYIT+R+  M +PA+  E  ++NHI+DV  +   +H +HY ++NLC +R     +F HN ++ +Y F     P    +   CK++  +L  DP NI  + C  G+  + V VC+ L       +A   L  Y  RR   G
Sbjct:    6 DLDISYITTRVAVMSYPAEGVESAFKNHIEDVRAYLDSRHPDHYAVFNLC-QRGYRPARF-HNRVS-EYAFPTRRAPNLGCLYTFCKDLLVWLKQDPKNICVVHCLDGRAVSAVAVCSFLCFCRLFSTAEAALYMYSLRRCPPG 146          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005736.1 (pep scaffold:Pmarinus_7.0:GL478791:38400:53446:1 gene:ENSPMAG00000005201.1 transcript:ENSPMAT00000005736.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.8929 bits (224), Expect = 5.488e-20
Identity = 61/198 (30.81%), Postives = 94/198 (47.47%), Query Frame = 3
Query:  156 VQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGK--GVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNG 743
            ++ G +LDL+YIT RIIA+ +P    +  Y                    I NL   RH D +K      +  +P + H PP+   +   CK +  +L++DP ++V I CK  KGRTGV+V + +       SA   L  Y  ++  + K   V+ PSQ R++ YF   L  + K     L L+H+V+  +P    NG
Sbjct:    7 MEPGQELDLTYITERIIAVSYPPGGSQLTY--------------------ILNLSERRH-DIEKLNPQVKDFGWP-DLHAPPL-DILCSLCKAMDSWLNADPQHVVVIHCKGNKGRTGVVVASYMYYNSICASAHQALDRYAMKKFYDDKVAAVSQPSQKRYVTYFSELLSGKTKVNNMPLFLHHIVVQGLPNFEANG 181          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Yeast
Match: TEP1 (PTEN homolog with no demonstrated inositol lipid phosphatase activity; plays a role in normal sporulation; homolog of human tumor suppressor gene PTEN/MMAC1/TEP1 and fission yeast ptn1 [Source:SGD;Acc:S000005072])

HSP 1 Score: 76.6406 bits (187), Expect = 3.626e-15
Identity = 61/219 (27.85%), Postives = 95/219 (43.38%), Query Frame = 3
Query:  165 GFDLDLSYITSRIIAMGFPAQSW-EGIYRNHIDDVVNFFHKKHA-NHYQIYNLCNERHIDE----------QKFE------------------------------------HNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLS--QEPDKSATDI-LQFYGERRTTNGKGVTIPSQIRFIYYFEHFLRKE 668
            G  LD+SYI   +I   +P  ++ + +YRN +DD++ F    H   +++I+N   E+   +           KFE                                    +N I  +  + DH PP F  + E    I++YL    N +  + C+ GKGR+G+I  A L+   Q P   A  I +Q   +   TN  GVTIPSQ+R++ Y E F+  E
Sbjct:   39 GLRLDISYILVNLIVCSYPVNTYPKLLYRNSLDDLILFLTVYHGKGNFRIFNFRGEKEDSDYKDNDLIGIAAKFESKDFEIQELRSTLINDGKIPISPIDLETRTLVEEETNNVICERIGWLDHFPPPFELLEEIVDGIENYLSVSKNRVAVLHCRMGKGRSGMITVAYLMKYLQCPLGEARLIFMQARFKYGMTN--GVTIPSQLRYLRYHEFFITHE 255          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Nematostella
Match: EDO32901 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STQ6])

HSP 1 Score: 235.728 bits (600), Expect = 1.931e-71
Identity = 137/374 (36.63%), Postives = 198/374 (52.94%), Query Frame = 3
Query:  120 LKELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGKGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNGYEIQFVIYIYDREAKQLKVHHTSQFYEARKDGARSLNLLSDECFIVSDDLKFQFILKSKFGKKENLCHCWLNTFFIVHKPQIQSFQDGIKHNSNSNKVGKSAGRKGPRFTSDNSDESKTDFSHAQSDSDSQPFLYKLRLQKHEIDKACKDLNNKTFPSTFAITFVF 1241
             K+LVSKKK R+ +DGFDLDL+YI   I+AMGFP++  EG+YRNH+D+V  F  +KH + Y++YNLC+ER  D  +F HN +   YPF+DHN P F  +   C ++ ++L +   N+  I CKAGKGRTGV++CA LL     K   + +++YG  RT N KGVTIPSQ R++ Y+ + LR  L Y  T++ L    +  +P + G      ++I+ Y     ++K+ HTS+  E+ K G  S+ L   +   +  D+K +F  K  FG+KE +   W NTFFI                             G   T     E          +SD + F     + K  +DKA KD   K F   F ++ VF
Sbjct:    4 FKQLVSKKKRRFQEDGFDLDLTYIKPNIVAMGFPSEKLEGVYRNHMDEVYRFLEQKHKDSYKVYNLCSERQYDPMRF-HNRVA-TYPFDDHNAPPFELIKPFCDDVDEWLKASNLNVAIIHCKAGKGRTGVMICAYLLHNGHFKDTKEAMEYYGNARTRNAKGVTIPSQRRYVEYYGYLLRNCLTYVPTMVLLRGFEIITIPNMQGGNCCPFYIIWQY-----KVKI-HTSKLIESSKKGDTSIKLELSQPLPICGDIKVEFFHKDTFGRKERMFQFWFNTFFI---------------------------STGANMTDSREGEPTIHTFKESRNSDVRWFA----IPKQFVDKAHKDNKCKVFSPDFKVSNVF 338          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Nematostella
Match: EDO47071 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN45])

