WD repeat-containing protein 59

Overview
NameWD repeat-containing protein 59
Smed IDSMED30029391
Length (bp)3156
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of WD repeat-containing protein 59 (SMED30029391) t-SNE clustered cells

Violin plots show distribution of expression levels for WD repeat-containing protein 59 (SMED30029391) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of WD repeat-containing protein 59 (SMED30029391) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for WD repeat-containing protein 59 (SMED30029391) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029391

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30029391SMESG000025367.1 dd_Smed_v4_10474_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30029391SMESG000025367.1 dd_Smed_v4_10474_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of WD repeat-containing protein 59 vs. Ensembl Human
Match: WDR59 (WD repeat domain 59 [Source:HGNC Symbol;Acc:HGNC:25706])

HSP 1 Score: 170.244 bits (430), Expect = 1.851e-42
Identity = 224/1055 (21.23%), Postives = 401/1055 (38.01%), Query Frame = 3
Query:   75 KEIQASSFAMNSNGSLGLFCGLYEILLLSFDDP-KRKRKESINKSSDPVLCQWNK--TCNEYFALTQSNVCKIF---DIELKKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDS-QGIQLVKWSNVKTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDWSANM-NIIVSCGQDKKLKIWNLEESNQNRILEEDYANYSMCKFDTLDNIFT-----LNSSDVPS---ENFVSFWSIVEFRKLYSTPPHT-----NVITDFALIYPTETA--CQFVTLHRNSDLKVWEINRSLVSGKRKRGGSSHVAGLDNSISNDRLFLSPSPDHSVNKSKAIPVGQSESFVNMHKNDILSSIIAHRSDPNLIMRDKSNKSLSEDQEIRVREFEKLS-NTNQVTFEKSVDMRSVTAHFNLINLKC----------------SIQFIYRTSIGDIVFLDVL-VLRQRAEKIRPQNLEELEKILKTTI---------DDCRRNNILPIEKCVDVTLDYLNKLSSRFSLRAIRSLKDQSTPIHSFTSLPDVKVPFPRICGASFSPTGLLVCFLSP---EGYMSRFHSAPRSLADISKLAN---------TNSSSKGFFYEMNKNTTQKQ-------YYKS-NIRKLKSTEFNTETPSRKLSTQSIQKQTHIVLIYNVLQLSLFNVSLAKNYSLKISNAEAMCHKNLSAVTNCNRKDLFEFWQYCAILANGC-KPSCNISAGYIRPWATQSMGRGLCELWMKHFLDINDIQSAAMLVIVMRAIDL--DLENNFKENKNNASSISLTSGSHKNISQESLMDNIHSDTLNSNLCVSIFVDGLQKYKIYDDKRNATLIVMEINEGSPGRFRNNSFGEQEITNNLKKGDNLIPDSSLQHFQQNEQIRLIDPAKNLQ-------YNRVLLHYVLMLSAHKLLNFSSKIVQKILPAKFFNLIFGHYNFDVFLLRNCINDHRCKSVYVDPNRLTVICSECPTRTVSVNNQDTSKTPIICSVCRNFVRGLFSVCDQCNHGGHADHLNSWF 2999
            ++ QA++ +++  G   +  G   + +++ D P +  RK S     D    QWN   +   YFA + +    ++   D   +   +L+ H ++IS +DW     + + T+S D    + IWDI++++ P+  + +  G   VKW+    N  AT+   ++ IWD RK +       AH   I+  DW  +  +I+ +  QD  +K W+  +  +       Y N   C+       +T     L +  VP    EN +  W++ +     +TP HT     +V+ +F      E +   Q VT  R+  L++W ++  +    ++   +  + G+D  I  + + L P P+ +++         +E   + H              P  ++ ++ +  L   Q ++ +EF  ++     V  E     RS T   +  N +                 S QFI  T+I   +   +L +L+  A +   +    LE  L+  +         +D   +N   +   V   L    ++++                  ++ S  D  +PFPR  GA F   G LV F  P      +S     PRSL+ +S             T +      Y  +   ++K+       YYK    R+ KS    +++ +R++      K    V+I ++  L   + SL + Y L +++ +  C KN ++     RKDL + W    +  + C  P  +       PWA    GR L E  + H+  + D+Q+ AML  V  A      L N F    N +S++ ++   + + +      ++    LN+             + I    R A  +     E SP   R   FG    ++  ++          +  Q ++  RL+DPA   Q       Y  +L  + L     ++L F S       P     + FG Y                             CS C +                C++C   VRG  + C  C HGGH  H+  WF
Sbjct:   15 RDSQATAMSVDCLGQHAVLSGRRFLYIVNLDAPFEGHRKISRQSKWDIGAVQWNPHDSFAHYFAASSNQRVDLYKWKDGSGEVGTTLQGHTRVISDLDWAVFEPDLLVTSSVDTY--IYIWDIKDTRKPTVALSAVAGASQVKWNKKNANCLATSHDGDVRIWDKRKPSTAVEYLAAHLSKIHGLDWHPDSEHILATSSQDNSVKFWDYRQPRK-------YLNILPCQVPVWKARYTPFSNGLVTVMVPQLRRENSLLLWNVFDL----NTPVHTFVGHDDVVLEFQWRKQKEGSKDYQLVTWSRDQTLRMWRVDSQM----QRLCANDILDGVDEFI--ESISLLPEPEKTLH---------TEDTDHQHTASHGEEEALKEDPPRNLLEERKSDQLGLPQTLQ-QEFSLINVQIRNVNVEMDAADRSCTVSVHCSNHRVKMLVKFPAQYPNNAAPSFQFINPTTITSTMKAKLLKILKDTALQKVKRGQSCLEPCLRQLVSCLESFVNQEDSASSNPFALPNSVTPPLPTFARVTT------------------AYGSYQDANIPFPRTSGARFCGAGYLVYFTRPMTMHRAVSPTEPTPRSLSALSAYHTGLIAPMKIRTEAPGNLRLYSGSPTRSEKEQVSISSFYYKERKSRRWKSKREGSDSGNRQI------KAAGKVIIQDIACLLPVHKSLGELYILNVNDIQETCQKNAASALLVGRKDLVQVWSLATVATDLCLGPKSD--PDLETPWARHPFGRQLLESLLAHYCRLRDVQTLAMLCSVFEAQSRPQGLPNPFGPFPNRSSNLVVSHSRYPSFTSSGSCSSMSDPGLNTG-----------GWNIAG--REAEHLSSPWGESSPEELR---FGSLTYSDPRER----------ERDQHDKNKRLLDPANTQQFDDFKKCYGEILYRWGLREKRAEVLKFVS-----CPPDPHKGIEFGVY-----------------------------CSHCRSEVRGTQCAICKGFTFQCAICHVAVRGSSNFCLTCGHGGHTSHMMEWF 954          
BLAST of WD repeat-containing protein 59 vs. Ensembl Human
Match: WDR59 (WD repeat domain 59 [Source:HGNC Symbol;Acc:HGNC:25706])

HSP 1 Score: 99.7525 bits (247), Expect = 7.318e-21
Identity = 125/589 (21.22%), Postives = 236/589 (40.07%), Query Frame = 3
Query:   75 KEIQASSFAMNSNGSLGLFCGLYEILLLSFDDP-KRKRKESINKSSDPVLCQWNK--TCNEYFALTQSNVCKIF---DIELKKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDS-QGIQLVKWSNVKTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDWSANM-NIIVSCGQDKKLKIWNLEESNQNRILEEDYANYSMCKFDTLDNIFT-----LNSSDVPS---ENFVSFWSIVEFRKLYSTPPHT-----NVITDFALIYPTETA--CQFVTLHRNSDLKVWEINRSLVSGKRKRGGSSHVAGLDNSISNDRLFLSPSPDHSVNKSKAIPVGQSESFVNMHKNDILSSIIAHRSDPNLIMRDKSNKSLSEDQEIRVREFEKLS-NTNQVTFEKSVDMRSVTAHFNLINLKC----------------SIQFIYRTSIGDIVFLDVL-VLRQRAEKIRPQNLEELEKILKTTI---------DDCRRNNILPIEKCVDVTLDYLNKLSSRFSLRAIRSLKDQSTPIHSFTSLPDVKVPFPRICGASFSPTGLLVCFLSP 1691
            ++ QA++ +++  G   +  G   + +++ D P +  RK S     D    QWN   +   YFA + +    ++   D   +   +L+ H ++IS +DW     + + T+S D    + IWDI++++ P+  + +  G   VKW+    N  AT+   ++ IWD RK +       AH   I+  DW  +  +I+ +  QD  +K W+  +  +       Y N   C+       +T     L +  VP    EN +  W++ +     +TP HT     +V+ +F      E +   Q VT  R+  L++W ++  +    ++   +  + G+D  I  + + L P P+ +++         +E   + H              P  ++ ++ +  L   Q ++ +EF  ++     V  E     RS T   +  N +                 S QFI  T+I   +   +L +L+  A +   +    LE  L+  +         +D   +N   +   V   L    ++++                  ++ S  D  +PFPR  GA F   G LV F  P
Sbjct:   15 RDSQATAMSVDCLGQHAVLSGRRFLYIVNLDAPFEGHRKISRQSKWDIGAVQWNPHDSFAHYFAASSNQRVDLYKWKDGSGEVGTTLQGHTRVISDLDWAVFEPDLLVTSSVDTY--IYIWDIKDTRKPTVALSAVAGASQVKWNKKNANCLATSHDGDVRIWDKRKPSTAVEYLAAHLSKIHGLDWHPDSEHILATSSQDNSVKFWDYRQPRK-------YLNILPCQVPVWKARYTPFSNGLVTVMVPQLRRENSLLLWNVFDL----NTPVHTFVGHDDVVLEFQWRKQKEGSKDYQLVTWSRDQTLRMWRVDSQM----QRLCANDILDGVDEFI--ESISLLPEPEKTLH---------TEDTDHQHTASHGEEEALKEDPPRNLLEERKSDQLGLPQTLQ-QEFSLINVQIRNVNVEMDAADRSCTVSVHCSNHRVKMLVKFPAQYPNNAAPSFQFINPTTITSTMKAKLLKILKDTALQKVKRGQSCLEPCLRQLVSCLESFVNQEDSASSNPFALPNSVTPPLPTFARVTT------------------AYGSYQDANIPFPRTSGARFCGAGYLVYFTRP 556          
BLAST of WD repeat-containing protein 59 vs. Ensembl Human
Match: WDR59 (WD repeat domain 59 [Source:HGNC Symbol;Acc:HGNC:25706])

HSP 1 Score: 85.5001 bits (210), Expect = 1.504e-16
Identity = 80/342 (23.39%), Postives = 151/342 (44.15%), Query Frame = 3
Query:  114 GSLGLFCGLYEILLLSFDDP-KRKRKESINKSSDPVLCQWNK--TCNEYFALTQSNVCKIF---DIELKKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDS-QGIQLVKWSNVKTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDWSANM-NIIVSCGQDKKLKIWNLEESNQNRILEEDYANYSMCKFDTLDNIFT-----LNSSDVPS---ENFVSFWSIVEFRKLYSTPPHT-----NVITDFALIYPTETA--CQFVTLHRNSDLKVWEINRSLVSGKRKRGGSSHVAGLDNSISNDRLFLSPSPDHSVN 1070
            G   +  G   + +++ D P +  RK S     D    QWN   +   YFA + +    ++   D   +   +L+ H ++IS +DW     + + T+S D    + IWDI++++ P+  + +  G   VKW+    N  AT+   ++ IWD RK +       AH   I+  DW  +  +I+ +  QD  +K W+  +  +       Y N   C+       +T     L +  VP    EN +  W++ +     +TP HT     +V+ +F      E +   Q VT  R+  L++W ++  +    ++   +  + G+D  I  + + L P P+ +++
Sbjct:    7 GQHAVLSGRRFLYIVNLDAPFEGHRKISRQSKWDIGAVQWNPHDSFAHYFAASSNQRVDLYKWKDGSGEVGTTLQGHTRVISDLDWAVFEPDLLVTSSVDTY--IYIWDIKDTRKPTVALSAVAGASQVKWNKKNANCLATSHDGDVRIWDKRKPSTAVEYLAAHLSKIHGLDWHPDSEHILATSSQDNSVKFWDYRQPRK-------YLNILPCQVPVWKARYTPFSNGLVTVMVPQLRRENSLLLWNVFDL----NTPVHTFVGHDDVVLEFQWRKQKEGSKDYQLVTWSRDQTLRMWRVDSQM----QRLCANDILDGVDEFI--ESISLLPEPEKTLH 329          
BLAST of WD repeat-containing protein 59 vs. Ensembl Human
Match: RBBP4 (RB binding protein 4, chromatin remodeling factor [Source:HGNC Symbol;Acc:HGNC:9887])

HSP 1 Score: 62.7734 bits (151), Expect = 2.859e-10
Identity = 45/156 (28.85%), Postives = 78/156 (50.00%), Query Frame = 3
Query:  261 TQSNVCKIFDIELKKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIR--NSKFPSHKIDSQGIQLVKWSNVKTNSF--ATTSSEE-IMIWDDRKLTAPTHIFEAHNGNINDFDWSA-NMNIIVSCGQDKKLKIWNLEESNQNRILEE 710
            T S+   +FD    K  S   H  ++  + WH  +++   + ++D  + L IWD R  N+  PSH +D+   ++   S    + F  AT S+++ + +WD R L    H FE+H   I    WS  N  I+ S G D++L +W+L +  + +  E+
Sbjct:   10 TPSSDVLVFD--YTKHPSKPGHTAVVEDVSWHLLHESLFGSVADD--QKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPED 161          
BLAST of WD repeat-containing protein 59 vs. Ensembl Human
Match: RBBP7 (RB binding protein 7, chromatin remodeling factor [Source:HGNC Symbol;Acc:HGNC:9890])

HSP 1 Score: 58.9214 bits (141), Expect = 2.815e-9
Identity = 38/136 (27.94%), Postives = 71/136 (52.21%), Query Frame = 3
Query:  321 AHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRN--SKFPSHKIDSQGIQLVKWSNVKTNSF--ATTSSEE-IMIWDDRKLTAPTHIFEAHNGNINDFDWSA-NMNIIVSCGQDKKLKIWNLEESNQNRILEE 710
             H+ ++  + WH  +++   + ++D  + L IWD R+  +  PSH +D+   ++   S    + F  AT S+++ + +WD R L    H FE+H   I    WS  N  I+ S G D++L +W+L +  + +  E+
Sbjct:   28 GHSAVVEDVAWHLLHESLFGSVADD--QKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAED 161          
BLAST of WD repeat-containing protein 59 vs. Ensembl Celegans
Match: lin-53 (Probable histone-binding protein lin-53 [Source:UniProtKB/Swiss-Prot;Acc:P90916])

HSP 1 Score: 72.0182 bits (175), Expect = 8.760e-13
Identity = 48/176 (27.27%), Postives = 82/176 (46.59%), Query Frame = 3
Query:  195 INKSSDPVLCQWNKTCNEYFALTQSNVCKIFDIELKKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDSQGIQL--VKWSNVKTNSFATTSSEE-IMIWDDRKLTAPTHIFEAHNGNINDFDWSA-NMNIIVSCGQDKKLKIWNLEESNQNRILEE 710
            ++ S D  +C W+   N+  A            EL+     K H  ++  + WH  +     +  +D  K L IWD+R S  P H ID+   ++  + ++       AT S+++ + +WD R L    H FE+H   I    WS  N  I+ S G DK+L +W+L +  +++  E+
Sbjct:  189 LSASDDQTVCHWDINANQNVAG-----------ELQAKDVFKGHESVVEDVAWHVLHDGVFGSVGDD--KKLLIWDVRTST-PGHCIDAHSAEVNCLAFNPYSEFILATGSADKTVALWDLRNLRMKLHSFESHRDEIFQVQWSPHNETILASSGTDKRLHVWDLSKIGEDQSAED 350          

HSP 2 Score: 50.0618 bits (118), Expect = 6.116e-6
Identity = 37/153 (24.18%), Postives = 78/153 (50.98%), Query Frame = 3
Query:  315 LKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDSQGIQL--VKWSNVKTNSFATTSSEE-IMIWDDRKLT----------APTHIFEAHNGN---INDFDWSANMN-IIVSCGQDKKLKIWNLEESNQNRILEEDYAN 722
            + AH+  ++ + ++P ++  +AT S D  K++ +WD+RN +   H  +S   ++  V+WS       A++ +++ + +WD  K+            P  +   H G+   I+DF W+ N   ++ S  +D  L++W + ++  N + EE  A+
Sbjct:  261 IDAHSAEVNCLAFNPYSEFILATGSAD--KTVALWDLRNLRMKLHSFESHRDEIFQVQWSPHNETILASSGTDKRLHVWDLSKIGEDQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVVCSVSEDNILQVWQMADNIYNEVDEETPAD 411          
BLAST of WD repeat-containing protein 59 vs. Ensembl Celegans
Match: pfs-2 (Polyadenylation Factor Subunit homolog [Source:UniProtKB/TrEMBL;Acc:U4PN22])

HSP 1 Score: 53.9138 bits (128), Expect = 5.681e-7
Identity = 44/173 (25.43%), Postives = 72/173 (41.62%), Query Frame = 3
Query:  315 LKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRN----SKFPSHKIDSQGIQLVKWSNVKTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDWSA-NMNIIVSCGQDKKLKIWNLEESNQNRILE--EDYANYSMCKFDTLDNIFTLNSSDVPSENFVSFWS 812
            L+ H   +  IDWHP  K  IAT S D  + + IWD ++    +    HK     ++     N   N   T   + ++   D ++      + AH   +    W   +  + VS G D  +  W ++   +  +LE   D A +SM K+  L +I    S+D    N   FW+
Sbjct:  266 LRGHGAEVRCIDWHP-TKGLIATGSRDTQQPVKIWDPKSGSCLATLQEHKSSVMAVEF----NKNGNWLLTGGRDHLVKMYDIRMMKEMRTYRAHKKEVISLAWHPIHEGLFVSGGGDGSIVYWMVDGEKEIGLLEHAHDQAIWSM-KWHPLGHILATGSND----NNTKFWA 428          
BLAST of WD repeat-containing protein 59 vs. Ensembl Celegans
Match: pfs-2 (Polyadenylation Factor Subunit homolog [Source:UniProtKB/TrEMBL;Acc:U4PN22])

HSP 1 Score: 53.5286 bits (127), Expect = 7.964e-7
Identity = 44/173 (25.43%), Postives = 72/173 (41.62%), Query Frame = 3
Query:  315 LKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRN----SKFPSHKIDSQGIQLVKWSNVKTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDWSA-NMNIIVSCGQDKKLKIWNLEESNQNRILE--EDYANYSMCKFDTLDNIFTLNSSDVPSENFVSFWS 812
            L+ H   +  IDWHP  K  IAT S D  + + IWD ++    +    HK     ++     N   N   T   + ++   D ++      + AH   +    W   +  + VS G D  +  W ++   +  +LE   D A +SM K+  L +I    S+D    N   FW+
Sbjct:   50 LRGHGAEVRCIDWHP-TKGLIATGSRDTQQPVKIWDPKSGSCLATLQEHKSSVMAVEF----NKNGNWLLTGGRDHLVKMYDIRMMKEMRTYRAHKKEVISLAWHPIHEGLFVSGGGDGSIVYWMVDGEKEIGLLEHAHDQAIWSM-KWHPLGHILATGSND----NNTKFWA 212          
BLAST of WD repeat-containing protein 59 vs. Ensembl Fly
Match: Wdr59 (gene:FBgn0032339 transcript:FBtr0080196)

HSP 1 Score: 84.3445 bits (207), Expect = 3.485e-16
Identity = 80/317 (25.24%), Postives = 143/317 (45.11%), Query Frame = 3
Query:   75 KEIQASSFAMNSNGSLGLFCGLYEILL--LSFDDPKRKRKESINKSSDPV----LCQWNKTCNEYFALTQS---NVCKIFDIELKKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDS---QGIQLVKWSNVKTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDWSANM-NIIVSCGQDKKLKIWNLEESNQNRILEEDYANYSMCKFDTLDNIFTLNSSDVP----SENFVSFWS-IVEFRKLYSTPPHTNVITDFALIYPTETA--CQFVTLHRNSDLKVWEINRSLV 965
            ++ QA++ +++ +G   L  G   + L  L  DD   +R E  +K    V    +C   K   EY A+  S   ++ +    E     SL+ H + ++ IDWH  + N + + S D      IWD+R  + P+  +++    G   V ++ V  N  A     ++ IWD RK + PTH   AH   ++  +WS      + +  QD  +K +++    +   +    +     ++  + N   L S  VP     EN +  WS   +   + S   HT+VI DFA     E++   + VT  R+  L+VW+I+ +++
Sbjct:   39 RDSQATAMSVDYSGQWVLLAGRGHLALQRLGQDDGSLRRHERQSKYEVSVAEFAICPSRK---EYCAIATSQHIDIVRWGTAEPHYEMSLRGHTRTVTDIDWHGKDPNLLVSCSIDTFSH--IWDLREPRKPALSLNAVCMSGATQVGFNRVSGNLLAAAHDGDLRIWDIRKGSCPTHYITAHLNRVHGINWSHKRETCLATASQDGTVKYFDVCNPRRAEKIITTMSPVWRARYTPIGN--GLVSIVVPHLGRGENSLLLWSNSKQTDPICSFVGHTDVILDFAWRPNRESSNEIELVTWSRDRTLRVWKIDDNML 348          
BLAST of WD repeat-containing protein 59 vs. Ensembl Fly
Match: Wdr59 (gene:FBgn0032339 transcript:FBtr0343622)

HSP 1 Score: 84.3445 bits (207), Expect = 3.485e-16
Identity = 80/317 (25.24%), Postives = 143/317 (45.11%), Query Frame = 3
Query:   75 KEIQASSFAMNSNGSLGLFCGLYEILL--LSFDDPKRKRKESINKSSDPV----LCQWNKTCNEYFALTQS---NVCKIFDIELKKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDS---QGIQLVKWSNVKTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDWSANM-NIIVSCGQDKKLKIWNLEESNQNRILEEDYANYSMCKFDTLDNIFTLNSSDVP----SENFVSFWS-IVEFRKLYSTPPHTNVITDFALIYPTETA--CQFVTLHRNSDLKVWEINRSLV 965
            ++ QA++ +++ +G   L  G   + L  L  DD   +R E  +K    V    +C   K   EY A+  S   ++ +    E     SL+ H + ++ IDWH  + N + + S D      IWD+R  + P+  +++    G   V ++ V  N  A     ++ IWD RK + PTH   AH   ++  +WS      + +  QD  +K +++    +   +    +     ++  + N   L S  VP     EN +  WS   +   + S   HT+VI DFA     E++   + VT  R+  L+VW+I+ +++
Sbjct:   39 RDSQATAMSVDYSGQWVLLAGRGHLALQRLGQDDGSLRRHERQSKYEVSVAEFAICPSRK---EYCAIATSQHIDIVRWGTAEPHYEMSLRGHTRTVTDIDWHGKDPNLLVSCSIDTFSH--IWDLREPRKPALSLNAVCMSGATQVGFNRVSGNLLAAAHDGDLRIWDIRKGSCPTHYITAHLNRVHGINWSHKRETCLATASQDGTVKYFDVCNPRRAEKIITTMSPVWRARYTPIGN--GLVSIVVPHLGRGENSLLLWSNSKQTDPICSFVGHTDVILDFAWRPNRESSNEIELVTWSRDRTLRVWKIDDNML 348          
BLAST of WD repeat-containing protein 59 vs. Ensembl Fly
Match: Caf1-55 (gene:FBgn0263979 transcript:FBtr0083052)

HSP 1 Score: 63.929 bits (154), Expect = 3.865e-10
Identity = 47/180 (26.11%), Postives = 84/180 (46.67%), Query Frame = 3
Query:  195 INKSSDPVLCQW--NKTCNEYFALTQSNVCKIFDIELKKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRN--SKFPSHKIDSQGIQLVKWSNVKTNSF--ATTSSEE-IMIWDDRKLTAPTHIFEAHNGNINDFDWSA-NMNIIVSCGQDKKLKIWNLEESNQNRILEE 710
            ++ S D  +C W  N T  E+  +   N+                H  ++  + WH  +++   + ++D  + L IWD RN  +  PSH +D+   ++   S    + F  AT S+++ + +WD R L    H FE+H   I    WS  N  I+ S G D++L +W+L +  + +  E+
Sbjct:  198 LSASDDHTICLWDINATPKEHRVIDAKNI-------------FTGHTAVVEDVAWHLLHESLFGSVADD--QKLMIWDTRNNNTSKPSHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSTED 362          

HSP 2 Score: 54.299 bits (129), Expect = 4.763e-7
Identity = 34/133 (25.56%), Postives = 67/133 (50.38%), Query Frame = 3
Query:  315 LKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDSQGI--------QLVKWSNVKTNSFATTSSEE-IMIWDDR--KLTAPTHIFEAHNGNINDFDWSANMNIIVSCG-QDKKLKIWNL 677
            L+ H K    + W+P+    + +AS+D+  ++C+WDI  +      ID++ I        + V W  +  + F + + ++ +MIWD R    + P+H  +AH   +N   ++     I++ G  DK + +W+L
Sbjct:  177 LRGHQKEGYGLSWNPNLNGYLLSASDDH--TICLWDINATPKEHRVIDAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWDTRNNNTSKPSHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDL 307          

HSP 3 Score: 50.8322 bits (120), Expect = 5.585e-6
Identity = 38/149 (25.50%), Postives = 73/149 (48.99%), Query Frame = 3
Query:  300 KKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDSQGIQL--VKWSNVKTNSFATTSSEE-IMIWDDRKLT----------APTHIFEAHNGN---INDFDWSANMN-IIVSCGQDKKLKIWNLEESNQN 695
            K   ++ AH   ++ + ++P ++  +AT S D  K++ +WD+RN K   H  +S   ++  V+WS       A++ ++  + +WD  K+            P  +   H G+   I+DF W+ N   II S  +D  +++W + E+  N
Sbjct:  268 KPSHTVDAHTAEVNCLSFNPYSEFILATGSAD--KTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSTEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENVYN 414          
BLAST of WD repeat-containing protein 59 vs. Ensembl Fly
Match: Caf1-55 (gene:FBgn0263979 transcript:FBtr0301845)

HSP 1 Score: 63.929 bits (154), Expect = 3.886e-10
Identity = 47/180 (26.11%), Postives = 84/180 (46.67%), Query Frame = 3
Query:  195 INKSSDPVLCQW--NKTCNEYFALTQSNVCKIFDIELKKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRN--SKFPSHKIDSQGIQLVKWSNVKTNSF--ATTSSEE-IMIWDDRKLTAPTHIFEAHNGNINDFDWSA-NMNIIVSCGQDKKLKIWNLEESNQNRILEE 710
            ++ S D  +C W  N T  E+  +   N+                H  ++  + WH  +++   + ++D  + L IWD RN  +  PSH +D+   ++   S    + F  AT S+++ + +WD R L    H FE+H   I    WS  N  I+ S G D++L +W+L +  + +  E+
Sbjct:  197 LSASDDHTICLWDINATPKEHRVIDAKNI-------------FTGHTAVVEDVAWHLLHESLFGSVADD--QKLMIWDTRNNNTSKPSHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSTED 361          

HSP 2 Score: 54.299 bits (129), Expect = 4.878e-7
Identity = 34/133 (25.56%), Postives = 67/133 (50.38%), Query Frame = 3
Query:  315 LKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDSQGI--------QLVKWSNVKTNSFATTSSEE-IMIWDDR--KLTAPTHIFEAHNGNINDFDWSANMNIIVSCG-QDKKLKIWNL 677
            L+ H K    + W+P+    + +AS+D+  ++C+WDI  +      ID++ I        + V W  +  + F + + ++ +MIWD R    + P+H  +AH   +N   ++     I++ G  DK + +W+L
Sbjct:  176 LRGHQKEGYGLSWNPNLNGYLLSASDDH--TICLWDINATPKEHRVIDAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWDTRNNNTSKPSHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDL 306          

HSP 3 Score: 50.8322 bits (120), Expect = 5.671e-6
Identity = 38/149 (25.50%), Postives = 73/149 (48.99%), Query Frame = 3
Query:  300 KKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDSQGIQL--VKWSNVKTNSFATTSSEE-IMIWDDRKLT----------APTHIFEAHNGN---INDFDWSANMN-IIVSCGQDKKLKIWNLEESNQN 695
            K   ++ AH   ++ + ++P ++  +AT S D  K++ +WD+RN K   H  +S   ++  V+WS       A++ ++  + +WD  K+            P  +   H G+   I+DF W+ N   II S  +D  +++W + E+  N
Sbjct:  267 KPSHTVDAHTAEVNCLSFNPYSEFILATGSAD--KTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSTEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENVYN 413          
BLAST of WD repeat-containing protein 59 vs. Ensembl Fly
Match: U4-U6-60K (gene:FBgn0036733 transcript:FBtr0075209)

HSP 1 Score: 58.151 bits (139), Expect = 3.178e-8
Identity = 64/278 (23.02%), Postives = 118/278 (42.45%), Query Frame = 3
Query:  276 CKIF---DIELKKFQSLKAHNKIISSIDWHP----DNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDSQGIQLVKWSNVKTNSFATTSSEE--IMIWDDRKLTAPTHIFEAHNGNINDFDWSANMNIIVSCGQDKKLKIWNLEESNQNRILEEDYANYSMCKFDTLDNIFTLNSSDVPSENFVSFWSIVEFRKLYSTPPHTNVITDFALIYPTETACQFVTLHRNSDLKVWEINRSLVSGKRKRGGSSHVAGLD--------NSISNDRLFLSPSPD 1058
            CK++   D ELK  Q+L+ H   +  +   P    D +N +A AS  +  ++ +W   N +  +        ++ K +   +  F  T+  +    +WD  + T   H  E H   ++   + ++ +++V+ G D   ++W+L        LE      ++   D   N F + +     +N    W +   + +Y+ P HTN+I+D  + Y  E     VT   +S  K+W  N++    K  +G  + V  +D         + S DR F   SPD
Sbjct:  285 CKLWSVPDCELK--QTLRGHASYVGGVALRPGVKADEENVVAMASGGHDGAVKLWGFNNEESIADITGHMPHRVSKVAFHPSGRFLATACYDSSWRLWDLEQKTEVLHQ-EGHAKPVHCLSYHSDGSVLVTGGLDAFGRVWDLRTGRCIMFLEGHLG--AVFGVDFSPNGFHIATGS--QDNTCKIWDLRRRQPVYTIPAHTNLISD--VKYQQECGSFLVTCSYDSTTKIWS-NKTWQPLKTLQGHDNKVISVDIAPNSQYIATTSFDRTFKLWSPD 552          
BLAST of WD repeat-containing protein 59 vs. Ensembl Zebrafish
Match: wdr59 (WD repeat domain 59 [Source:ZFIN;Acc:ZDB-GENE-120215-187])

HSP 1 Score: 90.1225 bits (222), Expect = 7.834e-18
Identity = 75/315 (23.81%), Postives = 139/315 (44.13%), Query Frame = 3
Query:   75 KEIQASSFAMNSNGSLGLFCGLYEILLLSFDDP-KRKRKESINKSSDPVLCQWN--KTCNEYFALTQSNVCKIF---DIELKKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDS-QGIQLVKWSNVKTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDWSA-NMNIIVSCGQDKKLKIWNLEE--------SNQNRILEEDYANYSMCKFDTLDNIFTLNSSDVPSENFVSFWSIVEF-RKLYSTPPHTNVITDFALIYPTETA--CQFVTLHRNSDLKVWEINRSL 962
            ++ QA++ +++  G   +  G   + +++ + P +  RK S     D    QWN  K+    FA + +    ++   D   K   SL+ H ++IS +DW       + T+S D    + IWD  +++ P+  + +  G   VKW+       A++   ++ IWD RK         AH   IN  DW   N  I+ +  QD  ++ W+  +        S Q  + +  Y  +S       + + T+    +  EN +  WS +E    +++   H +V+ +F      E +  CQ VTL R+  L++W ++  L
Sbjct:   15 RDAQANAMSVDCLGQHAVLSGRRFLYVVNLETPSEAPRKISRQSKWDVGTVQWNPHKSDAHIFAASSNQRVDLYTWRDGSGKSHTSLQGHTRVISDLDWSWFEPEFLVTSSVDTY--IYIWDTSDTRRPTVTLSAVAGASQVKWNRRNHYCLASSHDGDVRIWDKRKSNTAVEYVAAHLSKINGLDWHPDNEYILATSSQDNSVRFWDYRQPRKYLDILSCQVPVWKARYTPFS-------NGLVTVMVPQLRRENSLLLWSTLELNSPVHAFVGHDDVVYEFQWRPQKEGSKDCQLVTLSRDQTLRIWRVDPQL 320          

HSP 2 Score: 79.337 bits (194), Expect = 1.800e-14
Identity = 67/236 (28.39%), Postives = 101/236 (42.80%), Query Frame = 3
Query: 1596 SFTSLPDVKVPFPRICGASFSPTGLLVCFLSPEGYMSRFHSAPRSLADISKLANTNSSSKGFFYEM----NKNTTQKQYYKSNIRKLK-----STEFNTETPSRK---------LSTQSIQKQTHIVLIYNVLQLSLFNVSLAKNYSLKISNAEAMCHKNLSAVTNCNRKDLFEFWQYCAILAN-GCKPSCNISAGYIRPWATQSMGRGLCELWMKHFLDINDIQSAAMLVIVMRA 2246
            ++ S  D  +PFPR  GA F  TG LV F  P   M+   + P +      L+  ++   G    M       TT + Y  S  R  K     S+ +  E  SR+          S + I K    V+I  +  L   + +L + Y L +++ +  C KN +A     R+DL + W   +   N    P  +  AG   PWA    GR L E  ++H+  ++D+QS AML  V R 
Sbjct:  514 TYGSYQDANIPFPRTSGARFCGTGSLVYFTRP---MTMHRATPPTEPTPRSLSALSAYHSGVMTPMKMRTESQTTLRLYSGSPTRTDKDQVSISSFYYKERKSRRWKGKREGGDYSNRPI-KLAGKVIIQEISCLLSVHKALGETYVLNVNDIQDTCQKNGAAALAVARRDLAKVWALASASTNLNLSPDPDPDAG--TPWAKHPFGRHLLETLLEHYSQLSDVQSLAMLCSVFRG 743          

HSP 3 Score: 62.7734 bits (151), Expect = 2.524e-9
Identity = 47/183 (25.68%), Postives = 81/183 (44.26%), Query Frame = 3
Query:  225 QWNKTCNEYFALTQSNVCKIFDIELK--KFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDSQGIQLVKWSNVKT---NSFATTSSEE------IMIWDDRKLTAPTHIFEAHNGNINDFDWSANMN-----IIVSCGQDKKLKIWNLEESNQ-----NRILEE 710
            +WN+  +   A +     +I+D        + + AH   I+ +DWHPDN+  +AT+S DN  S+  WD R    P   +D    Q+  W    T   N   T    +      +++W   +L +P H F  H+  + +F W           +V+  +D+ L+IW ++   Q     N I++E
Sbjct:  155 KWNRRNHYCLASSHDGDVRIWDKRKSNTAVEYVAAHLSKINGLDWHPDNEYILATSSQDN--SVRFWDYRQ---PRKYLDILSCQVPVWKARYTPFSNGLVTVMVPQLRRENSLLLWSTLELNSPVHAFVGHDDVVYEFQWRPQKEGSKDCQLVTLSRDQTLRIWRVDPQLQKLCCANEIVDE 332          
BLAST of WD repeat-containing protein 59 vs. Ensembl Zebrafish
Match: wdr59 (WD repeat domain 59 [Source:ZFIN;Acc:ZDB-GENE-120215-187])

HSP 1 Score: 90.1225 bits (222), Expect = 8.488e-18
Identity = 75/315 (23.81%), Postives = 139/315 (44.13%), Query Frame = 3
Query:   75 KEIQASSFAMNSNGSLGLFCGLYEILLLSFDDP-KRKRKESINKSSDPVLCQWN--KTCNEYFALTQSNVCKIF---DIELKKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDS-QGIQLVKWSNVKTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDWSA-NMNIIVSCGQDKKLKIWNLEE--------SNQNRILEEDYANYSMCKFDTLDNIFTLNSSDVPSENFVSFWSIVEF-RKLYSTPPHTNVITDFALIYPTETA--CQFVTLHRNSDLKVWEINRSL 962
            ++ QA++ +++  G   +  G   + +++ + P +  RK S     D    QWN  K+    FA + +    ++   D   K   SL+ H ++IS +DW       + T+S D    + IWD  +++ P+  + +  G   VKW+       A++   ++ IWD RK         AH   IN  DW   N  I+ +  QD  ++ W+  +        S Q  + +  Y  +S       + + T+    +  EN +  WS +E    +++   H +V+ +F      E +  CQ VTL R+  L++W ++  L
Sbjct:   15 RDAQANAMSVDCLGQHAVLSGRRFLYVVNLETPSEAPRKISRQSKWDVGTVQWNPHKSDAHIFAASSNQRVDLYTWRDGSGKSHTSLQGHTRVISDLDWSWFEPEFLVTSSVDTY--IYIWDTSDTRRPTVTLSAVAGASQVKWNRRNHYCLASSHDGDVRIWDKRKSNTAVEYVAAHLSKINGLDWHPDNEYILATSSQDNSVRFWDYRQPRKYLDILSCQVPVWKARYTPFS-------NGLVTVMVPQLRRENSLLLWSTLELNSPVHAFVGHDDVVYEFQWRPQKEGSKDCQLVTLSRDQTLRIWRVDPQL 320          

HSP 2 Score: 76.6406 bits (187), Expect = 1.182e-13
Identity = 66/253 (26.09%), Postives = 101/253 (39.92%), Query Frame = 3
Query: 1596 SFTSLPDVKVPFPRICGASFSPTGLLVCFLSPEGYMSRFHSAPRSLADISKLANTNSSSKGFFYEM----NKNTTQKQYYKSNIR------KLKSTEFNTETP---SRKLSTQSIQ----------------------KQTHIVLIYNVLQLSLFNVSLAKNYSLKISNAEAMCHKNLSAVTNCNRKDLFEFWQYCAILAN-GCKPSCNISAGYIRPWATQSMGRGLCELWMKHFLDINDIQSAAMLVIVMRA 2246
            ++ S  D  +PFPR  GA F  TG LV F  P   M+   + P +      L+  ++   G    M       TT + Y  S  R       + S  +    P   +R+ S Q+I                       K    V+I  +  L   + +L + Y L +++ +  C KN +A     R+DL + W   +   N    P  +  AG   PWA    GR L E  ++H+  ++D+QS AML  V R 
Sbjct:  514 TYGSYQDANIPFPRTSGARFCGTGSLVYFTRP---MTMHRATPPTEPTPRSLSALSAYHSGVMTPMKMRTESQTTLRLYSGSPTRTDKDQVSISSFYYKERKPLSAARRWSVQTIHECPKSRRWKGKREGGDYSNRPIKLAGKVIIQEISCLLSVHKALGETYVLNVNDIQDTCQKNGAAALAVARRDLAKVWALASASTNLNLSPDPDPDAG--TPWAKHPFGRHLLETLLEHYSQLSDVQSLAMLCSVFRG 761          

HSP 3 Score: 62.3882 bits (150), Expect = 2.789e-9
Identity = 47/183 (25.68%), Postives = 81/183 (44.26%), Query Frame = 3
Query:  225 QWNKTCNEYFALTQSNVCKIFDIELK--KFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDSQGIQLVKWSNVKT---NSFATTSSEE------IMIWDDRKLTAPTHIFEAHNGNINDFDWSANMN-----IIVSCGQDKKLKIWNLEESNQ-----NRILEE 710
            +WN+  +   A +     +I+D        + + AH   I+ +DWHPDN+  +AT+S DN  S+  WD R    P   +D    Q+  W    T   N   T    +      +++W   +L +P H F  H+  + +F W           +V+  +D+ L+IW ++   Q     N I++E
Sbjct:  155 KWNRRNHYCLASSHDGDVRIWDKRKSNTAVEYVAAHLSKINGLDWHPDNEYILATSSQDN--SVRFWDYRQ---PRKYLDILSCQVPVWKARYTPFSNGLVTVMVPQLRRENSLLLWSTLELNSPVHAFVGHDDVVYEFQWRPQKEGSKDCQLVTLSRDQTLRIWRVDPQLQKLCCANEIVDE 332          
BLAST of WD repeat-containing protein 59 vs. Ensembl Zebrafish
Match: rbbp4 (retinoblastoma binding protein 4 [Source:NCBI gene;Acc:321726])

HSP 1 Score: 61.2326 bits (147), Expect = 3.856e-9
Identity = 47/178 (26.40%), Postives = 84/178 (47.19%), Query Frame = 3
Query:  195 INKSSDPVLCQWNKTCNEYFALTQSNVCKIFDIELKKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIR--NSKFPSHKIDSQGIQLVKWSNVKTNSF--ATTSSEE-IMIWDDRKLTAPTHIFEAHNGNINDFDWSA-NMNIIVSCGQDKKLKIWNLEESNQNRILEE 710
            ++ S D  +C W+ +       T     KI D +         H  ++  + WH  +++   + ++D  + L IWD R  N+  PSH +D+   ++   S    + F  AT S+++ + +WD R L    H FE+H   I    WS  N  I+ S G D++L +W+L +  + +  E+
Sbjct:  194 LSASDDHTICLWDIS-------TVPKEGKIVDAK----TIFTGHTAVVEDVSWHLLHESLFGSVADD--QKLMIWDTRSNNTSKPSHAVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPED 358          

HSP 2 Score: 51.9878 bits (123), Expect = 2.704e-6
Identity = 33/133 (24.81%), Postives = 66/133 (49.62%), Query Frame = 3
Query:  315 LKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDSQGI--------QLVKWSNVKTNSFATTSSEE-IMIWDDRK--LTAPTHIFEAHNGNINDFDWSANMNIIVSCG-QDKKLKIWNL 677
            L+ H K    + W+P+    + +AS+D+  ++C+WDI         +D++ I        + V W  +  + F + + ++ +MIWD R    + P+H  +AH   +N   ++     I++ G  DK + +W+L
Sbjct:  173 LRGHQKEGYGLSWNPNLSGCLLSASDDH--TICLWDISTVPKEGKIVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHAVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDL 303          
BLAST of WD repeat-containing protein 59 vs. Ensembl Zebrafish
Match: rbb4l (retinoblastoma binding protein 4, like [Source:NCBI gene;Acc:322129])

HSP 1 Score: 61.2326 bits (147), Expect = 4.148e-9
Identity = 39/136 (28.68%), Postives = 70/136 (51.47%), Query Frame = 3
Query:  321 AHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIR--NSKFPSHKIDSQGIQLVKWSNVKTNSF--ATTSSEE-IMIWDDRKLTAPTHIFEAHNGNINDFDWSA-NMNIIVSCGQDKKLKIWNLEESNQNRILEE 710
             H  ++  + WH  +++   + ++D  + L IWD R  N+  PSH +D+   ++   S    + F  AT S+++ + +WD R L    H FE+H   I    WS  N  I+ S G D++L +W+L +  + +  E+
Sbjct:  224 GHTAVVEDVSWHLLHESLFGSVADD--QKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSAED 357          

HSP 2 Score: 53.5286 bits (127), Expect = 9.161e-7
Identity = 33/133 (24.81%), Postives = 67/133 (50.38%), Query Frame = 3
Query:  315 LKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDSQGI--------QLVKWSNVKTNSFATTSSEE-IMIWDDRK--LTAPTHIFEAHNGNINDFDWSANMNIIVSCG-QDKKLKIWNL 677
            L+ H K    + W+P+    + +AS+D+  ++C+WDI  +      +D++ I        + V W  +  + F + + ++ +MIWD R    + P+H  +AH   +N   ++     I++ G  DK + +W+L
Sbjct:  172 LRGHQKEGYGLSWNPNLSGNLLSASDDH--TICLWDISGAPKEGKIVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDL 302          

HSP 3 Score: 50.447 bits (119), Expect = 8.508e-6
Identity = 37/145 (25.52%), Postives = 71/145 (48.97%), Query Frame = 3
Query:  300 KKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDSQGIQL--VKWSNVKTNSFATTSSEEIM-IWDDRKLT----------APTHIFEAHNGN---INDFDWSANMN-IIVSCGQDKKLKIWNLEE 683
            K   S+ AH   ++ + ++P ++  +AT S D  K++ +WD+RN K   H  +S   ++  V+WS       A++ ++  + +WD  K+            P  +   H G+   I+DF W+ N   +I S  +D  +++W + E
Sbjct:  263 KPSHSVDAHTAEVNCLSFNPYSEFILATGSAD--KTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAE 405          
BLAST of WD repeat-containing protein 59 vs. Ensembl Zebrafish
Match: rbb4l (retinoblastoma binding protein 4, like [Source:NCBI gene;Acc:322129])