HSP 1 Score: 167.548 bits (423), Expect = 5.018e-46
Identity = 80/186 (43.01%), Postives = 119/186 (63.98%), Query Frame = 3
Query:  123 KELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRT--TNGK---GVTIPSQIRFIYYFEHFLRK 665
            + ++S+ K RY QDGFDLDL+Y+T R+IAM FP+     +YRN I +V  F   KH++HY++YNLC+ER  D   F HN +  +   +DHN P  +Q++  C  ++++LD DP+N++A+ CK GKGRTG  +CA L++    + A   L+++G RRT  + GK   GV  PSQ R++ Y E    K
Sbjct:   29 RRMISQNKRRYQQDGFDLDLTYVTERVIAMSFPSSGKHKMYRNPISEVARFLDTKHSDHYKVYNLCSERSYDPSIF-HNQVE-RILIDDHNVPRLSQLLYFCHNVREWLDKDPSNVIAVHCKGGKGRTGTAICAWLIASGQFEQAQHSLEYFGVRRTDYSVGKTYQGVQTPSQGRYVGYLEQIFTK 212          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Nematostella
Match: EDO45782 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRM0])

HSP 1 Score: 144.436 bits (363), Expect = 2.562e-38
Identity = 82/238 (34.45%), Postives = 129/238 (54.20%), Query Frame = 3
Query:  138 KKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGK--GVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNGYEIQFVIYIYDREAKQLKVHHTSQFYEARKDGAR 845
            + ++R+V   FDLDL+YIT RIIAM FP    E  YRN++ DV     +KH + Y ++NL +ER  D  K  H  ++  +P  DH  P   ++    K I  +L +DP ++V + CK GKGRTGV++ A +   +   S    L ++  +R  + K  GVT PSQ R+++YF  +L  ++K     + L+HV++  +P     G    F + +YD     LK+ +TS  +   +D  R
Sbjct:    5 RGRVRHVDHEFDLDLTYITERIIAMSFPGTGLESTYRNNLRDVAKMLQRKHQDKYMVFNL-SERRYDISKLNHQVLDFGWP--DHLAPPLERLCSIIKSIDSWLKTDPQHVVVVHCKGGKGRTGVVISAYMHFSKMCSSPEAALDWFAIKRFYDDKLGGVTQPSQRRYVHYFSDYLEGKIKLSSEPMFLHHVIVHGIPNFDSKGGCKPF-LRVYD----GLKLVYTSGVFLVTQDMER 234          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Nematostella
Match: EDO43926 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RX98])

HSP 1 Score: 103.605 bits (257), Expect = 7.932e-23
Identity = 65/191 (34.03%), Postives = 100/191 (52.36%), Query Frame = 3
Query:  171 DLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCA----CLLSQEPDKSATDILQFYGERRTTNGKGVTI-PSQIRFIYYFEHFL-RKELKYEKTVLKLNHVVLDEMP 725
            DLDLSYITSRII M FPA+  E  Y+N+IDDV  F   KH   Y + N+ + R+    K     ++  +P N   PP+   +I  C++I  +L  D + ++ I C  G+  +GV+V A    C L + P+ +A      +  RR   G+ V + PSQ R++ Y    +    +K +K  L +  V L+ +P
Sbjct:  404 DLDLSYITSRIIVMSFPAEGIESTYKNNIDDVREFLEAKHYEQYFVVNV-SPRNYRADKLSTRVLHQCWPVN-RLPPL-ESIISLCRKIFVWLKKDSSRVIVIHCMDGRVASGVLVSAFFVFCKLFKNPNGAA----DMFSIRRCGIGQKVALTPSQERYLLYIAELINNPSMKPQKNSLYIKSVTLNPVP 587          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Nematostella
Match: EDO29614 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T353])

HSP 1 Score: 48.9062 bits (115), Expect = 1.161e-7
Identity = 24/60 (40.00%), Postives = 35/60 (58.33%), Query Frame = 3
Query:  318 CNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGK 497
            C+ER  D  +F HN +   YPF+DHN P F  +   C ++ ++L +   N+  I CKAGK
Sbjct:   12 CSERQYDPMRF-HNRVA-TYPFDDHNAPPFELIKPFCDDVDEWLKASNLNVAIIHCKAGK 69          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Medaka
Match: ENSORLT00000040384.1 (phosphatase and tensin homolog [Source:NCBI gene;Acc:101171856])

HSP 1 Score: 266.159 bits (679), Expect = 1.521e-81
Identity = 151/379 (39.84%), Postives = 217/379 (57.26%), Query Frame = 3
Query:  108 MPNKLKELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGKGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNGYEIQFVIYIYDREAKQLKVHHTSQFYEARKDGARSLNLLSDECFIVSDDLKFQFILK-SKFGKKENLCHCWLNTFFIVHKPQIQSFQDGIKHNSNSNKVGKSAGRKGPRFTSDNSDESKTDFSHAQSDSDSQPFLYKLRLQKHEIDKACKDLNNKTFPSTFAITFVF 1241
            M   +KE+VS+ K RY +DGFDLDL+YI   IIAMGFPA+  EG+YRN+IDDVV F   KH NHY+IYNLC ERH D  KF  N    QYPF DHNPP    +   C+++  +L  D N++ AI CKAGKGRTGV++CA LL +     A + L FYGE RT + KGVTIPSQ R++ Y+ + L+ +L+Y+   L  + +V + +P+ SG     QFV+Y       ++K+H ++  +  R+D  + +     +   V  D+K +F  K +K  KK+ + H W+NTFFI   P  +   D +++ S ++   + +   GP      + E +        D D       L L K+++DKA KD  N+ F   F +   F
Sbjct:    1 MAAIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDAAKF--NCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLEAQEALDFYGEVRTRDKKGVTIPSQRRYVCYYSYLLKNQLEYKPVALLFHKMVFETLPMFSGGTCNPQFVVY-----QLKVKIHTSNPLHTRRED--KHMYFEFPQPLPVCGDIKVEFFHKQNKMMKKDKMFHFWVNTFFI---PGPEESGDRMENGSVNDAESQPS---GPGQGQPQNAECRDGCREGDRDRD----YLILTLNKNDLDKANKDKANRYFSPNFKVKLYF 360          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Medaka
Match: PTEN (phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [Source:NCBI gene;Acc:101173689])

HSP 1 Score: 257.299 bits (656), Expect = 3.291e-78
Identity = 159/392 (40.56%), Postives = 221/392 (56.38%), Query Frame = 3
Query:  105 IMPNKLKELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGKGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPII-------SGNGYEI----QFVIYIYDREAKQLKVH-HTSQFYEARKDGARSLNLLSDECFIVSDDLKFQFILK-SKFGKKENLCHCWLNTFFIVHKPQIQSFQDGIKHNSNSNKVGKSAGRKGPRFTSDNSDESKTDFSHAQSDSDSQPFLYKLRLQKHEIDKACKDLNNKTFPSTFAITFVF 1241
            +  N +KE+VS+ K R+ +DGFDLDL+YI   IIAMGFPA+  EG+YRN+IDDVV F   KH NHY+IYNLC ERH D  KF  N    QYPF DHNPP    +   C+++  +L  + +++ AI CKAGKGRTGV++CA LL +   + A + L FYGE RT + KGVTIPSQ R++ Y+ + L+  L+Y+   L  + ++ + +P+        SG+G  +    QFV+Y       QLKV  HTS     R++  + L     +   V  D+K +F  K +K  KKE + H W+NTFFI   P+  S++                G   P     NSD S   + +   D++ + FL  L L K+E+DKA KD  NK F   F +   F
Sbjct:    1 MAANLIKEIVSRNKRRFQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDTTKF--NCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSENEHHVAAIHCKAGKGRTGVMICAYLLHRGKFREAQEALDFYGEVRTRDKKGVTIPSQRRYVVYYNYLLKNRLQYKPVALLFHKMMFETVPMFTVGTCSESGSGPPLHAHPQFVVY-------QLKVKIHTSNPAHTRRED-KLLLFEFPQPLPVCGDIKVEFFHKQNKVMKKEKMFHFWINTFFIP-GPEEASYK-------------LENGSAAP-----NSDVSDRTYQNP-GDANDKDFLV-LTLTKNELDKANKDKANKNFSPNFKVRLFF 361          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Medaka
Match: ENSORLT00000007833.2 (phosphatase and tensin homolog [Source:NCBI gene;Acc:101171856])

HSP 1 Score: 256.529 bits (654), Expect = 1.328e-77
Identity = 151/400 (37.75%), Postives = 219/400 (54.75%), Query Frame = 3
Query:  108 MPNKLKELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGKGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNG---------------------YEIQFVIYIYDREAKQLKVHHTSQFYEARKDGARSLNLLSDECFIVSDDLKFQFILK-SKFGKKENLCHCWLNTFFIVHKPQIQSFQDGIKHNSNSNKVGKSAGRKGPRFTSDNSDESKTDFSHAQSDSDSQPFLYKLRLQKHEIDKACKDLNNKTFPSTFAITFVF 1241
            M   +KE+VS+ K RY +DGFDLDL+YI   IIAMGFPA+  EG+YRN+IDDVV F   KH NHY+IYNLC ERH D  KF  N    QYPF DHNPP    +   C+++  +L  D N++ AI CKAGKGRTGV++CA LL +     A + L FYGE RT + KGVTIPSQ R++ Y+ + L+ +L+Y+   L  + +V + +P+ SG                       ++ QFV+Y       ++K+H ++  +  R+D  + +     +   V  D+K +F  K +K  KK+ + H W+NTFFI   P  +   D +++ S ++   + +   GP      + E +        D D       L L K+++DKA KD  N+ F   F +   F
Sbjct:    1 MAAIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDAAKF--NCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLEAQEALDFYGEVRTRDKKGVTIPSQRRYVCYYSYLLKNQLEYKPVALLFHKMVFETLPMFSGGTCRDVKNRSEPTPQGFKKGNWHWDPQFVVY-----QLKVKIHTSNPLHTRRED--KHMYFEFPQPLPVCGDIKVEFFHKQNKMMKKDKMFHFWVNTFFI---PGPEESGDRMENGSVNDAESQPS---GPGQGQPQNAECRDGCREGDRDRD----YLILTLNKNDLDKANKDKANRYFSPNFKVKLYF 381          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Medaka
Match: ENSORLT00000007829.2 (phosphatase and tensin homolog [Source:NCBI gene;Acc:101171856])