HSP 1 Score: 61.2326 bits (147), Expect = 4.162e-9
Identity = 39/136 (28.68%), Postives = 70/136 (51.47%), Query Frame = 3
Query:  321 AHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIR--NSKFPSHKIDSQGIQLVKWSNVKTNSF--ATTSSEE-IMIWDDRKLTAPTHIFEAHNGNINDFDWSA-NMNIIVSCGQDKKLKIWNLEESNQNRILEE 710
             H  ++  + WH  +++   + ++D  + L IWD R  N+  PSH +D+   ++   S    + F  AT S+++ + +WD R L    H FE+H   I    WS  N  I+ S G D++L +W+L +  + +  E+
Sbjct:  225 GHTAVVEDVSWHLLHESLFGSVADD--QKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSAED 358          

HSP 2 Score: 53.5286 bits (127), Expect = 9.262e-7
Identity = 33/133 (24.81%), Postives = 67/133 (50.38%), Query Frame = 3
Query:  315 LKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDSQGI--------QLVKWSNVKTNSFATTSSEE-IMIWDDRK--LTAPTHIFEAHNGNINDFDWSANMNIIVSCG-QDKKLKIWNL 677
            L+ H K    + W+P+    + +AS+D+  ++C+WDI  +      +D++ I        + V W  +  + F + + ++ +MIWD R    + P+H  +AH   +N   ++     I++ G  DK + +W+L
Sbjct:  173 LRGHQKEGYGLSWNPNLSGNLLSASDDH--TICLWDISGAPKEGKIVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDL 303          

HSP 3 Score: 50.447 bits (119), Expect = 8.599e-6
Identity = 37/145 (25.52%), Postives = 71/145 (48.97%), Query Frame = 3
Query:  300 KKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDSQGIQL--VKWSNVKTNSFATTSSEEIM-IWDDRKLT----------APTHIFEAHNGN---INDFDWSANMN-IIVSCGQDKKLKIWNLEE 683
            K   S+ AH   ++ + ++P ++  +AT S D  K++ +WD+RN K   H  +S   ++  V+WS       A++ ++  + +WD  K+            P  +   H G+   I+DF W+ N   +I S  +D  +++W + E
Sbjct:  264 KPSHSVDAHTAEVNCLSFNPYSEFILATGSAD--KTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAE 406          
BLAST of WD repeat-containing protein 59 vs. Ensembl Xenopus
Match: ddb1 (damage-specific DNA binding protein 1 [Source:Xenbase;Acc:XB-GENE-967908])

HSP 1 Score: 139.813 bits (351), Expect = 4.613e-33
Identity = 179/772 (23.19%), Postives = 321/772 (41.58%), Query Frame = 3
Query:   96 FAMNSNGSLGLFCGLYEILLLSFDDPK-RKRKESINKSSDPVLCQWN--KTCNEYFALTQSNVCKIF---DIELKKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDS-QGIQLVKWSNVKTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDWSANMN-IIVSCGQDKKLKIWNLEESNQNRILEEDYANYSMCKFDTLDN-IFTLNSSDVPSENFVSFWSIVEFR-KLYSTPPHTNVITDFALIYPTETA--CQFVTLHRNSDLKVWEINRSLVSGKRKRGGSSHVAGLDNSISNDRLFLSPSPDHSVNKSKAIPVGQSESFVNMHKNDILSSIIAHRSDPNLIMRDKSNKSLSEDQEIRVREFEKLSNTNQVTFEKSVDMRSVTAHFNLINLKCSIQF-IYRTSIGDIVFLDVLVLRQRAEK---IRPQNLE-----ELEKILK-TTIDDCRRNNILPIEKC----VDVTLDYLNKLSSRFSLRAIRSLKDQST-PIHSFTSLP-------DVKVPFPRICGASFSPTGLLVCFLSP---EGYMSRFHSAPRSLADISKL-------ANTNSSSKG--FFYEMNKNTTQKQ-------YYKS-NIRKLKSTEFNTETPSRKLSTQSIQKQTHIVLIYNVLQLSLFNVSLAKNYSLKISNAEAMCHKNLSAVTNCNRKDLFEFWQYCAILANGC-KPSCNISAGYIRPWATQSMGRGLCELWMKHFLDINDIQSAAMLVIVMRA 2246
             +++  G L +  G   + +++ + P    RK S     D    QWN  ++   +FA + +    ++   D       SL+ H ++IS +DW     + + T+S D    + IWDI++++ P+  + +  G   VKW+   +N  AT+   ++ IWD RK +       AH   I+  DW  +   I+ +  QD  +K W+  +  +   +          ++   +N + T+    +  EN +  W++ +    ++    H +V+ +F      E     Q VT  R+  L++W ++  L    ++   +  +  +D  +  D L L P  + S+   + I  G SE      +             P   M   +++ L   Q ++ +EF  +          +V +R+V    + +N  C++        +  +V   V      A     + P  +      +L KILK T++   +RN    +E C    V     ++N+ SS  S  +  +L+   T P+ +F  +P       D  +PFPR  GA F   G LV F  P      +S     PRSL+ +S          N  + + G    Y  +   ++K+       YYK    R+ KS   N++  SR +      K    V+I ++  L   + +L + Y L   + + MC KN +A  +  R+DL + W   A   + C  P  +  A    PWA    GR L E  + H+  ++D+Q+ AML  V  A
Sbjct:    1 MSVDCQGQLAVLSGRRFLYIVNLETPTDGHRKISRQSKWDIGTVQWNPHESYAHFFAASSNQRVDLYQWKDGTGDINTSLQGHTRVISDLDWSVFEPDVLVTSSIDTY--IYIWDIKDTRKPAVSLSAVAGASQVKWNKKNSNCLATSHDGDVRIWDRRKPSTAVEYIAAHLYKIHGLDWHPDSEYILATSSQDNSVKFWDSRQPRKCLNVLACQVPVWKARYTPFNNGLVTVMVPQLRRENSLLLWNVYDLHSPVHIFVGHDDVVLEFQWRKQKEALKDYQLVTWSRDQTLRMWRVDAQL----QRLCANDIMDPVDELM--DGLSLMPEQEKSLQPQEQI-SGHSEEDAAFGEE-----------SPTTPMILGTSEQLGLPQTLQ-QEFSLI----------NVHIRNVNIEMDAMNRSCTVSVHCGNHRVRMLVMFPVQYPNNAAPSFQFVTPTTISSAMKAKLLKILKDTSLQKVKRNQSC-LEPCLRQLVSCLESFVNQESSPSS--SPYNLQGPITPPLPTFARVPNAYGSYQDANIPFPRTSGARFCGAGYLVYFTRPMTMHRAVSPTEPTPRSLSALSAYHTGVMAPMNIRTETPGNLRIYSGSPTRSEKEQVSISSFYYKERKSRRWKSKRENSDANSRPI------KAAGKVIIQDISCLLTVHKALGELYILNHRDLQEMCQKNATAALSVGRRDLVQVWALAAAANDVCLSPKSDPDAE--TPWARHPFGRQLLESLLAHYCHLHDVQTLAMLCSVFDA 730          
BLAST of WD repeat-containing protein 59 vs. Ensembl Xenopus
Match: ddb1 (damage-specific DNA binding protein 1 [Source:Xenbase;Acc:XB-GENE-967908])

HSP 1 Score: 132.88 bits (333), Expect = 6.850e-31
Identity = 179/791 (22.63%), Postives = 321/791 (40.58%), Query Frame = 3
Query:   96 FAMNSNGSLGLFCGLYEILLLSFDDPK-RKRKESINKSSDPVLCQWN--KTCNEYFALTQSNVCKIF---DIELKKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDS-QGIQLVKWSNVKTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDWSANMN-IIVSCGQDKKLKIWNLEESNQNRILEEDYANYSMCKFDTLDN-IFTLNSSDVPSENFVSFWSIVEFR-KLYSTPPHTNVITDFALIYPTETA--CQFVTLHRNSDLKVWEINRSLVSGKRKRGGSSHVAGLDNSISNDRLFLSPSPDHSVNKSKAIPVGQSESFVNMHKNDILSSIIAHRSDPNLIMRDKSNKSLSEDQEIRVREFEKLSNTNQVTFEKSVDMRSVTAHFNLINLKCSIQF-IYRTSIGDIVFLDVLVLRQRAEK---IRPQNLE-----ELEKILK-TTIDDCRRNNILPIEKC----VDVTLDYLNKLSSRFSLRAIRSLKDQST-PIHSFTSLP-------DVKVPFPRICGASFSPTGLLVCFLSP---EGYMSRFHSAPRSLADISKL-------ANTNSSSKG--FFYEMNKNTTQKQ-------YYKSNI--------------------RKLKSTEFNTETPSRKLSTQSIQKQTHIVLIYNVLQLSLFNVSLAKNYSLKISNAEAMCHKNLSAVTNCNRKDLFEFWQYCAILANGC-KPSCNISAGYIRPWATQSMGRGLCELWMKHFLDINDIQSAAMLVIVMRA 2246
             +++  G L +  G   + +++ + P    RK S     D    QWN  ++   +FA + +    ++   D       SL+ H ++IS +DW     + + T+S D    + IWDI++++ P+  + +  G   VKW+   +N  AT+   ++ IWD RK +       AH   I+  DW  +   I+ +  QD  +K W+  +  +   +          ++   +N + T+    +  EN +  W++ +    ++    H +V+ +F      E     Q VT  R+  L++W ++  L    ++   +  +  +D  +  D L L P  + S+   + I  G SE      +             P   M   +++ L   Q ++ +EF  +          +V +R+V    + +N  C++        +  +V   V      A     + P  +      +L KILK T++   +RN    +E C    V     ++N+ SS  S  +  +L+   T P+ +F  +P       D  +PFPR  GA F   G LV F  P      +S     PRSL+ +S          N  + + G    Y  +   ++K+       YYK                       R+ KS   N++  SR +      K    V+I ++  L   + +L + Y L   + + MC KN +A  +  R+DL + W   A   + C  P  +  A    PWA    GR L E  + H+  ++D+Q+ AML  V  A
Sbjct:    1 MSVDCQGQLAVLSGRRFLYIVNLETPTDGHRKISRQSKWDIGTVQWNPHESYAHFFAASSNQRVDLYQWKDGTGDINTSLQGHTRVISDLDWSVFEPDVLVTSSIDTY--IYIWDIKDTRKPAVSLSAVAGASQVKWNKKNSNCLATSHDGDVRIWDRRKPSTAVEYIAAHLYKIHGLDWHPDSEYILATSSQDNSVKFWDSRQPRKCLNVLACQVPVWKARYTPFNNGLVTVMVPQLRRENSLLLWNVYDLHSPVHIFVGHDDVVLEFQWRKQKEALKDYQLVTWSRDQTLRMWRVDAQL----QRLCANDIMDPVDELM--DGLSLMPEQEKSLQPQEQI-SGHSEEDAAFGEE-----------SPTTPMILGTSEQLGLPQTLQ-QEFSLI----------NVHIRNVNIEMDAMNRSCTVSVHCGNHRVRMLVMFPVQYPNNAAPSFQFVTPTTISSAMKAKLLKILKDTSLQKVKRNQSC-LEPCLRQLVSCLESFVNQESSPSS--SPYNLQGPITPPLPTFARVPNAYGSYQDANIPFPRTSGARFCGAGYLVYFTRPMTMHRAVSPTEPTPRSLSALSAYHTGVMAPMNIRTETPGNLRIYSGSPTRSEKEQVSISSFYYKERTPPLSARRRWSIQVINDFPKSRRWKSKRENSDANSRPI------KAAGKVIIQDISCLLTVHKALGELYILNHRDLQEMCQKNATAALSVGRRDLVQVWALAAAANDVCLSPKSDPDAE--TPWARHPFGRQLLESLLAHYCHLHDVQTLAMLCSVFDA 749          
BLAST of WD repeat-containing protein 59 vs. Ensembl Xenopus
Match: ddb1 (damage-specific DNA binding protein 1 [Source:Xenbase;Acc:XB-GENE-967908])

HSP 1 Score: 117.087 bits (292), Expect = 5.744e-26
Identity = 177/774 (22.87%), Postives = 308/774 (39.79%), Query Frame = 3
Query:   96 FAMNSNGSLGLFCGLYEILLLSFDDPK-RKRKESINKSSDPVLCQWN--KTCNEYFALTQSNVCKIF---DIELKKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDSQGIQLVKWSNVKTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDWSANMN-IIVSCGQDKKLKIWNLEESNQNRILEEDYANYSMCKFDTLDN-IFTLNSSDVPSENFVSFWSIVEFR-KLYSTPPHTNVITDFALIYPTETAC----QFVTLHRNSDLKVWEINRSLVSGKRKRGGSSHVAGLDNSISNDRLFLSPSPDHSVNKSKAIPVGQSESFVNMHKNDILSSIIAHRSDPNLIMRDKSNKSLSEDQEIRVREFEKLSNTNQVTFEK-SVDMRSVTAHFNLINLKCSIQF-IYRTSIGDIVFLDVLVLRQRAEK---IRPQNLE-----ELEKILK-TTIDDCRRNNILPIEKC----VDVTLDYLNKLSSRFSLRAIRSLKDQSTP-IHSFTSLP-------DVKVPFPRICGASFSPTGLLVCFLSP---EGYMSRFHSAPRSLADISKL-------ANTNSSSKG--FFYEMNKNTTQKQ-------YYKS-NIRKLKSTEFNTETPSRKLSTQSIQKQTHIVLIYNVLQLSLFNVSLAKNYSLKISNAEAMCHKNLSAVTNCNRKDLFEFWQYCAILANGC-KPSCNISAGYIRPWATQSMGRGLCELWMKHFLDINDIQSAAMLVIVMRA 2246
             +++  G L +  G   + +++ + P    RK S     D    QWN  ++   +FA + +    ++   D       SL+ H ++IS +DW     + + T             I    F  +   + G   VKW+   +N  AT+   ++ IWD RK +       AH   I+  DW  +   I+ +  QD  +K W+  +  +   +          ++   +N + T+    +  EN +  W++ +    ++    H +V+ +F      E       Q VT  R+  L++W ++  L    ++   +  +  +D  +  D L L P  + S+   + I  G SE      ++ IL                     L ED ++       L  T Q  F   +V +R+V    + +N  C++        +  +V   V      A     + P  +      +L KILK T++   +RN    +E C    V     ++N+ SS  S  +  +L+   TP + +F  +P       D  +PFPR  GA F   G LV F  P      +S     PRSL+ +S          N  + + G    Y  +   ++K+       YYK    R+ KS   N++  SR +      K    V+I ++  L   + +L + Y L   + + MC KN +A  +  R+DL + W   A   + C  P  +  A    PWA    GR L E  + H+  ++D+Q+ AML  V  A
Sbjct:    1 MSVDCQGQLAVLSGRRFLYIVNLETPTDGHRKISRQSKWDIGTVQWNPHESYAHFFAASSNQRVDLYQWKDGTGDINTSLQGHTRVISDLDWSVFEPDVLVTI------------ILQYHFVFY---AAGASQVKWNKKNSNCLATSHDGDVRIWDRRKPSTAVEYIAAHLYKIHGLDWHPDSEYILATSSQDNSVKFWDSRQPRKCLNVLACQVPVWKARYTPFNNGLVTVMVPQLRRENSLLLWNVYDLHSPVHIFVGHDDVVLEFQWRKQKEGLSLKDYQLVTWSRDQTLRMWRVDAQL----QRLCANDIMDPVDELM--DGLSLMPEQEKSLQPQEQI-SGHSE------EDAILK--------------------LYEDCQL------GLPQTLQQEFSLINVHIRNVNIEMDAMNRSCTVSVHCGNHRVRMLVMFPVQYPNNAAPSFQFVTPTTISSAMKAKLLKILKDTSLQKVKRNQSC-LEPCLRQLVSCLESFVNQESSPSS--SPYNLQGPITPPLPTFARVPNAYGSYQDANIPFPRTSGARFCGAGYLVYFTRPMTMHRAVSPTEPTPRSLSALSAYHTGVMAPMNIRTETPGNLRIYSGSPTRSEKEQVSISSFYYKERKSRRWKSKRENSDANSRPI------KAAGKVIIQDISCLLTVHKALGELYILNHRDLQEMCQKNATAALSVGRRDLVQVWALAAAANDVCLSPKSDPDAE--TPWARHPFGRQLLESLLAHYCHLHDVQTLAMLCSVFDA 709          
BLAST of WD repeat-containing protein 59 vs. Ensembl Xenopus
Match: ddb1 (damage-specific DNA binding protein 1 [Source:Xenbase;Acc:XB-GENE-967908])

HSP 1 Score: 112.464 bits (280), Expect = 1.533e-24
Identity = 174/792 (21.97%), Postives = 309/792 (39.02%), Query Frame = 3
Query:   96 FAMNSNGSLGLFCGLYEILLLSFDDPK-RKRKESINKSSDPVLCQWN--KTCNEYFALTQSNVCKIF---DIELKKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDSQGIQLVKWSNVKTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDWSANMN-IIVSCGQDKKLKIWNLEESNQNRILEEDYANYSMCKFDTLDN-IFTLNSSDVPSENFVSFWSIVEFR-KLYSTPPHTNVITDFALIYPTETAC----QFVTLHRNSDLKVWEINRSLVSGKRKRGGSSHVAGLDNSISNDRLFLSPSPDHSVNKSKAIPVGQSESFVNMHKNDILSSIIAHRSDPNLIMRDKSNKSLSEDQEIRVREFEKLSNTNQVTFEKSVDMRSVTAHFNLINLKCSIQF-IYRTSIGDIVFLDVLVLRQRAEK---IRPQNLE-----ELEKILK-TTIDDCRRNNILPIEKC----VDVTLDYLNKLSSRFSLRAIRSLKDQST-PIHSFTSLP-------DVKVPFPRICGASFSPTGLLVCFLSP---EGYMSRFHSAPRSLADISKL-------ANTNSSSKG--FFYEMNKNTTQKQ-------YYKSNI--------------------RKLKSTEFNTETPSRKLSTQSIQKQTHIVLIYNVLQLSLFNVSLAKNYSLKISNAEAMCHKNLSAVTNCNRKDLFEFWQYCAILANGC-KPSCNISAGYIRPWATQSMGRGLCELWMKHFLDINDIQSAAMLVIVMRA 2246
             +++  G L +  G   + +++ + P    RK S     D    QWN  ++   +FA + +    ++   D       SL+ H ++IS +DW     + + T             I    F  +   + G   VKW+   +N  AT+   ++ IWD RK +       AH   I+  DW  +   I+ +  QD  +K W+  +  +   +          ++   +N + T+    +  EN +  W++ +    ++    H +V+ +F      E       Q VT  R+  L++W ++  L    ++   +  +  +D  +  D L L P  + S+   + I  G SE      +             P   M   +++ L   Q ++ +EF  +          +V +R+V    + +N  C++        +  +V   V      A     + P  +      +L KILK T++   +RN    +E C    V     ++N+ SS  S  +  +L+   T P+ +F  +P       D  +PFPR  GA F   G LV F  P      +S     PRSL+ +S          N  + + G    Y  +   ++K+       YYK                       R+ KS   N++  SR +      K    V+I ++  L   + +L + Y L   + + MC KN +A  +  R+DL + W   A   + C  P  +  A    PWA    GR L E  + H+  ++D+Q+ AML  V  A
Sbjct:    1 MSVDCQGQLAVLSGRRFLYIVNLETPTDGHRKISRQSKWDIGTVQWNPHESYAHFFAASSNQRVDLYQWKDGTGDINTSLQGHTRVISDLDWSVFEPDVLVTI------------ILQYHFVFY---AAGASQVKWNKKNSNCLATSHDGDVRIWDRRKPSTAVEYIAAHLYKIHGLDWHPDSEYILATSSQDNSVKFWDSRQPRKCLNVLACQVPVWKARYTPFNNGLVTVMVPQLRRENSLLLWNVYDLHSPVHIFVGHDDVVLEFQWRKQKEGLSLKDYQLVTWSRDQTLRMWRVDAQL----QRLCANDIMDPVDELM--DGLSLMPEQEKSLQPQEQI-SGHSEEDAAFGEE-----------SPTTPMILGTSEQLGLPQTLQ-QEFSLI----------NVHIRNVNIEMDAMNRSCTVSVHCGNHRVRMLVMFPVQYPNNAAPSFQFVTPTTISSAMKAKLLKILKDTSLQKVKRNQSC-LEPCLRQLVSCLESFVNQESSPSS--SPYNLQGPITPPLPTFARVPNAYGSYQDANIPFPRTSGARFCGAGYLVYFTRPMTMHRAVSPTEPTPRSLSALSAYHTGVMAPMNIRTETPGNLRIYSGSPTRSEKEQVSISSFYYKERTPPLSARRRWSIQVINDFPKSRRWKSKRENSDANSRPI------KAAGKVIIQDISCLLTVHKALGELYILNHRDLQEMCQKNATAALSVGRRDLVQVWALAAAANDVCLSPKSDPDAE--TPWARHPFGRQLLESLLAHYCHLHDVQTLAMLCSVFDA 737          
BLAST of WD repeat-containing protein 59 vs. Ensembl Xenopus
Match: ddb1 (damage-specific DNA binding protein 1 [Source:Xenbase;Acc:XB-GENE-967908])