HSP 1 Score: 206.838 bits (525), Expect = 4.587e-59
Identity = 133/397 (33.50%), Postives = 204/397 (51.39%), Query Frame = 3
Query:  129 LVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVV----NFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGKGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNG---------------------YEIQFVIYIYDREAKQLKVHHTSQFYEARKDGARSLNLLSDECFIVSDDLKFQFILK-SKFGKKENLCHCWLNTFFIVHKPQIQSFQDGIKHNSNSNKVGKSAGRKGPRFTSDNSDESKTDFSHAQSDSDSQPFLYKLRLQKHEIDKACKDLNNKTFPSTFAITFVF 1241
            +VS+ K RY +DGFDLDL+YI   IIAMGFPA+  EG+YRN+IDDV+            + Y  Y   +   +      H S+  QYPF DHNPP    +   C+++  +L  D N++ AI CKAGKGRTGV++CA LL +     A + L FYGE RT + KGVTIPSQ R++ Y+ + L+ +L+Y+   L  + +V + +P+ SG                       ++ QFV+Y       ++K+H ++  +  R+D  + +     +   V  D+K +F  K +K  KK+ + H W+NTFFI   P  +   D +++ S ++   + +   GP      + E +        D D       L L K+++DKA KD  N+ F   F +   F
Sbjct:    1 MVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVLFKSLMITPLLFVSTYYYYYFISFTTLRGLACRHASVA-QYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLEAQEALDFYGEVRTRDKKGVTIPSQRRYVCYYSYLLKNQLEYKPVALLFHKMVFETLPMFSGGTCRDVKNRSEPTPQGFKKGNWHWDPQFVVY-----QLKVKIHTSNPLHTRRED--KHMYFEFPQPLPVCGDIKVEFFHKQNKMMKKDKMFHFWVNTFFI---PGPEESGDRMENGSVNDAESQPS---GPGQGQPQNAECRDGCREGDRDRD----YLILTLNKNDLDKANKDKANRYFSPNFKVKLYF 379          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Medaka
Match: tpte (phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 [Source:NCBI gene;Acc:101172265])

HSP 1 Score: 166.007 bits (419), Expect = 5.196e-44
Identity = 75/181 (41.44%), Postives = 115/181 (63.54%), Query Frame = 3
Query:  123 KELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGK-----GVTIPSQIRFIYYFE 650
            + ++S+ K RY +DGFDLDL+Y+T R+IAM FP+   +  YRN I +V  F   KH  HY+++NLC+E+  D Q F H  +   +  +DHN P    M++    +++++ +DP N++AI CK GKGRTG +VC  L+  +  +SA D L+++GERRT   +     GV  PSQ R++ Y+E
Sbjct:  143 RRMISENKRRYQKDGFDLDLTYVTDRVIAMSFPSSGKQAFYRNPIKEVARFLDTKHEGHYKVFNLCSEKGYDPQHF-HYRVERVF-IDDHNVPALEDMLKFTASVREWMSADPQNVIAIHCKGGKGRTGTMVCTWLIDSDQFESAQDSLEYFGERRTDKTRSSKFQGVETPSQSRYVGYYE 321          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Planmine SMEST
Match: SMESG000043909.1 (SMESG000043909.1)

HSP 1 Score: 927.932 bits (2397), Expect = 0.000e+0
Identity = 442/442 (100.00%), Postives = 442/442 (100.00%), Query Frame = 3
Query:  108 MPNKLKELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGKGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNGYEIQFVIYIYDREAKQLKVHHTSQFYEARKDGARSLNLLSDECFIVSDDLKFQFILKSKFGKKENLCHCWLNTFFIVHKPQIQSFQDGIKHNSNSNKVGKSAGRKGPRFTSDNSDESKTDFSHAQSDSDSQPFLYKLRLQKHEIDKACKDLNNKTFPSTFAITFVFENYHFNNQKSPSKMIRMMKPVGSGELTRVNTESGKHNAAKQNLSSDARLGDDGQTGRAHYSPCY 1433
            MPNKLKELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGKGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNGYEIQFVIYIYDREAKQLKVHHTSQFYEARKDGARSLNLLSDECFIVSDDLKFQFILKSKFGKKENLCHCWLNTFFIVHKPQIQSFQDGIKHNSNSNKVGKSAGRKGPRFTSDNSDESKTDFSHAQSDSDSQPFLYKLRLQKHEIDKACKDLNNKTFPSTFAITFVFENYHFNNQKSPSKMIRMMKPVGSGELTRVNTESGKHNAAKQNLSSDARLGDDGQTGRAHYSPCY
Sbjct:    1 MPNKLKELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGKGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNGYEIQFVIYIYDREAKQLKVHHTSQFYEARKDGARSLNLLSDECFIVSDDLKFQFILKSKFGKKENLCHCWLNTFFIVHKPQIQSFQDGIKHNSNSNKVGKSAGRKGPRFTSDNSDESKTDFSHAQSDSDSQPFLYKLRLQKHEIDKACKDLNNKTFPSTFAITFVFENYHFNNQKSPSKMIRMMKPVGSGELTRVNTESGKHNAAKQNLSSDARLGDDGQTGRAHYSPCY 442          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Planmine SMEST
Match: SMESG000072902.1 (SMESG000072902.1)