HSP 1 Score: 111.694 bits (278), Expect = 2.676e-24
Identity = 174/784 (22.19%), Postives = 310/784 (39.54%), Query Frame = 3
Query:   96 FAMNSNGSLGLFCGLYEILLLSFDDPK-RKRKESINKSSDPVLCQWN--KTCNEYFALTQSNVCKIF---DIELKKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDSQGIQLVKWSNVKTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDWSANMN-IIVSCGQDKKLKIWNLEESNQNRILEEDYANYSMCKFDTLDN-IFTLNSSDVPSENFVSFWSIVEFR-KLYSTPPHTNVITDFALIYPTETAC----QFVTLHRNSDLKVWEINRSLVSGKRKRGGSSHVAGLDNSISNDRLFLSPSPDHSVNKSKAIPVGQSESFVNMHKNDILSSIIAHRSDPNLIMRDKSNKSLSEDQEIRVREFEKLSNTNQVTFEKSVDMRSVTAHFNLINLKCSIQF-IYRTSIGDIVFLDVLVLRQRAEK---IRPQNLE-----ELEKILK-TTIDDCRRNNILPIEKC----VDVTLDYLNKLSSRFSLRAIRSLKDQSTP-IHSFTSLP-------DVKVPFPRICGASFSPTGLLVCFLSP---EGYMSRFHSAPRSLADISKL-------ANTNSSSKG--FFYEMNKNTTQKQ-------YYKS-NIRKLKSTEFNTETPSRKLSTQSIQKQTHIVLIYNVLQLSLFNVSLAKNYSLKISNAEAMCHKNLSAVTNCNRKDLFEFWQYCAILANGC-KPSCNISAGYIRPWATQSMGRGLCE-----------LWMKHFLDINDIQSAAMLVIVMRA 2246
             +++  G L +  G   + +++ + P    RK S     D    QWN  ++   +FA + +    ++   D       SL+ H ++IS +DW     + + T             I    F  +   + G   VKW+   +N  AT+   ++ IWD RK +       AH   I+  DW  +   I+ +  QD  +K W+  +  +   +          ++   +N + T+    +  EN +  W++ +    ++    H +V+ +F      E       Q VT  R+  L++W ++  L    ++   +  +  +D  +  D L L P  + S+   + I  G SE      +             P   M   +++ L   Q ++ +EF  ++          V +R+V    + +N  C++        +  +V   V      A     + P  +      +L KILK T++   +RN    +E C    V     ++N+ SS  S  +  +L+   TP + +F  +P       D  +PFPR  GA F   G LV F  P      +S     PRSL+ +S          N  + + G    Y  +   ++K+       YYK    R+ KS   N++  SR +      K    V+I ++  L   + +L + Y L   + + MC KN +A  +  R+DL + W   A   + C  P  +  A    PWA    GR L E           + + H+  ++D+Q+ AML  V  A
Sbjct:    1 MSVDCQGQLAVLSGRRFLYIVNLETPTDGHRKISRQSKWDIGTVQWNPHESYAHFFAASSNQRVDLYQWKDGTGDINTSLQGHTRVISDLDWSVFEPDVLVTI------------ILQYHFVFY---AAGASQVKWNKKNSNCLATSHDGDVRIWDRRKPSTAVEYIAAHLYKIHGLDWHPDSEYILATSSQDNSVKFWDSRQPRKCLNVLACQVPVWKARYTPFNNGLVTVMVPQLRRENSLLLWNVYDLHSPVHIFVGHDDVVLEFQWRKQKEGLSLKDYQLVTWSRDQTLRMWRVDAQL----QRLCANDIMDPVDELM--DGLSLMPEQEKSLQPQEQI-SGHSEEDAAFGEES-----------PTTPMILGTSEQLGLPQTLQ-QEFSLIN----------VHIRNVNIEMDAMNRSCTVSVHCGNHRVRMLVMFPVQYPNNAAPSFQFVTPTTISSAMKAKLLKILKDTSLQKVKRNQSC-LEPCLRQLVSCLESFVNQESSPSS--SPYNLQGPITPPLPTFARVPNAYGSYQDANIPFPRTSGARFCGAGYLVYFTRPMTMHRAVSPTEPTPRSLSALSAYHTGVMAPMNIRTETPGNLRIYSGSPTRSEKEQVSISSFYYKERKSRRWKSKRENSDANSRPI------KAAGKVIIQDISCLLTVHKALGELYILNHRDLQEMCQKNATAALSVGRRDLVQVWALAAAANDVCLSPKSDPDAE--TPWARHPFGRQLLESLYGFTLCIGTIVLAHYCHLHDVQTLAMLCSVFDA 729          
BLAST of WD repeat-containing protein 59 vs. Ensembl Mouse
Match: Wdr59 (WD repeat domain 59 [Source:MGI Symbol;Acc:MGI:2442115])

HSP 1 Score: 158.303 bits (399), Expect = 7.832e-39
Identity = 220/1043 (21.09%), Postives = 395/1043 (37.87%), Query Frame = 3
Query:   75 KEIQASSFAMNSNGSLGLFCGLYEILLLSFDDP-KRKRKESINKSSDPVLCQWNK--TCNEYFALTQSNVCKIF---DIELKKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDS-QGIQLVKWSNVKTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDWSANM-NIIVSCGQDKKLKIWNLEESNQNRILEEDYANYSMCKFDTLDNIFT-----LNSSDVPS---ENFVSFWSIVEF-RKLYSTPPHTNVITDFALIYPTETA--CQFVTLHRNSDLKVWEINRSLVSGKRKRGGSSHVAGLDNSISNDRLFLSPSPDHSVNKSKAIPVGQSESFVNMHKNDILSSIIAHRSDPNLIMRDKSNKSLSEDQEIRVREFEKLS-NTNQVTFEKSVDMRSVTAHFNLINLKC----------------SIQFIYRTSIGDIVFLDVL-VLRQRAEKIRPQNLEELEKILKTTI---------DDCRRNNILPIEKCVDVTLDYLNKLSSRFSLRAIRSLKDQSTPIHSFTSLPDVKVPFPRICGASFSPTGLLVCFLSP---EGYMSRFHSAPRSLADISKLAN---------TNSSSKGFFYEMNKNTTQKQ-------YYKS-NIRKLKSTEFNTETPSRKLSTQSIQKQTHIVLIYNVLQLSLFNVSLAKNYSLKISNAEAMCHKNLSAVTNCNRKDLFEFWQYCAILANGC-KPSCNISAGYIRPWATQSMGRGLCELWMKHFLDINDIQSAAMLVIVMRAIDL--DLENNFKENKNNASSISLTSGSHKNISQESLMDNIHSDTLNSNLCVSIFVDGLQKYKIYDDKRNATLIVMEINEGSPGRFRNNSFGEQEITNNLKKGDNLIPDSSLQHFQQNEQIRLIDPAKNLQ-------YNRVLLHYVLMLSAHKLLNFSSKIVQKILPAKFFNLIFGHYNFDVFLLRNCINDHRCKSVYVDPNRLTVICSECPTRTVSVNNQDTSKTPIICSVCRNFVRGLFSVCDQCNHGGH 2975
            ++ QA++ +++  G   +  G   + +++ D P +  RK S     D    QWN   +   YFA + +    ++   D   +   +L+ H ++IS +DW     + + T+S D    + IWDI++++ P+  + +  G   VKW+    N  AT+   ++ IWD RK +       AH   I+  DW  +  +I  +  QD  +K W+  +  +       Y N   C+       +T     L +  VP    EN +  W+  +    +++   H +V+ +F      E +   Q VT  R+  L++W ++  +    ++   +  + G+D  I  + + L P P+ + +      +    S  +  ++ I          P+ ++ +K +  L   Q ++ +EF  ++     V  E     RS T   +  N +                 S QFI  T+I   V   +L +L+  + +   +N   LE  L+  +         +D   +N   ++  V   L    ++++                  ++ S  D  +PFPR  GA F   G LV F  P      +S     PRSL+ +S             T +      Y  +   ++K+       YYK    R+ KS    +++ +R +      K    V+I +V  L   + SL + Y L +++ +  C KN ++     RKDL + W    +  + C  P  +       PWA    GR L E  + H+  + D+Q+ AML  V  A      L N F    N +S++ ++   + + +      ++     N+             + I    R    I     E SP   R   FG    ++  ++          +  Q ++  RL+DPA   Q       Y  +L  + L     ++L F S       P     + FG Y                             CS C +                C++C   VRG  + C  C HGGH
Sbjct:   15 RDSQATAMSVDCLGQHAVLSGRRFLYIVNLDAPFEGHRKISRQSKWDIGAVQWNPHDSFAHYFAASSNQRVDLYKWKDGSGEVGTTLQGHTRVISDLDWAVFEPDLLVTSSVDTY--IYIWDIKDTRKPTVALSAVAGASQVKWNKKNANYLATSHDGDVRIWDKRKPSTAVEYLAAHLSKIHGLDWHPDSEHIFATSSQDNSVKFWDYRQPRK-------YLNILPCQVPVWKARYTPFSNGLVTVMVPQLRRENSLLLWNASDLNAPVHTFVGHDDVVLEFQWRRQKEGSKDYQLVTWSRDQTLRMWRVDYQM----QRLCANDILDGVDEFI--ESISLLPEPEKTPHPQD---IDHQPSLSHGEEDAI------KEDPPSSLLEEKRSDQLGLPQTLQ-QEFSLINVQIRNVNVEMDAADRSCTVSVHCSNHRVKMLVTFPAQYPNNAAPSFQFINPTTITSAVKAKLLKILKDTSLQKVKRNQSCLEPCLRQLVSCLESFVNQEDSASSNPFALQNSVTPPLPTFARVTT------------------AYGSYQDANIPFPRTSGARFCGAGYLVYFTRPMTMHRAVSPTEPTPRSLSALSAYHTGLIAPMKIRTEAPGNLRLYSGSPTRSEKEQVSISSFYYKERKSRRWKSKREGSDSGNRPI------KAAGKVIIQDVSCLLPVHKSLGELYILNVNDTQETCQKNATSAMLVGRKDLVQVWSLATVATDLCLGPKSD--PDLETPWARHPFGRQLLESLLAHYCQLRDVQTLAMLCSVFEAQSRPQGLPNPFGPFPNRSSNLVVSHSRYPSFTSSGSCSSMSDPGFNTG-----------GWNIAG--RETEHISSPWGESSPEELR---FGSLTYSDPRER----------ERDQHDKNKRLLDPANTQQFDDFKKCYGEILYRWGLREKRAEVLKFVS-----CPPDPHKGIEFGVY-----------------------------CSHCRSEVRGTQCAICKGFTFQCAICHVAVRGSSNFCLTCGHGGH 946          
BLAST of WD repeat-containing protein 59 vs. Ensembl Mouse
Match: Wdr59 (WD repeat domain 59 [Source:MGI Symbol;Acc:MGI:2442115])

HSP 1 Score: 152.91 bits (385), Expect = 3.868e-37
Identity = 220/1062 (20.72%), Postives = 396/1062 (37.29%), Query Frame = 3
Query:   75 KEIQASSFAMNSNGSLGLFCGLYEILLLSFDDP-KRKRKESINKSSDPVLCQWNK--TCNEYFALTQSNVCKIF---DIELKKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDS-QGIQLVKWSNVKTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDWSANM-NIIVSCGQDKKLKIWNLEESNQNRILEEDYANYSMCKFDTLDNIFT-----LNSSDVPS---ENFVSFWSIVEF-RKLYSTPPHTNVITDFALIYPTETA--CQFVTLHRNSDLKVWEINRSLVSGKRKRGGSSHVAGLDNSISNDRLFLSPSPDHSVNKSKAIPVGQSESFVNMHKNDILSSIIAHRSDPNLIMRDKSNKSLSEDQEIRVREFEKLS-NTNQVTFEKSVDMRSVTAHFNLINLKC----------------SIQFIYRTSIGDIVFLDVL-VLRQRAEKIRPQNLEELEKILKTTI---------DDCRRNNILPIEKCVDVTLDYLNKLSSRFSLRAIRSLKDQSTPIHSFTSLPDVKVPFPRICGASFSPTGLLVCFLSP---EGYMSRFHSAPRSLADISKLAN---------TNSSSKGFFYEMNKNTTQKQ-------YYKSNI--------------------RKLKSTEFNTETPSRKLSTQSIQKQTHIVLIYNVLQLSLFNVSLAKNYSLKISNAEAMCHKNLSAVTNCNRKDLFEFWQYCAILANGC-KPSCNISAGYIRPWATQSMGRGLCELWMKHFLDINDIQSAAMLVIVMRAIDL--DLENNFKENKNNASSISLTSGSHKNISQESLMDNIHSDTLNSNLCVSIFVDGLQKYKIYDDKRNATLIVMEINEGSPGRFRNNSFGEQEITNNLKKGDNLIPDSSLQHFQQNEQIRLIDPAKNLQ-------YNRVLLHYVLMLSAHKLLNFSSKIVQKILPAKFFNLIFGHYNFDVFLLRNCINDHRCKSVYVDPNRLTVICSECPTRTVSVNNQDTSKTPIICSVCRNFVRGLFSVCDQCNHGGH 2975
            ++ QA++ +++  G   +  G   + +++ D P +  RK S     D    QWN   +   YFA + +    ++   D   +   +L+ H ++IS +DW     + + T+S D    + IWDI++++ P+  + +  G   VKW+    N  AT+   ++ IWD RK +       AH   I+  DW  +  +I  +  QD  +K W+  +  +       Y N   C+       +T     L +  VP    EN +  W+  +    +++   H +V+ +F      E +   Q VT  R+  L++W ++  +    ++   +  + G+D  I  + + L P P+ + +      +    S  +  ++ I          P+ ++ +K +  L   Q ++ +EF  ++     V  E     RS T   +  N +                 S QFI  T+I   V   +L +L+  + +   +N   LE  L+  +         +D   +N   ++  V   L    ++++                  ++ S  D  +PFPR  GA F   G LV F  P      +S     PRSL+ +S             T +      Y  +   ++K+       YYK  +                    R+ KS    +++ +R +      K    V+I +V  L   + SL + Y L +++ +  C KN ++     RKDL + W    +  + C  P  +       PWA    GR L E  + H+  + D+Q+ AML  V  A      L N F    N +S++ ++   + + +      ++     N+             + I    R    I     E SP   R   FG    ++  ++          +  Q ++  RL+DPA   Q       Y  +L  + L     ++L F S       P     + FG Y                             CS C +                C++C   VRG  + C  C HGGH
Sbjct:   15 RDSQATAMSVDCLGQHAVLSGRRFLYIVNLDAPFEGHRKISRQSKWDIGAVQWNPHDSFAHYFAASSNQRVDLYKWKDGSGEVGTTLQGHTRVISDLDWAVFEPDLLVTSSVDTY--IYIWDIKDTRKPTVALSAVAGASQVKWNKKNANYLATSHDGDVRIWDKRKPSTAVEYLAAHLSKIHGLDWHPDSEHIFATSSQDNSVKFWDYRQPRK-------YLNILPCQVPVWKARYTPFSNGLVTVMVPQLRRENSLLLWNASDLNAPVHTFVGHDDVVLEFQWRRQKEGSKDYQLVTWSRDQTLRMWRVDYQM----QRLCANDILDGVDEFI--ESISLLPEPEKTPHPQD---IDHQPSLSHGEEDAI------KEDPPSSLLEEKRSDQLGLPQTLQ-QEFSLINVQIRNVNVEMDAADRSCTVSVHCSNHRVKMLVTFPAQYPNNAAPSFQFINPTTITSAVKAKLLKILKDTSLQKVKRNQSCLEPCLRQLVSCLESFVNQEDSASSNPFALQNSVTPPLPTFARVTT------------------AYGSYQDANIPFPRTSGARFCGAGYLVYFTRPMTMHRAVSPTEPTPRSLSALSAYHTGLIAPMKIRTEAPGNLRLYSGSPTRSEKEQVSISSFYYKERMSPRSARRRWSIQAINDFPKSRRWKSKREGSDSGNRPI------KAAGKVIIQDVSCLLPVHKSLGELYILNVNDTQETCQKNATSAMLVGRKDLVQVWSLATVATDLCLGPKSD--PDLETPWARHPFGRQLLESLLAHYCQLRDVQTLAMLCSVFEAQSRPQGLPNPFGPFPNRSSNLVVSHSRYPSFTSSGSCSSMSDPGFNTG-----------GWNIAG--RETEHISSPWGESSPEELR---FGSLTYSDPRER----------ERDQHDKNKRLLDPANTQQFDDFKKCYGEILYRWGLREKRAEVLKFVS-----CPPDPHKGIEFGVY-----------------------------CSHCRSEVRGTQCAICKGFTFQCAICHVAVRGSSNFCLTCGHGGH 965          
BLAST of WD repeat-containing protein 59 vs. Ensembl Mouse
Match: Wdr59 (WD repeat domain 59 [Source:MGI Symbol;Acc:MGI:2442115])

HSP 1 Score: 152.525 bits (384), Expect = 5.172e-37
Identity = 221/1061 (20.83%), Postives = 397/1061 (37.42%), Query Frame = 3
Query:   75 KEIQASSFAMNSNGSLGLFCGLYEILLLSFDDP-KRKRKESINKSSDPVLCQWNK--TCNEYFALTQSNVCKIF---DIELKKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDS-QGIQLVKWSNVKTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDWSANM-NIIVSCGQDKKLKIWNLEESNQNRILEEDYANYSMCKFDTLDNIFT-----LNSSDVPS---ENFVSFWSIVEF-RKLYSTPPHTNVITDFALIYPTETA--CQFVTLHRNSDLKVWEINRSLVSGKRKRGGSSHVAGLDNSISNDRLFLSPSPDHSVNKSKAIPVGQSESFVNMHKNDILSSIIAHRSDPNLIMRDKSNKSLSEDQEIRVREFEKLS-NTNQVTFEKSVDMRSVTAHFNLINLKC----------------SIQFIYRTSIGDIVFLDVL-VLRQRAEKIRPQNLEELEKILKTTI---------DDCRRNNILPIEKCVDVTLDYLNKLSSRFSLRAIRSLKDQSTPIHSFTSLPDVKVPFPRICGASFSPTGLLVCFLSP---EGYMSRFHSAPRSLADISKLAN---------TNSSSKGFFYEMNKNTTQKQ-------YYKS-NIRKLKSTEFNTETPSRKLSTQSIQKQTHIVLIYNVLQLSLFNVSLAKNYSLKISNAEAMCHKNLSAVTNCNRKDLFEFWQYCAILANGC-KPSCNISAGYIRPWATQSMGRGLCE-LW-----------------MKHFLDINDIQSAAMLVIVMRAIDL--DLENNFKENKNNASSISLTSGSHKNISQESLMDNIHSDTLNSNLCVSIFVDGLQKYKIYDDKRNATLIVMEINEGSPGRFRNNSFGEQEITNNLKKGDNLIPDSSLQHFQQNEQIRLIDPAKNLQ-------YNRVLLHYVLMLSAHKLLNFSSKIVQKILPAKFFNLIFGHYNFDVFLLRNCINDHRCKSVYVDPNRLTVICSECPTRTVSVNNQDTSKTPIICSVCRNFVRGLFSVCDQCNHGGH 2975
            ++ QA++ +++  G   +  G   + +++ D P +  RK S     D    QWN   +   YFA + +    ++   D   +   +L+ H ++IS +DW     + + T+S D    + IWDI++++ P+  + +  G   VKW+    N  AT+   ++ IWD RK +       AH   I+  DW  +  +I  +  QD  +K W+  +  +       Y N   C+       +T     L +  VP    EN +  W+  +    +++   H +V+ +F      E +   Q VT  R+  L++W ++  +    ++   +  + G+D  I  + + L P P+ + +      +    S  +  ++ I          P+ ++ +K +  L   Q ++ +EF  ++     V  E     RS T   +  N +                 S QFI  T+I   V   +L +L+  + +   +N   LE  L+  +         +D   +N   ++  V   L    ++++                  ++ S  D  +PFPR  GA F   G LV F  P      +S     PRSL+ +S             T +      Y  +   ++K+       YYK    R+ KS    +++ +R +      K    V+I +V  L   + SL + Y L +++ +  C KN ++     RKDL + W    +  + C  P  +       PWA    GR L E LW                 + H+  + D+Q+ AML  V  A      L N F    N +S++ ++   + + +      ++     N+                ++  R    I     E SP   R   FG    ++  ++          +  Q ++  RL+DPA   Q       Y  +L  + L     ++L F S       P     + FG Y                             CS C +                C++C   VRG  + C  C HGGH
Sbjct:   15 RDSQATAMSVDCLGQHAVLSGRRFLYIVNLDAPFEGHRKISRQSKWDIGAVQWNPHDSFAHYFAASSNQRVDLYKWKDGSGEVGTTLQGHTRVISDLDWAVFEPDLLVTSSVDTY--IYIWDIKDTRKPTVALSAVAGASQVKWNKKNANYLATSHDGDVRIWDKRKPSTAVEYLAAHLSKIHGLDWHPDSEHIFATSSQDNSVKFWDYRQPRK-------YLNILPCQVPVWKARYTPFSNGLVTVMVPQLRRENSLLLWNASDLNAPVHTFVGHDDVVLEFQWRRQKEGSKDYQLVTWSRDQTLRMWRVDYQM----QRLCANDILDGVDEFI--ESISLLPEPEKTPHPQD---IDHQPSLSHGEEDAI------KEDPPSSLLEEKRSDQLGLPQTLQ-QEFSLINVQIRNVNVEMDAADRSCTVSVHCSNHRVKMLVTFPAQYPNNAAPSFQFINPTTITSAVKAKLLKILKDTSLQKVKRNQSCLEPCLRQLVSCLESFVNQEDSASSNPFALQNSVTPPLPTFARVTT------------------AYGSYQDANIPFPRTSGARFCGAGYLVYFTRPMTMHRAVSPTEPTPRSLSALSAYHTGLIAPMKIRTEAPGNLRLYSGSPTRSEKEQVSISSFYYKERKSRRWKSKREGSDSGNRPI------KAAGKVIIQDVSCLLPVHKSLGELYILNVNDTQETCQKNATSAMLVGRKDLVQVWSLATVATDLCLGPKSD--PDLETPWARHPFGRQLLESLWGDRESTRVCGPPLSGARLAHYCQLRDVQTLAMLCSVFEAQSRPQGLPNPFGPFPNRSSNLVVSHSRYPSFTSSGSCSSMSDPGFNTG--------------GWNIGRETEHISSPWGESSPEELR---FGSLTYSDPRER----------ERDQHDKNKRLLDPANTQQFDDFKKCYGEILYRWGLREKRAEVLKFVS-----CPPDPHKGIEFGVY-----------------------------CSHCRSEVRGTQCAICKGFTFQCAICHVAVRGSSNFCLTCGHGGH 963          
BLAST of WD repeat-containing protein 59 vs. Ensembl Mouse
Match: Rbbp4 (retinoblastoma binding protein 4, chromatin remodeling factor [Source:MGI Symbol;Acc:MGI:1194912])

HSP 1 Score: 60.8474 bits (146), Expect = 5.717e-9
Identity = 39/136 (28.68%), Postives = 70/136 (51.47%), Query Frame = 3
Query:  321 AHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIR--NSKFPSHKIDSQGIQLVKWSNVKTNSF--ATTSSEE-IMIWDDRKLTAPTHIFEAHNGNINDFDWSA-NMNIIVSCGQDKKLKIWNLEESNQNRILEE 710
             H  ++  + WH  +++   + ++D  + L IWD R  N+  PSH +D+   ++   S    + F  AT S+++ + +WD R L    H FE+H   I    WS  N  I+ S G D++L +W+L +  + +  E+
Sbjct:  225 GHTAVVEDVSWHLLHESLFGSVADD--QKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPED 358          

HSP 2 Score: 52.373 bits (124), Expect = 2.122e-6
Identity = 33/133 (24.81%), Postives = 66/133 (49.62%), Query Frame = 3
Query:  315 LKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDSQGI--------QLVKWSNVKTNSFATTSSEE-IMIWDDRK--LTAPTHIFEAHNGNINDFDWSANMNIIVSCG-QDKKLKIWNL 677
            L+ H K    + W+P+    + +AS+D+  ++C+WDI         +D++ I        + V W  +  + F + + ++ +MIWD R    + P+H  +AH   +N   ++     I++ G  DK + +W+L
Sbjct:  173 LRGHQKEGYGLSWNPNLSGHLLSASDDH--TICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDL 303          

HSP 3 Score: 50.447 bits (119), Expect = 9.182e-6
Identity = 37/145 (25.52%), Postives = 71/145 (48.97%), Query Frame = 3
Query:  300 KKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDSQGIQL--VKWSNVKTNSFATTSSEEIM-IWDDRKLT----------APTHIFEAHNGN---INDFDWSANMN-IIVSCGQDKKLKIWNLEE 683
            K   S+ AH   ++ + ++P ++  +AT S D  K++ +WD+RN K   H  +S   ++  V+WS       A++ ++  + +WD  K+            P  +   H G+   I+DF W+ N   +I S  +D  +++W + E
Sbjct:  264 KPSHSVDAHTAEVNCLSFNPYSEFILATGSAD--KTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAE 406          
BLAST of WD repeat-containing protein 59 vs. Ensembl Mouse
Match: Rbbp7 (retinoblastoma binding protein 7, chromatin remodeling factor [Source:MGI Symbol;Acc:MGI:1194910])

HSP 1 Score: 60.077 bits (144), Expect = 8.638e-9
Identity = 38/136 (27.94%), Postives = 71/136 (52.21%), Query Frame = 3
Query:  321 AHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRN--SKFPSHKIDSQGIQLVKWSNVKTNSF--ATTSSEE-IMIWDDRKLTAPTHIFEAHNGNINDFDWSA-NMNIIVSCGQDKKLKIWNLEESNQNRILEE 710
             H+ ++  + WH  +++   + ++D  + L IWD R+  +  PSH +D+   ++   S    + F  AT S+++ + +WD R L    H FE+H   I    WS  N  I+ S G D++L +W+L +  + +  E+
Sbjct:  224 GHSAVVEDVAWHLLHESLFGSVADD--QKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAED 357          

HSP 2 Score: 53.5286 bits (127), Expect = 1.008e-6
Identity = 33/133 (24.81%), Postives = 66/133 (49.62%), Query Frame = 3
Query:  315 LKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDSQGI--------QLVKWSNVKTNSFATTSSEE-IMIWDDRKLTA--PTHIFEAHNGNINDFDWSANMNIIVSCG-QDKKLKIWNL 677
            L+ H K    + W+ +    + +AS+D+  ++C+WDI         +D++ I        + V W  +  + F + + ++ +MIWD R  T   P+H+ +AH   +N   ++     I++ G  DK + +W+L
Sbjct:  172 LRGHQKEGYGLSWNSNLSGHLLSASDDH--TVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDL 302          
BLAST of WD repeat-containing protein 59 vs. UniProt/SwissProt
Match: sp|Q6PJI9|WDR59_HUMAN (GATOR complex protein WDR59 OS=Homo sapiens OX=9606 GN=WDR59 PE=1 SV=2)

HSP 1 Score: 170.244 bits (430), Expect = 8.889e-42
Identity = 224/1055 (21.23%), Postives = 401/1055 (38.01%), Query Frame = 3
Query:   75 KEIQASSFAMNSNGSLGLFCGLYEILLLSFDDP-KRKRKESINKSSDPVLCQWNK--TCNEYFALTQSNVCKIF---DIELKKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDS-QGIQLVKWSNVKTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDWSANM-NIIVSCGQDKKLKIWNLEESNQNRILEEDYANYSMCKFDTLDNIFT-----LNSSDVPS---ENFVSFWSIVEFRKLYSTPPHT-----NVITDFALIYPTETA--CQFVTLHRNSDLKVWEINRSLVSGKRKRGGSSHVAGLDNSISNDRLFLSPSPDHSVNKSKAIPVGQSESFVNMHKNDILSSIIAHRSDPNLIMRDKSNKSLSEDQEIRVREFEKLS-NTNQVTFEKSVDMRSVTAHFNLINLKC----------------SIQFIYRTSIGDIVFLDVL-VLRQRAEKIRPQNLEELEKILKTTI---------DDCRRNNILPIEKCVDVTLDYLNKLSSRFSLRAIRSLKDQSTPIHSFTSLPDVKVPFPRICGASFSPTGLLVCFLSP---EGYMSRFHSAPRSLADISKLAN---------TNSSSKGFFYEMNKNTTQKQ-------YYKS-NIRKLKSTEFNTETPSRKLSTQSIQKQTHIVLIYNVLQLSLFNVSLAKNYSLKISNAEAMCHKNLSAVTNCNRKDLFEFWQYCAILANGC-KPSCNISAGYIRPWATQSMGRGLCELWMKHFLDINDIQSAAMLVIVMRAIDL--DLENNFKENKNNASSISLTSGSHKNISQESLMDNIHSDTLNSNLCVSIFVDGLQKYKIYDDKRNATLIVMEINEGSPGRFRNNSFGEQEITNNLKKGDNLIPDSSLQHFQQNEQIRLIDPAKNLQ-------YNRVLLHYVLMLSAHKLLNFSSKIVQKILPAKFFNLIFGHYNFDVFLLRNCINDHRCKSVYVDPNRLTVICSECPTRTVSVNNQDTSKTPIICSVCRNFVRGLFSVCDQCNHGGHADHLNSWF 2999
            ++ QA++ +++  G   +  G   + +++ D P +  RK S     D    QWN   +   YFA + +    ++   D   +   +L+ H ++IS +DW     + + T+S D    + IWDI++++ P+  + +  G   VKW+    N  AT+   ++ IWD RK +       AH   I+  DW  +  +I+ +  QD  +K W+  +  +       Y N   C+       +T     L +  VP    EN +  W++ +     +TP HT     +V+ +F      E +   Q VT  R+  L++W ++  +    ++   +  + G+D  I  + + L P P+ +++         +E   + H              P  ++ ++ +  L   Q ++ +EF  ++     V  E     RS T   +  N +                 S QFI  T+I   +   +L +L+  A +   +    LE  L+  +         +D   +N   +   V   L    ++++                  ++ S  D  +PFPR  GA F   G LV F  P      +S     PRSL+ +S             T +      Y  +   ++K+       YYK    R+ KS    +++ +R++      K    V+I ++  L   + SL + Y L +++ +  C KN ++     RKDL + W    +  + C  P  +       PWA    GR L E  + H+  + D+Q+ AML  V  A      L N F    N +S++ ++   + + +      ++    LN+             + I    R A  +     E SP   R   FG    ++  ++          +  Q ++  RL+DPA   Q       Y  +L  + L     ++L F S       P     + FG Y                             CS C +                C++C   VRG  + C  C HGGH  H+  WF
Sbjct:   15 RDSQATAMSVDCLGQHAVLSGRRFLYIVNLDAPFEGHRKISRQSKWDIGAVQWNPHDSFAHYFAASSNQRVDLYKWKDGSGEVGTTLQGHTRVISDLDWAVFEPDLLVTSSVDTY--IYIWDIKDTRKPTVALSAVAGASQVKWNKKNANCLATSHDGDVRIWDKRKPSTAVEYLAAHLSKIHGLDWHPDSEHILATSSQDNSVKFWDYRQPRK-------YLNILPCQVPVWKARYTPFSNGLVTVMVPQLRRENSLLLWNVFDL----NTPVHTFVGHDDVVLEFQWRKQKEGSKDYQLVTWSRDQTLRMWRVDSQM----QRLCANDILDGVDEFI--ESISLLPEPEKTLH---------TEDTDHQHTASHGEEEALKEDPPRNLLEERKSDQLGLPQTLQ-QEFSLINVQIRNVNVEMDAADRSCTVSVHCSNHRVKMLVKFPAQYPNNAAPSFQFINPTTITSTMKAKLLKILKDTALQKVKRGQSCLEPCLRQLVSCLESFVNQEDSASSNPFALPNSVTPPLPTFARVTT------------------AYGSYQDANIPFPRTSGARFCGAGYLVYFTRPMTMHRAVSPTEPTPRSLSALSAYHTGLIAPMKIRTEAPGNLRLYSGSPTRSEKEQVSISSFYYKERKSRRWKSKREGSDSGNRQI------KAAGKVIIQDIACLLPVHKSLGELYILNVNDIQETCQKNAASALLVGRKDLVQVWSLATVATDLCLGPKSD--PDLETPWARHPFGRQLLESLLAHYCRLRDVQTLAMLCSVFEAQSRPQGLPNPFGPFPNRSSNLVVSHSRYPSFTSSGSCSSMSDPGLNTG-----------GWNIAG--REAEHLSSPWGESSPEELR---FGSLTYSDPRER----------ERDQHDKNKRLLDPANTQQFDDFKKCYGEILYRWGLREKRAEVLKFVS-----CPPDPHKGIEFGVY-----------------------------CSHCRSEVRGTQCAICKGFTFQCAICHVAVRGSSNFCLTCGHGGHTSHMMEWF 954          
BLAST of WD repeat-containing protein 59 vs. UniProt/SwissProt
Match: sp|Q5ZLG9|WDR59_CHICK (GATOR complex protein WDR59 OS=Gallus gallus OX=9031 GN=WDR59 PE=2 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 1.951e-36
Identity = 186/797 (23.34%), Postives = 326/797 (40.90%), Query Frame = 3
Query:   75 KEIQASSFAMNSNGSLGLFCGLYEILLLSFDDP-KRKRKESINKSSDPVLCQWNK--TCNEYFALTQSNVCKIFDIELKKFQ---SLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDS-QGIQLVKWSNVKTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDWSA-NMNIIVSCGQDKKLKIWNLEESNQNRILEEDYANYSMCKFDTLDNIFT-----LNSSDVPS---ENFVSFWSIVEFRKLYSTPPHT-----NVITDFALIYPTETA--CQFVTLHRNSDLKVWEINRSLVSGKRKRGGSSHVAGLDNSISNDRLFLSPSPDHSVNKSKAIPV-----GQSESFVNMHKNDILSSIIAHRSDPNLIMRDKSNKSLSEDQEIRVREFEKLSNTNQVTFEKSVDMRSVTAHFNLINLKCSIQF-IYRTSIGDIVFLDVLVLRQRAEK---IRPQNL-----EELEKILK-TTIDDCRRNNILPIEKCVDVTLDYLNKLSSR---FSLRAIRSLKDQSTPIHSFT-------SLPDVKVPFPRICGASFSPTGLLVCFLSP---EGYMSRFHSAPRSLADISKLAN---------TNSSSKGFFYEMNKNTTQKQ-------YYKS-NIRKLKSTEFNTETPSRKLSTQSIQKQTHIVLIYNVLQLSLFNVSLAKNYSLKISNAEAMCHKNLSAVTNCNRKDLFEFWQYCAILANGC-----KPSCNISAGYIRPWATQSMGRGLCELWMKHFLDINDIQSAAMLVIVMRA 2246
            ++ QA++ +++  G   +  G   + +++ D P +  RK S     D    QWN   +   YFA + +    ++  +    +   SL+ H ++IS +DW     + + T+S D    + IWDI++++ P+  + +  G   VKW+    N  AT+   ++ IWD RK +       AH   I+  DW   N   + +  QD  ++ W+  +  +       Y N   C+       +T     L +  VP    EN +  W++ +     +TP HT     +V+ +F      E +   Q VT  R+  L++W I+  L    ++   +  + G+D+ I  D + L P PD ++    + P      G  E+     K D L          N ++  K    L   Q ++ +EF  +          +V +R+V    + +N  C++        +  +V   V      A     I P ++      +L KILK T++   +RN    +E C+   + +L  + ++    S          +TP+ +F        S  D  +PFPR  GA F   G LV F  P      +S     PRSL+ +S   +         T +      Y  +   ++K+       YYK    R+ KS    T+  +R +      K    V+I ++  L   +  L + Y L ++N +  C KN ++     R+DL + W    +  + C      P   I      PWA    GR L E  + H+  ++D+Q+ AML  V  A
Sbjct:   15 RDAQATAMSVDCLGQHAVLSGRRFLYIVNLDAPNEGHRKISRQSKWDIGAVQWNPHDSYAYYFAASSNQRVDLYKWKEGNGEVCTSLQGHTRVISDLDWSVFEPDLLVTSSVDTY--IYIWDIKDTRKPTVSLSAVAGASQVKWNKKNANCLATSHDGDVRIWDKRKPSTAVEYLAAHLSKIHGLDWHPDNEYTLATSSQDNSVRFWDYRQPRK-------YLNILPCQVPVWKARYTPFSNGLVTVMVPQLRRENSLLLWNVFDL----NTPVHTFVGHDDVVLEFQWRKQKEGSKDYQLVTWSRDQTLRMWRIDSQL----QRLCANDILDGVDDLI--DGISLLPEPDKALQPQDSEPQHSSGHGDEEAL----KEDFL----------NDLLVGKKTDQLGLPQTLQ-QEFSLI----------NVQIRNVNVEMDAVNRSCTVSVHCGNHRVRMLVMFPVQYPNNAAPSFQFINPTSITASMKAKLLKILKDTSLQKVKRNQSC-LEPCLRQLVSWLESVVNQEDSTSSNPYALPNSVTTPLPTFARVSNAYGSYQDSNIPFPRTSGARFCGAGYLVYFTRPMTMHRAVSPTEPTPRSLSALSAYHSGLITPMKIRTETPGNLRLYSGSPTRSEKEQVSISSFYYKERKSRRWKSKREGTDANNRPI------KAAGKVIIQDISCLLPVHKLLGELYILNVNNIQETCQKNAASAMAVGRRDLVQVWSLAMVATDLCLGPKSDPDLEI------PWAQHPFGRQLLESLLAHYSQLHDVQTLAMLCSVFEA 754          
BLAST of WD repeat-containing protein 59 vs. UniProt/SwissProt
Match: sp|Q8C0M0|WDR59_MOUSE (GATOR complex protein WDR59 OS=Mus musculus OX=10090 GN=Wdr59 PE=1 SV=2)

HSP 1 Score: 151.754 bits (382), Expect = 6.041e-36
Identity = 222/1061 (20.92%), Postives = 397/1061 (37.42%), Query Frame = 3
Query:   75 KEIQASSFAMNSNGSLGLFCGLYEILLLSFDDP-KRKRKESINKSSDPVLCQWNK--TCNEYFALTQSNVCKIF---DIELKKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDS-QGIQLVKWSNVKTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDWSANM-NIIVSCGQDKKLKIWNLEESNQNRILEEDYANYSMCKFDTLDNIFT-----LNSSDVPS---ENFVSFWSIVEF-RKLYSTPPHTNVITDFALIYPTETA--CQFVTLHRNSDLKVWEINRSLVSGKRKRGGSSHVAGLDNSISNDRLFLSPSPDHSVNKSKAIPVGQSESFVNMHKNDILSSIIAHRSDPNLIMRDKSNKSLSEDQEIRVREFEKLS-NTNQVTFEKSVDMRSVTAHFNLINLKC----------------SIQFIYRTSIGDIVFLDVL-VLRQRAEKIRPQNLEELEKILKTTI---------DDCRRNNILPIEKCVDVTLDYLNKLSSRFSLRAIRSLKDQSTPIHSFTSLPDVKVPFPRICGASFSPTGLLVCFLSP---EGYMSRFHSAPRSLADISKLAN---------TNSSSKGFFYEMNKNTTQKQ-------YYKS-NIRKLKSTEFNTETPSRKLSTQSIQKQTHIVLIYNVLQLSLFNVSLAKNYSLKISNAEAMCHKNLSAVTNCNRKDLFEFWQYCAILANGC-KPSCNISAGYIRPWATQSMGRGLCE-LW-----------------MKHFLDINDIQSAAMLVIVMRAIDL--DLENNFKENKNNASSISLTSGSHKNISQESLMDNIHSDTLNSNLCVSIFVDGLQKYKIYDDKRNATLIVMEINEGSPGRFRNNSFGEQEITNNLKKGDNLIPDSSLQHFQQNEQIRLIDPAKNLQ-------YNRVLLHYVLMLSAHKLLNFSSKIVQKILPAKFFNLIFGHYNFDVFLLRNCINDHRCKSVYVDPNRLTVICSECPTRTVSVNNQDTSKTPIICSVCRNFVRGLFSVCDQCNHGGH 2975
            ++ QA++ +++  G   +  G   + +++ D P +  RK S     D    QWN   +   YFA + +    ++   D   +   +L+ H ++IS +DW     + + T+S D    + IWDI++++ P+  + +  G   VKW+    N  AT+   ++ IWD RK +       AH   I+  DW  +  +I  +  QD  +K W+  +  +       Y N   C+       +T     L +  VP    EN +  W+  +    +++   H +V+ +F      E +   Q VT  R+  L++W ++  +    ++   +  + G+D  I  + + L P P+ + +      +    S  +  ++ I          P+ ++ +K +  L   Q ++ +EF  ++     V  E     RS T   +  N +                 S QFI  T+I   V   +L +L+  + +   +N   LE  L+  +         +D   +N   ++  V   L    ++++                  ++ S  D  +PFPR  GA F   G LV F  P      +S     PRSL+ +S             T +      Y  +   ++K+       YYK    R+ KS    +++ +R +      K    V+I +V  L   + SL + Y L +++ +  C KN ++     RKDL + W    +  + C  P  +       PWA    GR L E LW                 + H+  + D+Q+ AML  V  A      L N F    N +S++ ++   + + +      ++     N+             + I    R    I     E SP   R   FG    ++  ++          +  Q ++  RL+DPA   Q       Y  +L  + L     ++L F S       P     + FG Y                             CS C +                C++C   VRG  + C  C HGGH
Sbjct:   15 RDSQATAMSVDCLGQHAVLSGRRFLYIVNLDAPFEGHRKISRQSKWDIGAVQWNPHDSFAHYFAASSNQRVDLYKWKDGSGEVGTTLQGHTRVISDLDWAVFEPDLLVTSSVDTY--IYIWDIKDTRKPTVALSAVAGASQVKWNKKNANYLATSHDGDVRIWDKRKPSTAVEYLAAHLSKIHGLDWHPDSEHIFATSSQDNSVKFWDYRQPRK-------YLNILPCQVPVWKARYTPFSNGLVTVMVPQLRRENSLLLWNASDLNAPVHTFVGHDDVVLEFQWRRQKEGSKDYQLVTWSRDQTLRMWRVDYQM----QRLCANDILDGVDEFI--ESISLLPEPEKTPHPQD---IDHQPSLSHGEEDAI------KEDPPSSLLEEKRSDQLGLPQTLQ-QEFSLINVQIRNVNVEMDAADRSCTVSVHCSNHRVKMLVTFPAQYPNNAAPSFQFINPTTITSAVKAKLLKILKDTSLQKVKRNQSCLEPCLRQLVSCLESFVNQEDSASSNPFALQNSVTPPLPTFARVTT------------------AYGSYQDANIPFPRTSGARFCGAGYLVYFTRPMTMHRAVSPTEPTPRSLSALSAYHTGLIAPMKIRTEAPGNLRLYSGSPTRSEKEQVSISSFYYKERKSRRWKSKREGSDSGNRPI------KAAGKVIIQDVSCLLPVHKSLGELYILNVNDTQETCQKNATSAMLVGRKDLVQVWSLATVATDLCLGPKSD--PDLETPWARHPFGRQLLESLWGDRESTRVCGPPLSGARLAHYCQLRDVQTLAMLCSVFEAQSRPQGLPNPFGPFPNRSSNLVVSHSRYPSFTSSGSCSSMSDPGFNTG-----------GWNIAG--RETEHISSPWGESSPEELR---FGSLTYSDPRER----------ERDQHDKNKRLLDPANTQQFDDFKKCYGEILYRWGLREKRAEVLKFVS-----CPPDPHKGIEFGVY-----------------------------CSHCRSEVRGTQCAICKGFTFQCAICHVAVRGSSNFCLTCGHGGH 964          
BLAST of WD repeat-containing protein 59 vs. UniProt/SwissProt
Match: sp|Q9VKK2|WDR59_DROME (GATOR complex protein Wdr59 OS=Drosophila melanogaster OX=7227 GN=Wdr59 PE=1 SV=3)

HSP 1 Score: 84.3445 bits (207), Expect = 3.494e-15
Identity = 80/317 (25.24%), Postives = 143/317 (45.11%), Query Frame = 3
Query:   75 KEIQASSFAMNSNGSLGLFCGLYEILL--LSFDDPKRKRKESINKSSDPV----LCQWNKTCNEYFALTQS---NVCKIFDIELKKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDS---QGIQLVKWSNVKTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDWSANM-NIIVSCGQDKKLKIWNLEESNQNRILEEDYANYSMCKFDTLDNIFTLNSSDVP----SENFVSFWS-IVEFRKLYSTPPHTNVITDFALIYPTETA--CQFVTLHRNSDLKVWEINRSLV 965
            ++ QA++ +++ +G   L  G   + L  L  DD   +R E  +K    V    +C   K   EY A+  S   ++ +    E     SL+ H + ++ IDWH  + N + + S D      IWD+R  + P+  +++    G   V ++ V  N  A     ++ IWD RK + PTH   AH   ++  +WS      + +  QD  +K +++    +   +    +     ++  + N   L S  VP     EN +  WS   +   + S   HT+VI DFA     E++   + VT  R+  L+VW+I+ +++
Sbjct:   39 RDSQATAMSVDYSGQWVLLAGRGHLALQRLGQDDGSLRRHERQSKYEVSVAEFAICPSRK---EYCAIATSQHIDIVRWGTAEPHYEMSLRGHTRTVTDIDWHGKDPNLLVSCSIDTFSH--IWDLREPRKPALSLNAVCMSGATQVGFNRVSGNLLAAAHDGDLRIWDIRKGSCPTHYITAHLNRVHGINWSHKRETCLATASQDGTVKYFDVCNPRRAEKIITTMSPVWRARYTPIGN--GLVSIVVPHLGRGENSLLLWSNSKQTDPICSFVGHTDVILDFAWRPNRESSNEIELVTWSRDRTLRVWKIDDNML 348          
BLAST of WD repeat-containing protein 59 vs. UniProt/SwissProt
Match: sp|O22469|MSI3_ARATH (WD-40 repeat-containing protein MSI3 OS=Arabidopsis thaliana OX=3702 GN=MSI3 PE=1 SV=2)