HSP 1 Score: 327.405 bits (838), Expect = 4.106e-105
Identity = 175/395 (44.30%), Postives = 245/395 (62.03%), Query Frame = 3
Query:  108 MPNKLKELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRTTNGKGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHVVLDEMPIISGNGYEIQFVIYIYDREAKQLKVHHTSQFYEARKDGARSLNLLSDECFIVSDDLKFQFILKSKFGKKENLCHCWLNTFFIVHKPQIQSFQDGIKHNSNSNKVGKSAGRKGPRFTSDNSDESKTDFSHAQSDSDSQPFLYKLRLQKHEIDKACKDLNNKTFPSTFAITFVFENYHFNNQKSPSKMIRM 1292
            M + ++ +VSKKK RY + GF+LDLSY+TSRIIAMGFPA+ +E +YRN IDDV  FF   H   Y+IYNLC ER+ +  KF       ++PF+DHN P+FT ++ C  +I  +LDS P+N+VAI CKAGKGRTGVIVC  L+  E +K AT  LQ YG+ RT NGKGVTIPSQIR+I+Y++HF++ +LKY    L L  +  + +P I GN  E+++ IY   R   Q K++ +  +   ++D  R +  +    + + DDLKFQF  K+  G  + LC CWLNTFFIV++P IQ   D +   SNS  V      K P      SDE+K   +  +   ++   +Y +RL K EID+A KD   + FP  F+ITF+F +   N   + + +I +
Sbjct:    1 MNSTIRTIVSKKKRRYKKQGFNLDLSYVTSRIIAMGFPAEKFEALYRNDIDDVSKFFEVNHCGKYKIYNLCRERNFNASKFSGEI--ARFPFDDHNAPIFTDLVACVNDIAQFLDSCPDNVVAINCKAGKGRTGVIVCCTLIHCENNKDATTALQDYGKSRTLNGKGVTIPSQIRYIFYYDHFVKNKLKYASIPLWLRKINFEMVPNI-GNA-EVEYAIY---RVNSQNKIYSSKTYKTTKQD--RQITFVESISYPLEDDLKFQFFYKTLMGGTKILCQCWLNTFFIVNQPLIQCL-DPVPRKSNSKNVFNRLPSKPP------SDEAKCPIARPEKPHEN---IYTIRLTKKEIDEANKDSTFRIFPENFSITFMFSDCPLNTDNNGNSLISI 376          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Planmine SMEST
Match: SMESG000060206.1 (SMESG000060206.1)

HSP 1 Score: 149.058 bits (375), Expect = 4.589e-38
Identity = 75/181 (41.44%), Postives = 109/181 (60.22%), Query Frame = 3
Query:  123 KELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSATDILQFYGERRT--TNGK---GVTIPSQIRFIYYFE 650
            + + S+ K R+   G+DLDL Y+T R+IAM FP+  +  +YRN I DV  FF+ K+ ++Y+IYNLC ER  D + F  N    +Y   DHN P   +++E  K  +++L     NI+A+ CK GKGRTG ++C  L+      +A   LQ++G+RRT    GK   GV  PSQ R++ YFE
Sbjct:  154 RHVTSENKRRFQSGGYDLDLCYVTDRVIAMSFPSSGFTALYRNSITDVAKFFNSKYGSNYKIYNLCEERAYDTKIF--NDQVERYMVKDHNVPRLEEILEFAKSSREWLTKSDQNIIAVHCKGGKGRTGTMICVHLIDSGVFDNAELCLQYFGQRRTDLLQGKKFQGVETPSQNRYVGYFE 332          
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Planmine SMEST
Match: SMESG000081891.1 (SMESG000081891.1)