HSP 1 Score: 73.1738 bits (178), Expect = 4.142e-12
Identity = 56/225 (24.89%), Postives = 100/225 (44.44%), Query Frame = 3
Query:  297 LKKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSH-KIDSQGIQLVKWSNVKTNSFATTSSEE-IMIWDDRKLTAPTHIFEAHNGNINDFDWSANM-NIIVSCGQDKKLKIWNLEESNQNRILEEDYANYSMCKFDTLDNIFTLNSSDVPSENFVSFWSIVEFRKLYSTPPHTNVITDFALIYPTETACQFVTLHRNSDLKVWEINRSL 962
            L      + H  II  + WH  N+N   +A +D    L IWD+R ++     K+  + I  + ++       AT SS+  + ++D RKLTAP H+   H G +   +W  N   ++ S G+D++L +W++     NR+ +E                  L++ D P E             L+S   H   I+DFA  +  +      ++  ++ L+VW++  S+
Sbjct:  208 LNPMHVYEGHQSIIEDVAWHMKNENIFGSAGDDCQ--LVIWDLRTNQMQHQVKVHEREINYLSFNPFNEWVLATASSDSTVALFDLRKLTAPLHVLSKHEGEVFQVEWDPNHETVLASSGEDRRLMVWDI-----NRVGDEQLE-------------IELDAEDGPPE------------LLFSHGGHKAKISDFA--WNKDEPWVISSVAEDNSLQVWQMAESI 398          
BLAST of WD repeat-containing protein 59 vs. TrEMBL
Match: A0A4D5RH96 (Putative conserved wd40 repeat-containing protein (Fragment) OS=Ixodes scapularis OX=6945 PE=4 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 1.898e-51
Identity = 236/1013 (23.30%), Postives = 414/1013 (40.87%), Query Frame = 3
Query:   75 KEIQASSFAMNSNGSLGLFCGLYEILLLSFDDPKRKRKESINKSSDPVL-CQWNKTCNEYFALTQSNVCKIF---DIELK-KFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDS-QGIQLVKWSNVKTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDW-SANMNIIVSCGQDKKLKIWNLEESNQNRILEEDYANYSMCKFDTLDN--IFTLNSSDVPSENFVSFWSIVEFRK-LYSTPPHTNVITDFALIYPTETA--CQFVTLHRNSDLKVWEINRSLVSGKRKRGGSSHVAGLDNSISNDRLFLSPSPDHSVNKSKAIPVGQSESFVNMHKNDILSSIIAHRSDPNLIMRDKSNKSLSEDQEIRVREFEKLSNTNQVTFEKSVDMRSVTAHFNLI---NLKCSIQFIYRTSIGDIVFLDVL-VLRQRAEKIRPQNLEELEKILKTTIDDCRRNNILPIEKCVD---VTLDYLNKLSSRFSLRAIRSLKDQSTPIHSFTSLPDVKVPFPRICGASFSPTGLLVCFLSPEGYM---SRFHSAPRSLADISK-LANTNSSSK--------GFFYEMNKNTTQKQYYKSNIRKLKSTEFNTETPSRKLSTQSIQKQTH-----IVLIYNVLQLSLFNVSLAKNYSLKISNAEAMCHKNLSAVTNCNRKDLFEFWQYCAILANGCKPSCNISAGYIRPWATQSMGRGLCELWMKHFLDINDIQSAAMLVIVMRAIDLDLENNFKENKNNASSISLTSGSHKNISQESLMDNIHSDTLNSNLCVSIFVDGLQKYKIYDDKRNATLIVMEINEGSPGRFRNNSFGEQEITNNLKKGDNLIPDSSLQHFQQNEQIRLIDPAKNLQYNRVLLHYVLMLSAHKLLNFSSKIVQ--KILPAKFFNLIFGHYNFDVFLLRNCINDHRCKSVYVDPNRLTVICSECPTRTVSVNNQDTSKTPIICSVCRNFVRGLFSVCDQCNHGGHADHLNSWF 2999
            K++QA++ A++S G   +  G   I L++ D P    K S+ +S   +   +WN    + F L  +   ++    + EL+ K  + +AH + IS I+W P ++N +AT+S D    + IWD R  + P   + +  G   VKW+ +  +  AT+   ++ IWD RK  +P     AH+  I    W  A+ N + +  QD  +K W++    +     +  A     ++    N  +  L       +N +  W+     + + +   H++ I +F    P   +   Q VT  ++  L +W ++       R +G        ++S+S     L+  P   V+         S+SF  +  +  L      +  P  + R+ S  +++  + I V+E +       VT    + +  +   F  +   N   + QF+  T++   V   +L VLR  +E+   +N        ++ ++ C R  +  +E C++   V  +    +S R  L           P   + S  D  VPFPR  GA F     LVCF  P  +    +     PRSL+ +   LA+ + +S+          +   +  T   Q    +I      E      +++ + +    Q H      VL+YN+  +   N  LA+NY L   +    C+ N S   +  RKDL + W   A++AN        S     PWA    GR + E  + H+L  +DIQ+ AML  +    ++D  N+ K+   + +  S  SGS     Q+      H+ T  S+    +  DGL  Y +   KRN                R+NS+ +    ++++  DN      ++  +     +L+DP K+ QY+     Y  +L    L    + +++     P K   + F         +  C   H CK      +   V C++C             +  ++C VC   VRG    C  C HGGH +H+ SWF
Sbjct:   14 KDLQATAMALDSEGQYAVLAGRRCIALVNLDSPDTTLKRSVRQSKFEISSAEWNPHLTDTFLLACNQSVELLTWCNGELRSKHTTPRAHTRAISDINWSPFDENLLATSSFDTY--VHIWDSREPRKPYLSLSAVTGASQVKWNKITQHVLATSHDGDVRIWDTRKSASPVQYIAAHSSKIYGLGWNPASENQLATSSQDGTVKFWDVTNPKKVEYTLQAGAPVFKARYLPFGNGLVTVLVPRQRKGDNNLVIWNCFHLNEPVQAFHGHSDAILEFGWRKPRLDSRDYQLVTWSKDQSLHLWNVD------VRLQGQCGQEVSEEDSVSLGASMLAEVPSTPVSSE------LSKSFGPLPGDSPLP-----QHPPFDLEREFSLLNINIPKVI-VQELDPGKRVCCVTVTVGMHILGLKLTFPQLYPYNASPTFQFLKGTTVDSNVKAKLLRVLRMTSEQHVKRN--------RSCLEPCLRQLVATLESCIESAEVEDNDSGYISERLKL-----------PYAVYGSFQDSSVPFPRTSGARFCGADYLVCFTRPSHFQKMNAPTEVTPRSLSALGAYLASQHKASRPPSTSSLVSLYAPHSPGTAATQTQDVSISSFYYQERKGRGRTQRRTGRQASSQQHPVPSAAVLLYNMSGIMPINQVLAQNYLLDCGDPVGSCNHNASWAASVGRKDLVQVWSLAALVANPDLAHDKQSPDVGVPWAQHPFGRQMLESIIGHYLRHSDIQTVAMLCCLFGGGNVD-GNSGKKFAFDQACTSQLSGS---WWQKVGGSPYHTVTGPSD----VMFDGL--YAVESLKRN----------------RSNSWSDS--IDDIRYMDNSPDPQKVERAKHRANCKLLDPKKSTQYDEFKKKYAEILYKWNLFEQRASVLKCLSTSPPKHKGVEF---------ITTC---HYCKH-----DVKNVQCTQC------------KRLSLLCVVCHIAVRGHAHACVACGHGGHVEHMLSWF 930          
BLAST of WD repeat-containing protein 59 vs. TrEMBL
Match: A0A131YP78 (Uncharacterized protein OS=Rhipicephalus appendiculatus OX=34631 PE=4 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 1.124e-48
Identity = 238/1025 (23.22%), Postives = 405/1025 (39.51%), Query Frame = 3
Query:   75 KEIQASSFAMNSNGSLGLFCGLYEILLLSFDDPKRKRKESINKSSDPV-LCQWNKTCNEYFALTQSNVCKIFDI----ELKKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDS-QGIQLVKWSNVKTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDW-SANMNIIVSCGQDKKLKIWNLEESNQNRILEEDYANYSMCKFDTLDN------IFTLNSSDVPSENFVSFWSIVEFRKLYSTPPHTNVITDFAL--IYPTETACQFVTLHRNSDLKVWEINRSLVSGKRKRGGSSHVAGLDNSISNDRLFLSPSPDHSVNKSKAIPVGQSESFVNMHKNDILSSIIAHRSDPNLIMRDKSNKSLSEDQEIRVREFEKLSNTN-------QVTFEKSVDMRSVTAHFNLINLKCSIQFIYRTSIGDIV-FLDVLV----LRQRAEKIRPQNLEELEKILKTTIDDCRRNNILPIEKCVDVTLDYLNKLSSRFSLRAIRSLKDQSTPIHSFTSLPDVKVPFPRICGASFSPTGLLVCFLSPEGYMSRFHS----APRSLADISK-LANTNSSSK--------GFFYEMNKNTTQKQYYKSNIRKLKSTEFNTETPSRKLSTQSIQKQTH-----IVLIYNVLQLSLFNVSLAKNYSLKISNAEAMCHKNLSAVTNCNRKDLFEFWQYCAILANGC----KPSCNISAGYIRPWATQSMGRGLCELWMKHFLDINDIQSAAMLVIVMRAIDLDLENNFKENKNNASSISLTSGSHKNISQESLMDNIHSDTLNSN-LCVSIFVDGLQKYKIYDDKRNATLIVMEINEGSPGRFRNNSFGEQEITNNLKKGDNLIPDSSLQHFQQNEQIRLIDPAKNLQYNRVLLHYVLMLSAHKLLNFSSKIVQKILPAKFFNLIFGHYNFDVFLLRNCINDHRCKSVYVDPNRLTVICSECPTRTVSVNNQDTSKTPIICSVCRNFVRGLFSVCDQCNHGGHADHLNSWF 2999
            K++QA++ A++S+G   +  G   + L++ D P    K+S+ +S   V   +WN    + F L  +   ++        L K   LKAH + IS I+W P ++N +A++S D    + IWD R+ + P   + +  G   VKW+ V  +  AT+   ++ IWD RK  +P     AH   I   DW  A+ + + +C QD  +K W++    +   + +  A     ++    +      I  L   D    N V + S+     + +   H +V+ +F    +       Q VT  ++  L +W ++        K     H    D+++S     ++  P   V+      +G      N  K +   + +     P+L                  REF  L N N       ++  EK V   ++T   + + LK     +Y  +      FL        +  R  K+     E+  K  +  ++ C R  +  +E CV+ + +  +  S   + R    LK       SF    D  VPFPR  GA F     LVCF  P  ++ + ++     PRSL+ +   LA+ + +S+          +   +  T   Q    +I      E      +++ + +    Q H      VLIYN+  +   N  LA+NY L   +  + C+ N +   N  RKDL + W   A++A+      KP  + +     PWA    GR + E  + H+L   DIQ+ AML  +    + D     K   + A S  LT    + +         H+ T  S+ +   ++V+ L        KRN                R+NS+ +    ++++  DN      ++        +L+DP+K+ QY+     Y  +L   KL    + +++                        C++    K   VD      +C  C +   SV   +  K  + C VC   VRG F  C QC HGGH  HL  WF
Sbjct:   14 KDLQATAMALDSDGQYAVLAGRRYVALVNLDSPDVTVKKSVRQSKFEVSTAEWNPHLADTFLLACNQNVELLTWCNGELLSKHIILKAHTRAISDINWSPFDENLLASSSYDTY--VHIWDSRDLRKPYLSLSAVTGASQVKWNKVTQHVLATSHDGDVRIWDTRKSGSPVQYIAAHPSKIYGLDWNPASEHQLATCSQDGTVKFWDVTNPKKVEYMLQAGAPVWRARYLPFGDGLVTALITKLRKGD---RNLVIWSSLRTSVPVRTFLTHPDVVLEFGWRRLRQESRDYQLVTWSKDQSLHLWNVD-------AKHQTCGHDVSEDDALSLAASMVAEVPTTPVSPEFPKSLG-----TNSSKGE---TPLPQHPPPDL-----------------EREFSLL-NINIPKVIIQELDAEKRVCCVAITVGNHALRLKLQFPQLYPYNASPTFQFLKGTTVDSNIENRLAKVLRVTSEQHVKRNRNCLEPCLRQLVATLESCVE-SAEVEDSDSGYLAER----LKHHYAVYGSFQ---DSSVPFPRTSGARFCGADFLVCFTRPS-HLQKMNAPTEVTPRSLSALGAYLASQHKASRPPSTSSLVSLYAPHSPGTATAQPQDVSISSFYYKERKGRGRTQRRTGRQASSQQHPLPSAAVLIYNMSGIMPINQFLAQNYMLDNGDPVSACNNNATCAANVGRKDLAQVWSLAALIASPQLSHDKPGPDAAV----PWAQHPFGRQMLESIISHYLKHYDIQTVAMLCCIFSGENADGSCGKKFAFDQACSSQLTGSWWQKVGGSPY----HTVTGPSDSVFGGLYVESL--------KRN----------------RSNSWSDS--IDDIRFMDNSPDPREVERTNHRTNCKLLDPSKSAQYDEFKKKYAEILYKWKLYEQRACVLK------------------------CLSTSPPKVKAVD---FVTVCHYCKSDVRSVQCDECKKLTLHCIVCHLAVRGQFHFCVQCGHGGHVQHLLDWF 930          
BLAST of WD repeat-containing protein 59 vs. TrEMBL
Match: A0A224Z4X1 (Protein containing WD40 and Zn ribbon domain OS=Rhipicephalus zambeziensis OX=60191 PE=4 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 9.541e-48
Identity = 236/1024 (23.05%), Postives = 405/1024 (39.55%), Query Frame = 3
Query:   75 KEIQASSFAMNSNGSLGLFCGLYEILLLSFDDPKRKRKESINKSSDPV-LCQWNKTCNEYFALTQSNVCKIFDI----ELKKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDS-QGIQLVKWSNVKTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDW-SANMNIIVSCGQDKKLKIWNLEESNQNRILEEDYANYSMCKFDTLDN------IFTLNSSDVPSENFVSFWSIVEFRKLYSTPPHTNVITDFAL--IYPTETACQFVTLHRNSDLKVWEINRSLVSGKRKRGGSSHVAGLDNSISNDRLFLSPSPDHSVNKSKAIPVGQSESFVNMHKNDILSSIIAHRSDPNLIMRDKSNKSLSEDQEIRVREFEKLSNTN-------QVTFEKSVDMRSVTAHFNLINLKCSIQFIYRTSIGDIV-FLDVLV----LRQRAEKIRPQNLEELEKILKTTIDDCRRNNILPIEKCVDVTLDYLNKLSSRFSLRAIRSLKDQSTPIHSFTSLPDVKVPFPRICGASFSPTGLLVCFLSPEGYMSRFHS----APRSLADISK-LANTNSSSK--------GFFYEMNKNTTQKQYYKSNIRKLKSTEFNTETPSRKLSTQSIQKQTH-----IVLIYNVLQLSLFNVSLAKNYSLKISNAEAMCHKNLSAVTNCNRKDLFEFWQYCAILANGC----KPSCNISAGYIRPWATQSMGRGLCELWMKHFLDINDIQSAAMLVIVMRAIDLDLENNFKENKNNASSISLTSGSHKNISQESLMDNIHSDTLNSNLCVSIFVDGLQKYKIYDDKRNATLIVMEINEGSPGRFRNNSFGEQEITNNLKKGDNLIPDSSLQHFQQNEQIRLIDPAKNLQYNRVLLHYVLMLSAHKLLNFSSKIVQKILPAKFFNLIFGHYNFDVFLLRNCINDHRCKSVYVDPNRLTVICSECPTRTVSVNNQDTSKTPIICSVCRNFVRGLFSVCDQCNHGGHADHLNSWF 2999
            K++QA++ A++S+G   +  G   + L++ D P    K+S+ +S   V   +WN    + F L  +   ++        L K   LKAH + IS I+W P ++N +A++S D    + IWD R+ + P   + +  G   VKW+ V  +  AT+   ++ IWD RK  +P     AH   I   DW  A+ + + +C QD  +K W++    +   + +  A     ++    +      I  L   D    N V + S+     + +   H++V+ +F    +       Q VT  ++  L +W ++        K     H    D+++S     ++  P   V+      +G      N  K +   + +     P+L                  REF  L N N       ++  EK V   ++T   + + LK     +Y  +      FL        +  R  K+     E+  K  +  ++ C R  +  +E CV+ + +  +  S   + R    LK       SF    D  VPFPR  GA F     LVCF  P  ++ + ++     PRSL+ +   LA+ + +S+          +   +  T   Q    +I      E      +++ + +    Q H      VLIYN+  +   N  LA+NY L   +  + C+ N +   N  RKDL + W   A++A+      KP  + +     PWA    GR + E  + H+L   DIQ+ AML  +    + D     K   + A S S+    +  ++  S  D++            ++V+ L        KRN                R+NS+ +    ++++  DN      ++        +L+DP+K+ QY+     Y  +L   KL    + +++                        C++    K   VD      +C  C +   SV   +  K  + C VC   VRG F  C QC HGGH  HL  WF
Sbjct:   14 KDLQATAMALDSDGQYAVLAGRRYVALVNLDSPDVTVKKSVRQSKFEVSTAEWNPHLADTFLLACNQNVELLTWCNGELLSKHIILKAHTRAISDINWSPFDENLLASSSYDTY--VHIWDSRDLRKPYLSLSAVTGASQVKWNKVTQHVLATSHDGDVRIWDTRKSGSPVQYIAAHPSKIYGLDWNPASEHQLATCSQDGTVKFWDVTNPKKVEYMLQAGAPVWRARYLPFGDGLVTALITKLRKGD---RNLVIWSSLRTSVPVRTFLTHSDVVLEFGWRRLRQESRDYQLVTWSKDQSLHLWNVD-------AKHQTCGHDVSEDDALSLAASMVAEVPTTPVSPEFPKSLG-----TNSSKGE---TPLPQHPPPDL-----------------EREFSLL-NINIPKVIIQELDAEKRVCCVAITVGNHALRLKLQFPQLYPYNASPTFQFLKGTTVDSNIENRLAKVLRVTSEQHVKRNRNCLEPCLRQLVATLESCVE-SAEVEDSDSGYIAER----LKHHYAVYGSFQ---DSSVPFPRTSGARFCGADFLVCFTRPS-HLQKMNAPTEVTPRSLSALGAYLASQHKASRPPSTSSLVSLYAPHSPGTATAQPQDVSISSFYYKERKGRGRTQRRTGRQASSQQHPLPSAAVLIYNMSGIMPINQFLAQNYMLDNGDPVSACNNNATCAANVGRKDLAQVWSLAALIASPQLSHDKPGPDAAV----PWAQHPFGRQMLESIISHYLKHYDIQTVAMLCCIFSGENADGSCGKKFAFDQACS-SVGGSPYHTVTGPS--DSVFG---------GLYVESL--------KRN----------------RSNSWSDS--IDDIRFMDNSPDPREVERTNHRTNCKLLDPSKSAQYDEFKKKYAEILYKWKLYEQRACVLK------------------------CLSTSPPKVKAVD---FVTVCHYCKSDVRSVQCDECKKLTLHCIVCHLAVRGQFHFCVQCGHGGHVQHLLDWF 921          
BLAST of WD repeat-containing protein 59 vs. TrEMBL
Match: A0A131YR22 (Uncharacterized protein OS=Rhipicephalus appendiculatus OX=34631 PE=4 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 1.587e-47
Identity = 236/1024 (23.05%), Postives = 404/1024 (39.45%), Query Frame = 3
Query:   75 KEIQASSFAMNSNGSLGLFCGLYEILLLSFDDPKRKRKESINKSSDPV-LCQWNKTCNEYFALTQSNVCKIFDI----ELKKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDS-QGIQLVKWSNVKTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDW-SANMNIIVSCGQDKKLKIWNLEESNQNRILEEDYANYSMCKFDTLDN------IFTLNSSDVPSENFVSFWSIVEFRKLYSTPPHTNVITDFAL--IYPTETACQFVTLHRNSDLKVWEINRSLVSGKRKRGGSSHVAGLDNSISNDRLFLSPSPDHSVNKSKAIPVGQSESFVNMHKNDILSSIIAHRSDPNLIMRDKSNKSLSEDQEIRVREFEKLSNTN-------QVTFEKSVDMRSVTAHFNLINLKCSIQFIYRTSIGDIV-FLDVLV----LRQRAEKIRPQNLEELEKILKTTIDDCRRNNILPIEKCVDVTLDYLNKLSSRFSLRAIRSLKDQSTPIHSFTSLPDVKVPFPRICGASFSPTGLLVCFLSPEGYMSRFHS----APRSLADISK-LANTNSSSK--------GFFYEMNKNTTQKQYYKSNIRKLKSTEFNTETPSRKLSTQSIQKQTH-----IVLIYNVLQLSLFNVSLAKNYSLKISNAEAMCHKNLSAVTNCNRKDLFEFWQYCAILANGC----KPSCNISAGYIRPWATQSMGRGLCELWMKHFLDINDIQSAAMLVIVMRAIDLDLENNFKENKNNASSISLTSGSHKNISQESLMDNIHSDTLNSNLCVSIFVDGLQKYKIYDDKRNATLIVMEINEGSPGRFRNNSFGEQEITNNLKKGDNLIPDSSLQHFQQNEQIRLIDPAKNLQYNRVLLHYVLMLSAHKLLNFSSKIVQKILPAKFFNLIFGHYNFDVFLLRNCINDHRCKSVYVDPNRLTVICSECPTRTVSVNNQDTSKTPIICSVCRNFVRGLFSVCDQCNHGGHADHLNSWF 2999
            K++QA++ A++S+G   +  G   + L++ D P    K+S+ +S   V   +WN    + F L  +   ++        L K   LKAH + IS I+W P ++N +A++S D    + IWD R+ + P   + +  G   VKW+ V  +  AT+   ++ IWD RK  +P     AH   I   DW  A+ + + +C QD  +K W++    +   + +  A     ++    +      I  L   D    N V + S+     + +   H +V+ +F    +       Q VT  ++  L +W ++        K     H    D+++S     ++  P   V+      +G      N  K +   + +     P+L                  REF  L N N       ++  EK V   ++T   + + LK     +Y  +      FL        +  R  K+     E+  K  +  ++ C R  +  +E CV+ + +  +  S   + R    LK       SF    D  VPFPR  GA F     LVCF  P  ++ + ++     PRSL+ +   LA+ + +S+          +   +  T   Q    +I      E      +++ + +    Q H      VLIYN+  +   N  LA+NY L   +  + C+ N +   N  RKDL + W   A++A+      KP  + +     PWA    GR + E  + H+L   DIQ+ AML  +    + D     K   + A S S+    +  ++  S  D++            ++V+ L        KRN                R+NS+ +    ++++  DN      ++        +L+DP+K+ QY+     Y  +L   KL    + +++                        C++    K   VD      +C  C +   SV   +  K  + C VC   VRG F  C QC HGGH  HL  WF
Sbjct:   14 KDLQATAMALDSDGQYAVLAGRRYVALVNLDSPDVTVKKSVRQSKFEVSTAEWNPHLADTFLLACNQNVELLTWCNGELLSKHIILKAHTRAISDINWSPFDENLLASSSYDTY--VHIWDSRDLRKPYLSLSAVTGASQVKWNKVTQHVLATSHDGDVRIWDTRKSGSPVQYIAAHPSKIYGLDWNPASEHQLATCSQDGTVKFWDVTNPKKVEYMLQAGAPVWRARYLPFGDGLVTALITKLRKGD---RNLVIWSSLRTSVPVRTFLTHPDVVLEFGWRRLRQESRDYQLVTWSKDQSLHLWNVD-------AKHQTCGHDVSEDDALSLAASMVAEVPTTPVSPEFPKSLG-----TNSSKGE---TPLPQHPPPDL-----------------EREFSLL-NINIPKVIIQELDAEKRVCCVAITVGNHALRLKLQFPQLYPYNASPTFQFLKGTTVDSNIENRLAKVLRVTSEQHVKRNRNCLEPCLRQLVATLESCVE-SAEVEDSDSGYLAER----LKHHYAVYGSFQ---DSSVPFPRTSGARFCGADFLVCFTRPS-HLQKMNAPTEVTPRSLSALGAYLASQHKASRPPSTSSLVSLYAPHSPGTATAQPQDVSISSFYYKERKGRGRTQRRTGRQASSQQHPLPSAAVLIYNMSGIMPINQFLAQNYMLDNGDPVSACNNNATCAANVGRKDLAQVWSLAALIASPQLSHDKPGPDAAV----PWAQHPFGRQMLESIISHYLKHYDIQTVAMLCCIFSGENADGSCGKKFAFDQACS-SVGGSPYHTVTGPS--DSVFG---------GLYVESL--------KRN----------------RSNSWSDS--IDDIRFMDNSPDPREVERTNHRTNCKLLDPSKSAQYDEFKKKYAEILYKWKLYEQRACVLK------------------------CLSTSPPKVKAVD---FVTVCHYCKSDVRSVQCDECKKLTLHCIVCHLAVRGQFHFCVQCGHGGHVQHLLDWF 921          
BLAST of WD repeat-containing protein 59 vs. TrEMBL
Match: A0A293LUA5 (Uncharacterized protein (Fragment) OS=Ornithodoros erraticus OX=265619 PE=4 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 1.090e-45
Identity = 234/1012 (23.12%), Postives = 412/1012 (40.71%), Query Frame = 3
Query:   96 FAMNSNGSLGLFCGLYEILLLSFDDPKRKRKESINKSSDPV-LCQWNKTCNEYFALTQSNVCKIF---DIEL-KKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDS-QGIQLVKWSNVKTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDW-SANMNIIVSCGQDKKLKIWNLEESNQ-NRILEEDYANYSMCKFDTLDNIFTLNSSDVP----SENFVSFWSIVEFR-KLYSTPPHTNVITDFALIYPTET-ACQFVTLHRNSDLKVWEINRSLVSGKRKRGGSSHVAGLDN-SISNDRLFLSPSPDHSVN-KSKAIPVGQSESFVNMHKNDILSS--IIAHRSDPNLIMRDKSNKSLSEDQEIRVREFEKLSNTNQVTFEKSVDMRSVTAHFNLINLKCSIQFIYRTSIGDIVFLDVL-VLRQRAEKIRPQNLEELEKILKTTIDDCRRNNILPIEKCVDVTLDYLNKLSSRFSLRAIRSLKDQSTPIHSFTSLPDVKVPFPRICGASFSPTGLLVCFLSPEGYM---SRFHSAPRSLADI----------SKLANTNS--------SSKGFFYEMNKNTTQKQYYKSNIRKLKSTEFNTETPSRKLSTQSIQKQTHIVLIYNVLQLSLFNVSLAKNYSLKISNAEAMCHKNLSAVTNCNRKDLFEFWQYCAILANG--CKPSCNISAGYIRPWATQSMGRGLCELWMKHFLDINDIQSAAMLVIVMRAIDLDLENNFKENKNNASSISLTSGSHKNISQESLMDNIHSDTLNSNLCVSIFVDGLQKYKIYDDKRNATLIVMEINEGSPGRFRNNSFGEQEITNNLKKGDNLIPDSSLQHFQQNEQIRLIDPAKNLQYNRVLLHYVLMLSAHKLLNFSSKIVQKIL--PAKFFNLIFGHYNFDVFLLRNCINDHRCKSVYVDPNRLTVICSECPTRTVSVNNQDTSKTPIICSVCRNFVRGLFSVCDQCNHGGHADHLNSWF 2999
             A++S+G+  +  G   I ++  ++P+   K+S+ +S   V   +WN    + F+L  +   ++    D EL  K+  +KAH + IS I+W P ++N +A++S D    + IWD R+ +     + +  G   VKW+ +     AT+   ++ IWD RK  +P     AH+  I   DW  +N + + +  QD  +K W++    +    L+     +        D + T+    VP     EN +  W+ +      ++   H++V+ +F    P ++   Q VT  ++  L +W ++       R +G S  V   D  S+    +  +P    S        P+G  ES    H    L     + + + P +I+++   K             +++           + ++ +       N   + QF+  T+I   V   +L VLR  +E        +  K  ++ ++ C R  +  +E C  ++ +  +   S    R   S          + S  D  VPFPR  GA F     LVCF  P  +    +     PRSL+ +          S+ A+T+S        S  G       + +   +Y  + RK K  +       R+ ++Q     +  VLIYN+  +   N +LA+NY L  ++    C KN S   +  R DL + W   A +A+        N+S G   PWA ++ GR + E  + H+L   DIQ+ AML  +    + +     K   + +SS  L+      +   S    +   +  SNL  +  V+ L        KRN                R+NS+ +    ++++  D       ++  +    IRL++P  + QY+     Y  +L    LL   +++++ +   P K       H   D  ++  C   H CK      +   V C+ C  R +S++          C +CR  VRG F  C  C HGGH  H+  WF
Sbjct:    1 MALDSHGNFAVLAGRRYIAIVDLNEPQLTVKKSVRQSKFEVSTAEWNPHIEDTFSLACNQNIELLTWADGELLSKYTVVKAHTRAISDINWSPFDENYMASSSFDTY--VHIWDTRDPRKAFLSLSAVTGPSQVKWNKLSAYFLATSHDGDVRIWDTRKSGSPVQYIAAHSSKIYGLDWCPSNEHQLTTASQDGTVKFWDVTNPKKVEHTLQSGAPVWRARYMPFGDGLVTVL---VPKMRRGENSLVIWNNIRANVPAHTFLAHSDVVLEFGWRKPQDSRGYQLVTWSKDQSLHLWNVD------SRMQGYSQEVLEDDTVSLGTSAIAETPLAQSSAELVESGQPLGNGESHPPQHPPPDLEQEFSLLNINIPKVIIQELDAK-------------KRVCCVTVTVGMHVLGLKLIFPQLYPFNASPTFQFLKGTTIDSSVKAKLLKVLRHTSE--------QHVKRKRSCLEPCLRQLVATLEGCT-LSSEVDDSDGSHLVERMKHSYA-------VYGSFQDSSVPFPRTSGARFCGADCLVCFTRPSHFQKMNAPTEVTPRSLSALGAYLASQHKASRPASTSSLVGLYPPHSPGGATAPGTHDVSISSFYYQD-RKSKGRQ--QRRAGRQATSQQQPVPSAAVLIYNMSGIMPINQTLAQNYVLDSADPAGACSKNASCAASVGRNDLVQVWSLAAFIASPHISHDKQNLSTGI--PWARRAFGRRMLESIIDHYLKRYDIQTVAMLCCIFGGENPETGFGKKAAGDLSSSSHLSGSWWLKVGG-SPYHTVTGPSEGSNLDSTYLVEAL--------KRN----------------RSNSWSDS--IDDIRYMDTNPDPREVERERHRANIRLLNPNNSAQYDEFKKKYGEILYKWSLLEQRAQVLKHLTSSPPK-------HKGVDFMII--C---HYCKC-----DVRGVQCTRC--RKLSLH----------CIICRVAVRGHFHFCVGCGHGGHLLHMLEWF 911          
BLAST of WD repeat-containing protein 59 vs. Ensembl Cavefish
Match: wdr59 (WD repeat domain 59 [Source:NCBI gene;Acc:103043604])

HSP 1 Score: 138.658 bits (348), Expect = 6.929e-33
Identity = 176/755 (23.31%), Postives = 302/755 (40.00%), Query Frame = 3
Query:  114 GSLGLFCGLYEILLLSFDDP-KRKRKESINKSSDPVLCQWNKTCNE--YFALTQSNVCKIF---DIELKKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDS-QGIQLVKWSNVKTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDWSA-NMNIIVSCGQDKKLKIWNLEESNQNRILEEDYANYSMCKFDTLDNIFTLNSSD-----VPS---ENFVSFWSIVEF-RKLYSTPPHTNVITDFALIYPTETA--CQFVTLHRNSDLKVWEINRSLVSGKRKRGGSSHVAGLDNSISNDRLFLSPSPDHSVNKSKAIPVGQSESFVNMHKNDILSSIIAHRSDPNLIMRDKSNKSLSEDQEIRVR-EFEKLSNTNQVTFEKSVDMRSVTAHFNLI---NLKCSIQFIYRTSIGDIVFLDVLVLRQRAEKIRPQNLEELEKILKTTIDDCRRNNILPIEKCVDVTLDYLNKLSSRFSLRAIRSLKDQSTPIHSFTSLPDVKVPFPRICGASFSPTGLLVCFLSPEGYMSRFHSA---PRSLADISKL---------ANTNSSSKGFFYEMNKNTTQKQ-------YYKS-NIRKLKSTEFNTETPSRKLSTQSIQKQTHIVLIYNVLQLSLFNVSLAKNYSLKISNAEAMCHKNLSAVTNCNRKDLFEFWQYC-AILANGCKPSCNISAGYIRPWATQSMGRGLCELWMKHFLDINDIQSAAMLVIVMRA 2246
            G   +  G   + +++ + P +  RK       D    QWN    E   FA + +    ++   D   +   SL+ H ++IS +DW       + T+S D    + IWD R+++ P+  + +  G   VKW+    N  A++   ++ IWD RK         AH   I+  DW   N  I+ +  QD  ++ W+  +  +       Y N   C+       +T  S+      VP    EN +  WS ++    +++   H +V+ +F      E +  CQ VT  R+  L++W ++  L            + G+  +  +++     SPD     S ++ V  S+  +   ++ +LSS    +  P L    +   SL   Q   V  E + L+ T  V+    V+   +   F      N   S QF+  T+I          ++ + +KI      +  K  +  ++ C R  +  +E  ++   D  N  +  F+     +L       +++ S  D  +PFPR  GA F  TG LV F  P         A   PRSL+ +S             + S +    Y  +   T K+       YYK    R+ K     T+  +R +      K    V+I  +  L   + +LA+ Y L +++    C KN +A     R+DL + W    A  +    P  +  A    PWA    GR L    ++H+  ++D+QS AML  V R 
Sbjct:    7 GHHAVLSGRRFLYVVNLETPSEAPRKIGRQSKWDVGTVQWNPHRAEAHLFAASSNQRVDLYVWRDGCGEAHNSLQGHTRVISDLDWSWFEPEYLVTSSVDTY--IYIWDTRDTRKPTVALSAVAGASQVKWNRRNQNCLASSHDGDVRIWDRRKPNTAVEYVAAHLSKIHGLDWHPDNEYILATSSQDNSVRFWDYRQPRK-------YLNILSCQVPVWKARYTPFSNGLVTVMVPQLRRENSLLLWSTLDLNSPVHAFVGHDDVVLEFQWRPQKEGSKDCQLVTWSRDQTLRIWRVDPQLQKLCANDIVEELMEGMTLTTESEKTLR--SPDSEPPLSPSLTVDNSQGQIESLQSGLLSS--GRQDSPGLPQTLQQEFSLVNLQIRNVNVEMDALNRTCFVSAHCGVNQVRLVVKFPAQYPNNAAPSFQFVPPTNISS-------SMKTKIQKILTDTSLQKVKRNQNCLEPCVRQLVSCLESDME---DGTNPHA--FANSVTPALPAFPRVTNTYGSYQDANIPFPRTSGARFFGTGSLVYFTRPMSMHRTVPPAEPTPRSLSALSAYHSGLMTPMKMRSESQTSLRLYSGSPTRTDKEHVSISSFYYKERKSRRWKGKREGTDYGNRPI------KLAGKVIIQEISCLLPIHKALAETYVLNVNDIHDTCQKNAAAALAVGRRDLAKVWALASAATSQDLCPDSDPDAN--TPWARHPFGRKLLATLIEHYSHLSDVQSLAMLCSVFRG 728          
BLAST of WD repeat-containing protein 59 vs. Ensembl Cavefish
Match: wdr59 (WD repeat domain 59 [Source:NCBI gene;Acc:103043604])

HSP 1 Score: 137.887 bits (346), Expect = 1.367e-32
Identity = 175/784 (22.32%), Postives = 312/784 (39.80%), Query Frame = 3
Query:   75 KEIQASSFAMNSNGSLGLFCGLYEILLLSFDDP-KRKRKESINKSSDPVLCQWNKTCNE--YFALTQSNVCKIF---DIELKKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDS-QGIQLVKWSNVKTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDWSA-NMNIIVSCGQDKKLKIWNLEE--------SNQNRILEEDYANYSMCKFDTLDNIFTLNSSDVPSENFVSFWSIVEF-RKLYSTPPHTNVITDFALIYPTETA--CQFVTLHRNSDLKVWEINRSLVSGKRKRGGSSHVAGLDNSISNDRLFLSPSPDHSVNKSKAIPVGQSESFVNMHKNDILSSIIAHRSDPNLIMRDKSNKSLSEDQEIRVR-EFEKLSNTNQVTFEKSVDMRSVTAHFNLI---NLKCSIQFIYRTSIGDIVFLDVLVLRQRAEKIRPQNLEELEKILKTTIDDCRRNNILPIEKCVDVTLDYLNKLSSRFSLRAIRSLKDQSTPIHSFTSLPDVKVPFPRICGASFSPTGLLVCFLSPEGYMSRFHSAPRSLADISKLANTNSSSKGFFYEM----NKNTTQKQYYKSNIR------KLKSTEFNTETP----SRKLSTQSIQ----------------------KQTHIVLIYNVLQLSLFNVSLAKNYSLKISNAEAMCHKNLSAVTNCNRKDLFEFWQYC-AILANGCKPSCNISAGYIRPWATQSMGRGLCELWMKHFLDINDIQSAAMLVIVMRA 2246
            ++ QA++ +++  G   +  G   + +++ + P +  RK       D    QWN    E   FA + +    ++   D   +   SL+ H ++IS +DW       + T+S D    + IWD R+++ P+  + +  G   VKW+    N  A++   ++ IWD RK         AH   I+  DW   N  I+ +  QD  ++ W+  +        S Q  + +  Y  +S       + + T+    +  EN +  WS ++    +++   H +V+ +F      E +  CQ VT  R+  L++W ++  L            + G+  +  +++     SPD     S ++ V  S+  +   ++ +LSS    +  P L    +   SL   Q   V  E + L+ T  V+    V+   +   F      N   S QF+  T+I          ++ + +KI      +  K  +  ++ C R  +  +E  ++   D  N  +  F+     +L       +++ S  D  +PFPR  GA F  TG LV F  P   MS   + P +      L+  ++   G    M       T+ + Y  S  R       + S  +    P     R+ S Q+I                       K    V+I  +  L   + +LA+ Y L +++    C KN +A     R+DL + W    A  +    P  +  A    PWA    GR L    ++H+  ++D+QS AML  V R 
Sbjct:   15 RDAQATAMSVDCLGHHAVLSGRRFLYVVNLETPSEAPRKIGRQSKWDVGTVQWNPHRAEAHLFAASSNQRVDLYVWRDGCGEAHNSLQGHTRVISDLDWSWFEPEYLVTSSVDTY--IYIWDTRDTRKPTVALSAVAGASQVKWNRRNQNCLASSHDGDVRIWDRRKPNTAVEYVAAHLSKIHGLDWHPDNEYILATSSQDNSVRFWDYRQPRKYLNILSCQVPVWKARYTPFS-------NGLVTVMVPQLRRENSLLLWSTLDLNSPVHAFVGHDDVVLEFQWRPQKEGSKDCQLVTWSRDQTLRIWRVDPQLQKLCANDIVEELMEGMTLTTESEKTLR--SPDSEPPLSPSLTVDNSQGQIESLQSGLLSS--GRQDSPGLPQTLQQEFSLVNLQIRNVNVEMDALNRTCFVSAHCGVNQVRLVVKFPAQYPNNAAPSFQFVPPTNISS-------SMKTKIQKILTDTSLQKVKRNQNCLEPCVRQLVSCLESDME---DGTNPHA--FANSVTPALPAFPRVTNTYGSYQDANIPFPRTSGARFFGTGSLVYFTRP---MSMHRTVPPAEPTPRSLSALSAYHSGLMTPMKMRSESQTSLRLYSGSPTRTDKEHVSISSFYYKERKPPLSAPRRWSVQTIHDCPKSRRWKGKREGTDYGNRPIKLAGKVIIQEISCLLPIHKALAETYVLNVNDIHDTCQKNAAAALAVGRRDLAKVWALASAATSQDLCPDSDPDAN--TPWARHPFGRKLLATLIEHYSHLSDVQSLAMLCSVFRG 768          
BLAST of WD repeat-containing protein 59 vs. Ensembl Cavefish
Match: wdr59 (WD repeat domain 59 [Source:NCBI gene;Acc:103043604])

HSP 1 Score: 127.487 bits (319), Expect = 2.143e-29
Identity = 176/764 (23.04%), Postives = 299/764 (39.14%), Query Frame = 3
Query:   87 ASSFAMNSNGSLGLFCGLYEILLLSFDDP-KRKRKESINKSSDPVLCQWNKTCNE--YFALTQSNVCKIF---DIELKKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDS-QGIQLVKWSNVKTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDWSA-NMNIIVSCGQDKKLKIWNLEE--------SNQNRILEEDYANYSMCKFDTLDNIFTLNSSDVPSENFVSFWSIVEF-RKLYSTPPHTNVITDFALIYPTETA--CQFVTLHRNSDLKVWEINRSLVSGKRKRGGSSHVAGLDNSISNDRLFLSPSPDHSVNKSKAIPVGQSESFVNMHKNDILSSIIAHRSDPNLIMRDKSNKSLSEDQEIRVR-EFEKLSNTNQVTFEKSVDMRSVTAHFNLI---NLKCSIQFIYRTSIGDIVFLDVLVLRQRAEKIRPQNLEELEKILKTTIDDCRRNNILPIEKCVDVTLDYLNKLSSRFSLRAIRSLKDQSTPIHSFTSLPDVKVPFPRICGASFSPTGLLVCFLSPEGYMSRFHSA---PRSLADISKL---------ANTNSSSKGFFYEMNKNTTQKQ-------YYKS-NIRKLKSTEFNTETPSRKLSTQSIQKQTHIVLIYNVLQLSLFNVSLAKNYSLKISNAEAMCHKNLSAVTNCNRKDLFEFWQYC-AILANGCKPSCNISAGYIRPWATQSMGRGLCELWMKHFLDINDIQSAAMLVIVMRA 2246
            A++ +++  G   +  G   + +++ + P +  RK       D    QWN    E   FA + +    ++   D   +   SL+ H ++IS +DW       + T+S D    + IWD R+++ P+  + +  G   VKW+    N  A++   ++ IWD RK         AH   I+  DW   N  I+ +  QD  ++ W+  +        S Q  + +  Y  +S       + + T+    +  EN +  WS ++    +++   H +V+ +F      E +  CQ VT  R+  L++W ++  L                   +   RL   P        S    +GQ ES     ++ +LSS    +  P L    +   SL   Q   V  E + L+ T  V+    V+   +   F      N   S QF+  T+I          ++ + +KI      +  K  +  ++ C R  +  +E  + V+ D  N  +  F+     +L       +++ S  D  +PFPR  GA F  TG LV F  P         A   PRSL+ +S             + S +    Y  +   T K+       YYK    R+ K     T+  +R +      K    V+I  +  L   + +LA+ Y L +++    C KN +A     R+DL + W    A  +    P  +  A    PWA    GR L          ++D+QS AML  V R 
Sbjct:    1 ATAMSVDCLGHHAVLSGRRFLYVVNLETPSEAPRKIGRQSKWDVGTVQWNPHRAEAHLFAASSNQRVDLYVWRDGCGEAHNSLQGHTRVISDLDWSWFEPEYLVTSSVDTY--IYIWDTRDTRKPTVALSAVAGASQVKWNRRNQNCLASSHDGDVRIWDRRKPNTAVEYVAAHLSKIHGLDWHPDNEYILATSSQDNSVRFWDYRQPRKYLNILSCQVPVWKARYTPFS-------NGLVTVMVPQLRRENSLLLWSTLDLNSPVHAFVGHDDVVLEFQWRPQKEGSKDCQLVTWSRDQTLRIWRVDPQL-----------------QKVRFIRLLAQP------YLSSLFSIGQIESL----QSGLLSS--GRQDSPGLPQTLQQEFSLVNLQIRNVNVEMDALNRTCFVSAHCGVNQVRLVVKFPAQYPNNAAPSFQFVPPTNISS-------SMKTKIQKILTDTSLQKVKRNQNCLEPCVRQLVSCLESDM-VSEDGTNPHA--FANSVTPALPAFPRVTNTYGSYQDANIPFPRTSGARFFGTGSLVYFTRPMSMHRTVPPAEPTPRSLSALSAYHSGLMTPMKMRSESQTSLRLYSGSPTRTDKEHVSISSFYYKERKSRRWKGKREGTDYGNRPI------KLAGKVIIQEISCLLPIHKALAETYVLNVNDIHDTCQKNAAAALAVGRRDLAKVWALASAATSQDLCPDSDPDAN--TPWARHPFGRKLLAT-----FHLSDVQSLAMLCSVFRG 703          
BLAST of WD repeat-containing protein 59 vs. Ensembl Cavefish
Match: rbb4l (histone-binding protein RBBP7 [Source:NCBI gene;Acc:103023991])