HSP 1 Score: 81.6481 bits (200), Expect = 1.417e-15
Identity = 61/215 (28.37%), Postives = 108/215 (50.23%), Query Frame = 3
Query:  171 DLDLSYITSRIIAMGFPAQSW-EGIYRNHIDDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMFTQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGV----IVCACLLSQEPDKSATDILQFYGERRTTNGKGVTIPSQIRFIYYFEHFLRK--------ELKYEKTVLKLNHVVLDEMPIISGNGYEIQFVIYIYD 776
            DL+++Y+TSRII M  P +S  + + R+ I+DV  F   +H N Y IYNL + R I  ++F    +  Q  F+   P  F  ++  C     +L +D  N++ IQC  G+  +G+    ++C C L  +   +A +I++F   RR   G      SQ+R+I Y    +          E+ + K ++KL  + L+ +PI +     ++  + I++
Sbjct:  459 DLNITYVTSRIIMMPTPGESGIDALTRDKIEDVQTFLDFRHPNQYYIYNL-SLRSIKTERFNDRVM--QLGFDSMKPMSFNNLVSVCIHQLSWLLADAKNVIVIQCTDGRIGSGLNVAALLCFCRLV-DTSSAAVNIVKF---RR---GDCQFTSSQLRYIDYICRLMHNISNQSIGPEIPH-KFIVKLTGIELEPVPIFNRAKTGVRPYVEIFN 662          
The following BLAST results are available for this feature:
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PTEN3.800e-7639.31phosphatase and tensin homolog [Source:HGNC Symbol... [more]
PTEN8.388e-7539.47phosphatase and tensin homolog [Source:HGNC Symbol... [more]
PTEN8.388e-7539.47phosphatase and tensin homolog [Source:HGNC Symbol... [more]
TPTE24.065e-4947.51transmembrane phosphoinositide 3-phosphatase and t... [more]
TPTE26.892e-4847.51transmembrane phosphoinositide 3-phosphatase and t... [more]
back to top
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
daf-187.826e-3636.11Phosphatidylinositol 3,4,5-trisphosphate 3-phospha... [more]
tns-11.236e-722.26TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L04... [more]
tns-15.359e-722.10TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L04... [more]
back to top
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pten2.587e-6333.92gene:FBgn0026379 transcript:FBtr0089902[more]
Pten1.193e-6233.92gene:FBgn0026379 transcript:FBtr0089905[more]
Pten1.193e-6233.92gene:FBgn0026379 transcript:FBtr0089901[more]
Pten1.478e-6233.92gene:FBgn0026379 transcript:FBtr0300562[more]
Pten1.478e-6233.92gene:FBgn0026379 transcript:FBtr0301521[more]
back to top
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptena5.853e-8641.24phosphatase and tensin homolog A [Source:ZFIN;Acc:... [more]
ptena7.910e-8441.58phosphatase and tensin homolog A [Source:ZFIN;Acc:... [more]
ptena7.910e-8441.58phosphatase and tensin homolog A [Source:ZFIN;Acc:... [more]
ptena4.934e-8239.90phosphatase and tensin homolog A [Source:ZFIN;Acc:... [more]
ptena8.864e-8238.93phosphatase and tensin homolog A [Source:ZFIN;Acc:... [more]
back to top
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pten3.680e-7740.31phosphatase and tensin homolog [Source:NCBI gene;A... [more]
pten1.301e-5835.90phosphatase and tensin homolog [Source:NCBI gene;A... [more]
tpte27.132e-4836.58transmembrane phosphoinositide 3-phosphatase and t... [more]
tpte21.436e-4736.58transmembrane phosphoinositide 3-phosphatase and t... [more]
tpte21.844e-4736.58transmembrane phosphoinositide 3-phosphatase and t... [more]
back to top
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pten2.350e-7639.31phosphatase and tensin homolog [Source:MGI Symbol;... [more]
Tpte3.827e-5041.23transmembrane phosphatase with tensin homology [So... [more]
Tpte1.586e-4937.04transmembrane phosphatase with tensin homology [So... [more]
Tns11.858e-2431.00tensin 1 [Source:MGI Symbol;Acc:MGI:104552][more]
Tns11.937e-2431.00tensin 1 [Source:MGI Symbol;Acc:MGI:104552][more]
back to top
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9PUT6|PTEN_XENLA6.493e-7740.58Phosphatidylinositol 3,4,5-trisphosphate 3-phospha... [more]
sp|O08586|PTEN_MOUSE1.644e-7539.31Phosphatidylinositol 3,4,5-trisphosphate 3-phospha... [more]
sp|P60484|PTEN_HUMAN1.825e-7539.31Phosphatidylinositol 3,4,5-trisphosphate 3-phospha... [more]
sp|P60483|PTEN_CANLF1.825e-7539.31Phosphatidylinositol 3,4,5-trisphosphate 3-phospha... [more]
sp|Q8T9S7|PTEN_DICDI4.293e-5343.89Phosphatidylinositol 3,4,5-trisphosphate 3-phospha... [more]
back to top
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q6TGR71.310e-8241.24Phosphatidylinositol 3,4,5-trisphosphate 3-phospha... [more]
A0A3S6CXE83.346e-8241.47Phosphatidylinositol 3,4,5-trisphosphate 3-phospha... [more]
A0A3Q3K1X27.943e-8242.37Phosphatidylinositol 3,4,5-trisphosphate 3-phospha... [more]
A0A2I4AQK21.685e-8141.47Phosphatidylinositol 3,4,5-trisphosphate 3-phospha... [more]
A0A1B6IPR62.157e-8139.69Uncharacterized protein OS=Homalodisca liturata OX... [more]
back to top
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000007968.22.402e-8038.44phosphatase and tensin homolog [Source:NCBI gene;A... [more]
ENSAMXT00000043891.11.382e-7947.24phosphatidylinositol 3,4,5-trisphosphate 3-phospha... [more]
ENSAMXT00000055423.11.404e-7543.77phosphatidylinositol 3,4,5-trisphosphate 3-phospha... [more]
ENSAMXT00000038725.11.561e-5332.89phosphatidylinositol 3,4,5-trisphosphate 3-phospha... [more]
ENSAMXT00000047718.11.228e-2828.63pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TNS19.441e-2532.66tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973][more]
ENSPMAT00000010484.11.671e-2026.61pep scaffold:Pmarinus_7.0:GL477590:9709:49115:-1 g... [more]
ENSPMAT00000010485.13.037e-2026.52pep scaffold:Pmarinus_7.0:GL477590:24098:49109:-1 ... [more]
ENSPMAT00000009584.13.954e-2034.03pep scaffold:Pmarinus_7.0:GL480473:6650:34123:1 ge... [more]
ENSPMAT00000005736.15.488e-2030.81pep scaffold:Pmarinus_7.0:GL478791:38400:53446:1 g... [more]
back to top
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
TEP13.626e-1527.85PTEN homolog with no demonstrated inositol lipid p... [more]
back to top
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO329011.931e-7136.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470715.018e-4643.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO457822.562e-3834.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO439267.932e-2334.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO296141.161e-740.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000040384.11.521e-8139.84phosphatase and tensin homolog [Source:NCBI gene;A... [more]
PTEN3.291e-7840.56phosphatidylinositol 3,4,5-trisphosphate 3-phospha... [more]
ENSORLT00000007833.21.328e-7737.75phosphatase and tensin homolog [Source:NCBI gene;A... [more]
ENSORLT00000007829.24.587e-5933.50phosphatase and tensin homolog [Source:NCBI gene;A... [more]
tpte5.196e-4441.44phosphatidylinositol 3,4,5-trisphosphate 3-phospha... [more]
back to top
BLAST of Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000043909.10.000e+0100.00SMESG000043909.1[more]
SMESG000072902.14.106e-10544.30SMESG000072902.1[more]
SMESG000060206.14.589e-3841.44SMESG000060206.1[more]
SMESG000081891.11.417e-1528.37SMESG000081891.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029410 ID=SMED30029410|Name=Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN|organism=Schmidtea mediterranea sexual|type=transcript|length=2173bp
TTAGAATCTTAAAAGATTTATCAAAAATATAATTCTTTAAAATAAAACTC
AAATATTCTACTTTAAAAAGTTATGATAATAAATTGATAAATTTTGACAA
TATTATTATGCCAAATAAATTAAAAGAATTAGTTTCAAAAAAGAAAATTC
GCTACGTCCAAGATGGATTTGACCTTGATCTTTCATACATAACATCTCGT
ATTATCGCTATGGGATTTCCAGCTCAAAGTTGGGAAGGTATATATCGAAA
TCATATAGATGACGTTGTGAATTTTTTTCACAAGAAACACGCCAACCATT
ATCAAATATATAATTTGTGTAACGAGCGACATATTGACGAACAGAAATTC
GAACACAATAGTATCAACCATCAATATCCATTCAACGACCATAATCCGCC
TATGTTCACCCAAATGATAGAGTGCTGTAAAGAAATTCAAGATTATCTAG
ATTCCGACCCAAATAATATTGTCGCTATTCAATGTAAAGCTGGAAAAGGA
CGAACAGGAGTAATCGTTTGTGCTTGTTTGCTATCTCAAGAACCCGATAA
ATCCGCAACGGACATTCTCCAATTTTATGGTGAACGTCGCACAACGAACG
GGAAAGGAGTGACAATTCCTAGTCAGATTCGTTTTATCTACTATTTCGAA
CATTTTTTACGGAAAGAATTAAAATATGAAAAAACAGTTTTGAAATTGAA
TCACGTTGTCTTGGATGAGATGCCAATTATCTCTGGCAACGGCTACGAAA
TCCAATTTGTTATTTATATATATGATCGAGAGGCAAAACAACTCAAAGTT
CATCATACATCTCAATTTTACGAAGCCCGAAAAGATGGCGCTCGTTCTCT
GAATCTTTTGTCTGACGAGTGTTTTATTGTATCAGATGATTTAAAGTTTC
AATTTATATTAAAATCAAAATTTGGTAAAAAGGAAAACCTTTGCCATTGT
TGGTTAAATACATTTTTCATCGTCCATAAACCGCAGATTCAGTCATTTCA
AGATGGTATAAAACATAATTCAAATTCAAACAAAGTTGGCAAATCAGCGG
GTCGTAAAGGTCCTAGATTTACATCAGATAATAGTGATGAATCCAAAACA
GATTTTTCACATGCTCAAAGTGATTCTGATTCTCAACCATTTTTGTACAA
ATTACGACTTCAAAAACACGAAATTGATAAAGCCTGCAAAGATTTGAATA
ATAAAACATTTCCATCAACTTTCGCTATTACTTTCGTTTTTGAAAATTAT
CATTTTAATAATCAAAAATCGCCCTCGAAAATGATCAGGATGATGAAACC
CGTCGGTTCGGGTGAACTCACTCGAGTTAATACAGAAAGCGGTAAACATA
ATGCTGCCAAACAAAACCTTTCATCAGATGCTAGACTCGGTGATGATGGC
CAGACTGGGAGAGCTCACTATTCTCCGTGTTACAGTGATAATCCAGATGA
TAATTCTGAAAGCAGTGAATCTTCAAATTCTATATGTCAAGATTCTGAAC
AAAAATTTTAAAATAGAGTAAAATCACAAATATTTTCCTAACAGTTAATA
TAATAATAAACGTATAATGGTAAAATAATAAATAATTTGCTAGTTATAAT
AATCAATAATTGTTTGAGAATTGGGATTGTGTAAAAAATGTGCTAATTGT
GTTAAGATGTATTTGATTTATTTATTTTTTATACATTTACTTTTATATAC
TTTGTGCTACGTTATAATTGATCATTGAGAAATCGTTTCTTTTTAATTCA
ATTACAATTCTCTCATTTTCTTTTTTCAATTAAACTCGTTTTATTTGAAT
TTTTATTTGTAAATAATAATTCCACCCCCTTCTCGCCATCGCTACAGTTA
TGTTAAATGCCTATACAAATTTTGTATTGCAAAACTTTATATATATATAT
TGAATAATGGACCAAATGAATGAAAATAGAGTATAATATGCTAAAGTCAA
CATATAATTTCAGAATTTATTTATTCGAATGAAAGCTCCGAAAATATATC
TATCAAAACGAGCAAAATGAGATTTTAGATTTACAACTGATTTGAAAGGT
TTAATTTTTGTATAATTGAAGTATTGCTGACAATATTTATAACTTTTATT
AACTATCATTTTGTACAAATGGAAATCCAATTGGGTACATGTACATATTC
ATACATATATTATGATTAATAAA
back to top

protein sequence of SMED30029410-orf-1

>SMED30029410-orf-1 ID=SMED30029410-orf-1|Name=SMED30029410-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=468bp
MPNKLKELVSKKKIRYVQDGFDLDLSYITSRIIAMGFPAQSWEGIYRNHI
DDVVNFFHKKHANHYQIYNLCNERHIDEQKFEHNSINHQYPFNDHNPPMF
TQMIECCKEIQDYLDSDPNNIVAIQCKAGKGRTGVIVCACLLSQEPDKSA
TDILQFYGERRTTNGKGVTIPSQIRFIYYFEHFLRKELKYEKTVLKLNHV
VLDEMPIISGNGYEIQFVIYIYDREAKQLKVHHTSQFYEARKDGARSLNL
LSDECFIVSDDLKFQFILKSKFGKKENLCHCWLNTFFIVHKPQIQSFQDG
IKHNSNSNKVGKSAGRKGPRFTSDNSDESKTDFSHAQSDSDSQPFLYKLR
LQKHEIDKACKDLNNKTFPSTFAITFVFENYHFNNQKSPSKMIRMMKPVG
SGELTRVNTESGKHNAAKQNLSSDARLGDDGQTGRAHYSPCYSDNPDDNS
ESSESSNSICQDSEQKF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004438phosphatidylinositol-3-phosphatase activity
GO:0004721phosphoprotein phosphatase activity
GO:0016787hydrolase activity
GO:0051717inositol-1,3,4,5-tetrakisphosphate 3-phosphatase activity
GO:0004725protein tyrosine phosphatase activity
GO:0005515protein binding
GO:0000287magnesium ion binding
GO:0008138protein tyrosine/serine/threonine phosphatase activity
GO:0016314phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase activity
GO:0016791phosphatase activity
GO:0030165PDZ domain binding
GO:0051800phosphatidylinositol-3,4-bisphosphate 3-phosphatase activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0016605PML body
Vocabulary: biological process
TermDefinition
GO:0006629lipid metabolic process
GO:0007399nervous system development
GO:0006470protein dephosphorylation
GO:0008285negative regulation of cell proliferation
GO:0016311dephosphorylation
GO:0030336negative regulation of cell migration
GO:0031647regulation of protein stability
GO:0035335peptidyl-tyrosine dephosphorylation
GO:0046855inositol phosphate dephosphorylation
GO:0046856phosphatidylinositol dephosphorylation
GO:0051895negative regulation of focal adhesion assembly
GO:0051898negative regulation of protein kinase B signaling
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002112Xins cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR000242PTPase_domain
IPR029023Tensin_phosphatase
IPR000008C2_dom
IPR014020Tensin_C2-dom
IPR029021Prot-tyrosine_phosphatase-like
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR014020Tensin phosphatase, C2 domainSMARTSM01326PTEN_C2_2coord: 190..380
e-value: 1.5E-22
score: 90.9
IPR014020Tensin phosphatase, C2 domainPFAMPF10409PTEN_C2coord: 190..379
e-value: 3.4E-17
score: 62.4
IPR014020Tensin phosphatase, C2 domainPROSITEPS51182C2_TENSINcoord: 192..381
score: 12.393
NoneNo IPR availableGENE3DG3DSA:2.60.40.1110coord: 329..382
e-value: 3.0E-6
score: 29.0
coord: 190..316
e-value: 3.1E-16
score: 61.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 405..427
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 443..467
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 405..467
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 321..335
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 305..339
NoneNo IPR availablePANTHERPTHR12305:SF81PHOSPHATIDYLINOSITOL 3,4,5-TRISPHOSPHATE 3-PHOSPHATASE AND DUAL-SPECIFICITY PROTEIN PHOSPHATASE PTENcoord: 4..437
NoneNo IPR availablePANTHERPTHR12305PHOSPHATASE WITH HOMOLOGY TO TENSINcoord: 4..437
NoneNo IPR availableCDDcd14509PTP_PTENcoord: 24..181
e-value: 3.9227E-79
score: 240.953
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 193..380
IPR029021Protein-tyrosine phosphatase-likeGENE3DG3DSA:3.90.190.10coord: 1..188
e-value: 6.8E-69
score: 233.6
IPR029021Protein-tyrosine phosphatase-likeSUPERFAMILYSSF52799(Phosphotyrosine protein) phosphatases IIcoord: 20..186
IPR000242PTP type protein phosphatasePFAMPF00102Y_phosphatasecoord: 60..178
e-value: 5.9E-7
score: 29.3
IPR029023Tensin-type phosphatase domainPROSITEPS51181PPASE_TENSINcoord: 14..187
score: 32.552