HSP 1 Score: 61.2326 bits (147), Expect = 3.121e-9
Identity = 39/136 (28.68%), Postives = 70/136 (51.47%), Query Frame = 3
Query:  321 AHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIR--NSKFPSHKIDSQGIQLVKWSNVKTNSF--ATTSSEE-IMIWDDRKLTAPTHIFEAHNGNINDFDWSA-NMNIIVSCGQDKKLKIWNLEESNQNRILEE 710
             H  ++  + WH  +++   + ++D  + L IWD R  N+  PSH +D+   ++   S    + F  AT S+++ + +WD R L    H FE+H   I    WS  N  I+ S G D++L +W+L +  + +  E+
Sbjct:  225 GHTAVVEDVSWHLLHESLFGSVADD--QKLMIWDTRSNNTAKPSHAVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSAED 358          

HSP 2 Score: 54.6842 bits (130), Expect = 3.209e-7
Identity = 34/133 (25.56%), Postives = 66/133 (49.62%), Query Frame = 3
Query:  315 LKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDSQGI--------QLVKWSNVKTNSFATTSSEE-IMIWDDRK--LTAPTHIFEAHNGNINDFDWSANMNIIVSCG-QDKKLKIWNL 677
            L+ H K    + W+P+    + +AS+D+  ++C+WDI  S      +D++ I        + V W  +  + F + + ++ +MIWD R      P+H  +AH   +N   ++     I++ G  DK + +W+L
Sbjct:  173 LRGHQKEGYGLSWNPNLSGNLLSASDDH--TICLWDISGSPKEGKIVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTAKPSHAVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDL 303          
BLAST of WD repeat-containing protein 59 vs. Ensembl Cavefish
Match: rbbp4 (RB binding protein 4, chromatin remodeling factor [Source:NCBI gene;Acc:103039809])

HSP 1 Score: 61.2326 bits (147), Expect = 3.184e-9
Identity = 47/178 (26.40%), Postives = 84/178 (47.19%), Query Frame = 3
Query:  195 INKSSDPVLCQWNKTCNEYFALTQSNVCKIFDIELKKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIR--NSKFPSHKIDSQGIQLVKWSNVKTNSF--ATTSSEE-IMIWDDRKLTAPTHIFEAHNGNINDFDWSA-NMNIIVSCGQDKKLKIWNLEESNQNRILEE 710
            ++ S D  +C W+ +       T     KI D +         H  ++  + WH  +++   + ++D  + L IWD R  N+  PSH +D+   ++   S    + F  AT S+++ + +WD R L    H FE+H   I    WS  N  I+ S G D++L +W+L +  + +  E+
Sbjct:  194 LSASDDHTICLWDIS-------TVPKEGKIVDAK----TIFTGHTAVVEDVSWHLLHESLFGSVADD--QKLMIWDTRSNNTSKPSHAVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPED 358          

HSP 2 Score: 52.373 bits (124), Expect = 2.083e-6
Identity = 33/133 (24.81%), Postives = 66/133 (49.62%), Query Frame = 3
Query:  315 LKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDSQGI--------QLVKWSNVKTNSFATTSSEE-IMIWDDRK--LTAPTHIFEAHNGNINDFDWSANMNIIVSCG-QDKKLKIWNL 677
            L+ H K    + W+P+    + +AS+D+  ++C+WDI         +D++ I        + V W  +  + F + + ++ +MIWD R    + P+H  +AH   +N   ++     I++ G  DK + +W+L
Sbjct:  173 LRGHQKEGYGLSWNPNLSGCLLSASDDH--TICLWDISTVPKEGKIVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHAVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDL 303          
BLAST of WD repeat-containing protein 59 vs. Ensembl Sea Lamprey
Match: wdr59 (WD repeat domain 59 [Source:ZFIN;Acc:ZDB-GENE-120215-187])

HSP 1 Score: 92.4337 bits (228), Expect = 8.396e-20
Identity = 76/304 (25.00%), Postives = 136/304 (44.74%), Query Frame = 3
Query:   96 FAMNSNGSLGLFCGLYEILLLSFDDPKRKRKESINKSS-DPVLCQWN--KTCNEYFALT---QSNVCKIFDIELKKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDS-QGIQLVKWSNVKTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDWSA-NMNIIVSCGQDKKLKIWNLEESNQNRILEEDYANYSMCKFDTLDNIFTLNSSDVP----SENFVSFWSIVEF-RKLYSTPPHTNVITDFALIYPTETA--CQFVTLHRNSDLKVWEINRSL 962
             +++  G   +  G   + +++ D P    K+   +S  D    QWN  +    +FA +   Q ++ K  D   +   SL+ H ++IS +DW       + T S D    + IWDI++++ P+  + +  G   VKW+  + ++ AT+   ++ IWD RK TAP     AH   I+  DW   N  I+ +  QD  +K W++    +N  +          ++    N   L +  VP     EN +  W++ E    +++   H +V+ +F      E     Q VT  R+  L++W I+  L
Sbjct:    1 MSVDCQGQTAVLSGRRYLYMINLDSPSELVKKISRQSKWDVGAVQWNPHEVSKHFFAASCNQQVDLYKWKDGVGEVPTSLRGHTRVISDLDWSWFEHEYLVTCSVDTY--IYIWDIKDTRKPAISLSAVAGASQVKWNKRQRDTLATSHDGDVRIWDKRKATAPVEYMAAHLSKIHGLDWHPDNEFILATSSQDNSVKFWDIRNPRKNIHVLSCQVPVWKARYTPFSN--GLITVMVPQLRRGENSLLLWNLGELGAPVHTFVGHNDVVLEFNWRKQREGLKDFQLVTWSRDQSLRIWRIDTQL 300          
BLAST of WD repeat-containing protein 59 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008002.1 (pep scaffold:Pmarinus_7.0:GL477852:421:9512:1 gene:ENSPMAG00000007189.1 transcript:ENSPMAT00000008002.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.7734 bits (151), Expect = 2.351e-10
Identity = 39/136 (28.68%), Postives = 70/136 (51.47%), Query Frame = 3
Query:  321 AHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIR--NSKFPSHKIDSQGIQLVKWSNVKTNSF--ATTSSEE-IMIWDDRKLTAPTHIFEAHNGNINDFDWSA-NMNIIVSCGQDKKLKIWNLEESNQNRILEE 710
             H  ++  + WH  +++   + ++D  + L IWD R  N+  PSH +D+   ++   S    + F  AT S+++ + +WD R L    H FE+H   I    WS  N  I+ S G D++L +W+L +  + +  E+
Sbjct:  225 GHTAVVEDVSWHLLHESLFGSVADD--QKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADQTVALWDLRNLKLKLHSFESHRDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQAAED 358          

HSP 2 Score: 51.6026 bits (122), Expect = 6.256e-7
Identity = 31/133 (23.31%), Postives = 67/133 (50.38%), Query Frame = 3
Query:  315 LKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDSQGI--------QLVKWSNVKTNSFATTSSEE-IMIWDDRK--LTAPTHIFEAHNGNINDFDWSANMNIIVSCG-QDKKLKIWNL 677
            L+ H K    + W+P+    + +AS+D+  ++C+WDI  +      ++++ I        + V W  +  + F + + ++ +MIWD R    + P+H  +AH   +N   ++     I++ G  D+ + +W+L
Sbjct:  173 LRGHQKEGYGLSWNPNLSGHLLSASDDH--TVCLWDISGTPREGKVVEAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADQTVALWDL 303          

HSP 3 Score: 49.6766 bits (117), Expect = 2.376e-6
Identity = 37/149 (24.83%), Postives = 73/149 (48.99%), Query Frame = 3
Query:  300 KKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDSQGIQL--VKWSNVKTNSFATTSSEEIM-IWDDRKLT----------APTHIFEAHNGN---INDFDWSANMN-IIVSCGQDKKLKIWNLEESNQN 695
            K   S+ AH   ++ + ++P ++  +AT S D  +++ +WD+RN K   H  +S   ++  V+WS       A++ ++  + +WD  K+            P  +   H G+   I+DF W+ N   +I S  +D  +++W + E+  N
Sbjct:  264 KPSHSVDAHTAEVNCLSFNPYSEFILATGSAD--QTVALWDLRNLKLKLHSFESHRDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQAAEDVEDGPPELLFVHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYN 410          
BLAST of WD repeat-containing protein 59 vs. Ensembl Sea Lamprey
Match: pex7 (peroxisomal biogenesis factor 7 [Source:ZFIN;Acc:ZDB-GENE-050320-105])

HSP 1 Score: 51.6026 bits (122), Expect = 4.919e-7
Identity = 40/182 (21.98%), Postives = 81/182 (44.51%), Query Frame = 3
Query:  243 NEYFALTQSNVCKIFD------IELKKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFP--SHKIDSQGIQLVKWSNVKTNSFATTSS--EEIMIWDDRKLTAPTHIFEAHNGNINDFDWSANM-NIIVSCGQDKKLKIWNLEESNQNRIL----EEDYANYSMCKFD 743
            ++YF +  S    I         EL++F+     N  +  + W  DN++ + T S D   SL +WD    + P   ++  ++ +  V WS  +  +   + S      +WD   L++    +  H G +    WS ++ +   S   D+ L++W+++  +  RI+    +E+  +   CK+D
Sbjct:   37 SQYFGIAGSGSLLILHQTPEGITELRRFE----WNDSLFDVAWSEDNEHVLVTGSGDG--SLQLWDASQPEGPLRVYQGHTKEVYSVDWSQTRGENLVVSGSWDHTARVWDPAFLSSLAE-YRGHEGVVYSTVWSPHIPSCFASASGDQTLRVWDVKSPHAARIVIPAHQEEVLSCDWCKYD 211          
BLAST of WD repeat-containing protein 59 vs. Ensembl Sea Lamprey
Match: POC1A (POC1 centriolar protein A [Source:HGNC Symbol;Acc:HGNC:24488])

HSP 1 Score: 50.0618 bits (118), Expect = 2.411e-6
Identity = 47/214 (21.96%), Postives = 86/214 (40.19%), Query Frame = 3
Query:  315 LKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKF-PSHKIDSQGIQLVKWSNVKTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDWSANMNIIVSCGQDKKLKIWNLEESNQNRILEEDYANYSMCKFDTLDNIFTLNSSDVPSENFVSFWSIVEFRKLYSTPPHTNVITDFALIYPTETACQFVTLHRNSDLKVWEIN 953
             KAH   + S+ +  D ++ + TAS+D  KS+ +W +   KF  S    S  ++  K+S       + +    + +WD        H F  H G +N  D+  +   I + G D  +K+W++  +   +  +   A  +   F    N     S+D    + +    +VE R  Y+   H    T  A    +     F +   +  + VW+ N
Sbjct:   98 FKAHTATVRSVSFSADGQS-LVTASDD--KSIKVWTVHRQKFLYSLNQHSNWVRSAKFSPDGRLIVSGSDDRTVRVWDSNSREC-VHTFYEHGGFVNQVDFHPSGTCIAAAGTDNTVKVWDIRMNKLLQHYQVHGAAVNSLSFHPTGNYLITASND----STLKVLDLVEGRLFYTLHGHQGPATAVAF---SRAGDFFASGGSDEQVMVWKTN 300          
BLAST of WD repeat-containing protein 59 vs. Ensembl Sea Lamprey
Match: snrnp40 (small nuclear ribonucleoprotein 40 (U5) [Source:ZFIN;Acc:ZDB-GENE-040426-978])

HSP 1 Score: 47.7506 bits (112), Expect = 8.486e-6
Identity = 42/182 (23.08%), Postives = 84/182 (46.15%), Query Frame = 3
Query:  180 KRKESINKSSDPVLC---QWNKTCNEYFALTQSNVCKIFDIELKKF-QSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRN-------SKFPSHKIDSQGIQLVK--WSNVKTNSFATTSSEEIMIWD--DRKLTAPTHIFEAHNGNINDFDWSANMNIIVSCGQDKKLKIWNLE 680
            ++K S++   +   C    +N T ++  +    NV K++D+   K   ++K HN  ++ +   PD    ++ A ++   S+ IWDIR         K     + +    L+K  WS+  +   A ++   + IWD   R++    +    H G++ND  +     I++SC  DK+L +  ++
Sbjct:  173 RKKGSVHSFQNTYQCLSVTFNDTSDQILSGGIDNVIKVWDLRQNKLIYTMKGHNDSVTGLSLSPDGSYLLSNAMDN---SVRIWDIRPFAPMERCVKIFQGNVHNFEKNLLKCSWSHDGSKVSAGSADRFVYIWDTTSRRIL---YKLPGHAGSVNDVAFHPEEPIVLSCANDKRLYLGEIQ 348          
BLAST of WD repeat-containing protein 59 vs. Ensembl Yeast
Match: MTC5 (Subunit of SEACAT, a subcomplex of the SEA complex; Mtc1p, along with Rtc1p and Sea4p, redundantly inhibit the TORC1 inhibitory role of the Iml1p/SEACIT (Iml1p-Npr2p-Npr3p) subcomplex, a GAP for GTPase Gtr1p (EGOC subunit) in response to amino acid limitation, thereby resulting in activation of TORC1 signaling; SEA is a coatomer-related complex that associates dynamically with the vacuole; relative distribution to the vacuolar membrane decreases upon DNA replication stress [Source:SGD;Acc:S000002535])

HSP 1 Score: 59.6918 bits (143), Expect = 2.110e-9
Identity = 59/255 (23.14%), Postives = 107/255 (41.96%), Query Frame = 3
Query:  315 LKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDS--QGIQLVKWSNVKTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDWSA-NMNIIVSCGQDKKLKIWNLEESN--------------QNRILE--EDYANYSMCKFDTLDNIFTLNSSDVPSENFVSFWSIVEFRKLYSTPPHTNVITDFALIYPTETAC---------QFVTLHRNSDLKVWEINRSLVS------GKR 977
            L  H++ I+ I+++P + + +AT S D    +  WD+R+   P +   S       VKW+    N  A++   +I +WD RK + P    + H  ++N  D++    + I+S   D  +K W+  +S               + R L   E Y    M   +    +  L   D   +N        + + +Y+   H++ + DF  ++ +   C         Q VT  ++ DLK+W I+ S+        GKR
Sbjct:  110 LHGHSRAITDINFNPQHPDVLATCSVDTY--VHAWDMRSPHRPFYSTSSWRSAASQVKWNYKDPNVLASSHGNDIFVWDLRKGSTPLCSLKGHVSSVNSIDFNRFKYSEIMSSSNDGTVKFWDYSKSTTESKRTVTTNFPIWRGRYLPFGEGYCIMPMVGGNNAVYLINLCDDDDSEQN-----KKTKLQPIYAFKGHSDRVIDF--LWRSRHTCDGDYDDREFQLVTWSKDCDLKLWPISDSIYGKVNFDRGKR 355          
BLAST of WD repeat-containing protein 59 vs. Ensembl Yeast
Match: UTP13 (Nucleolar protein; component of the small subunit (SSU) processome containing the U3 snoRNA that is involved in processing of pre-18S rRNA [Source:SGD;Acc:S000004212])

HSP 1 Score: 52.7582 bits (125), Expect = 2.497e-7
Identity = 62/235 (26.38%), Postives = 97/235 (41.28%), Query Frame = 3
Query:  318 KAHNKIISSIDWHPDNKNQIATASNDNSKSL-------CIWDIRNSKFPSHKIDSQGIQLVKWSNVKTNSFATTSSEEIMI--WDDRKLTAPTHI---------FEAHNGNINDFDWSANMNIIVSCGQDKKLKIWNLEESNQNRILEEDYANY-------SMCKFDTLDNIFTLNSSDVPSENFVSFWSIVEFRKLYSTPPHTNVITDFALIYPTETACQFVTLHRNSDLKVWE 947
            + H  +++S+D   D    IATAS DN+  +       C +DI  +K+  H      + L    +     F  T+S ++ I  W   K TA   +           AH  +IN    S N +I  +   DK  KIWNLE    N  LE   AN+       S C++D L      +S D      V  WS+  F  + +   HTN +   + I   +   Q ++   +  +K+W+
Sbjct:  385 EGHEDLLNSLDATEDGL-WIATASKDNTAIVWRYNENSCKFDIY-AKYIGHSAAVTAVGLPNIVSKGYPEFLLTASNDLTIKKWIIPKPTASMDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATASYDKTCKIWNLE----NGELEATLANHKRGLWDVSFCQYDKL---LATSSGD----KTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQK---QLISCGADGLIKIWD 603          
BLAST of WD repeat-containing protein 59 vs. Ensembl Yeast
Match: SEC31 (Component of the Sec13p-Sec31p complex of the COPII vesicle coat; COPII coat is required for vesicle formation in ER to Golgi transport; mutant has increased aneuploidy tolerance [Source:SGD;Acc:S000002354])

HSP 1 Score: 50.447 bits (119), Expect = 1.410e-6
Identity = 41/165 (24.85%), Postives = 67/165 (40.61%), Query Frame = 3
Query:  228 WNKTCNEYFA-LTQSNVCKIFDIELKK---FQSLKAHNKII----SSIDWHPDNKNQIATASN-DNSKSLCIWDIRNSKFPSHKIDSQGIQLVKWSNVKTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDW-SANMNIIVSCGQDKKLKIWNLEESNQ 692
            WN++    FA    SN   I+D++ KK     S  + N  I    S ++WHP N  ++ATA+  DN  S+ IWD+RN+  P   ++                                        + H   I   DW   + ++++S G+D  + +WN E + Q
Sbjct:  168 WNQSLAHVFASAGSSNFASIWDLKAKKEVIHLSYTSPNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILIWDLRNANTPLQTLN----------------------------------------QGHQKGILSLDWCHQDEHLLLSSGRDNTVLLWNPESAEQ 292          
BLAST of WD repeat-containing protein 59 vs. Ensembl Yeast
Match: RSA4 (WD-repeat protein involved in ribosome biogenesis; may interact with ribosomes; required for maturation and efficient intra-nuclear transport or pre-60S ribosomal subunits, localizes to the nucleolus [Source:SGD;Acc:S000000668])

HSP 1 Score: 47.7506 bits (112), Expect = 7.525e-6
Identity = 35/128 (27.34%), Postives = 59/128 (46.09%), Query Frame = 3
Query:  300 KKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPS-HKIDSQGIQLVKWSNVKTNSFATTSSEEIMIWD--DRKLTAPTHIFEAHNGNINDFDWSANMNIIVSCGQDKKLKIWN 674
            K    +  H K+++ + + PD +  I +AS DNS  L  WD R+ KF S  +     +  V WS+      + +    + +WD   RKL+        H   +   DWS +   + S G+DK +++W 
Sbjct:  393 KPIARMTGHQKLVNHVAFSPDGR-YIVSASFDNSIKL--WDGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVD---LPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLWT 514          
BLAST of WD repeat-containing protein 59 vs. Ensembl Nematostella
Match: EDO32893 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STS6])

HSP 1 Score: 59.3066 bits (142), Expect = 7.278e-9
Identity = 55/252 (21.83%), Postives = 108/252 (42.86%), Query Frame = 3
Query:  231 NKTCNEYFALTQSNVCKIFDIELKKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDSQG----IQLVKWSNVKTNSFATTSSEE--IMIWDDRKLTAP-THIF-----EAHNGNINDFDWSANMNIIVSCGQDKKLKIWNLEESNQNRILEEDYANYSMCKFDTLDNIFTLNSSDVPSENFVSFWSIVEFRKLYSTPPHTNVITDFALIYPTETACQFVTLHRNSDLKVWEI 950
             KT +    +T SN  +++++E    + ++ H+K+I  +D   D   +I T S D++  + +WD+ +   P       G    +  V WS   +  F  + S++  I +W+  K  A  + +F     +AH+ +IN    S N  ++V+  QDK  K+W + +     +           +F   D      S D    + +  WS+ ++  + +   H+N +     I       Q +T   +  +K+W I
Sbjct:  373 GKTNDHLAVVTNSNQLRLYNLETLDCRMVEGHSKMILCLDVCADG-TKIVTGSKDHT--VRVWDVSDCSNPRCLAVGNGHTHAVSGVAWSRT-SQRFVISCSQDLTIKVWEATKKAAEESSMFVKMTVKAHDKDINSVAVSPNDKLVVTGSQDKTAKVWRIADGILMGVARGHKRGVWCAQFSPFDKCIATASGD----STIKIWSLTDYTCVKTFEGHSNSVLKVVFI---SNGMQLITSGTDGLVKLWTI 613          
BLAST of WD repeat-containing protein 59 vs. Ensembl Nematostella
Match: EDO42058 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2K4])

HSP 1 Score: 58.5362 bits (140), Expect = 7.341e-9
Identity = 44/178 (24.72%), Postives = 83/178 (46.63%), Query Frame = 3
Query:  195 INKSSDPVLCQWNKTCNEYFALTQSNVCKIFDIELKKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIR--NSKFPSHKIDSQGIQLVKWSNVKTNSF--ATTSSEE-IMIWDDRKLTAPTHIFEAHNGNINDFDWSA-NMNIIVSCGQDKKLKIWNLEESNQNRILEE 710
            ++ S D  +C W+ +          +  +IF            H+ ++  + WH  +++   + ++D+   L IWD R  NS   +H +D+   ++   S    + F  AT S+++ + +WD R L    H FE+H   I    WS  N  I+ S G D++L +W+L +  + +  E+
Sbjct:  179 LSASDDHTICLWDISSGISKEQKTVDAMRIF----------TGHSAVVEDVSWHLLHESLFGSVADDHK--LMIWDTRQTNSNKAAHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSAED 344          

HSP 2 Score: 49.2914 bits (116), Expect = 5.654e-6
Identity = 35/145 (24.14%), Postives = 71/145 (48.97%), Query Frame = 3
Query:  300 KKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDSQGIQL--VKWSNVKTNSFATTSSEE-IMIWDDRKLT----------APTHIFEAHNGN---INDFDWSANMN-IIVSCGQDKKLKIWNLEE 683
            K   ++ AH   ++ + ++P ++  +AT S D  K++ +WD+RN K   H  +S   ++  V+WS       A++ ++  + +WD  K+            P  +   H G+   I+DF W+ N   ++ S  +D  +++W + E
Sbjct:  250 KAAHTVDAHTAEVNCLSFNPYSEFILATGSAD--KTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVLCSVSEDNIMQVWQMAE 392          
BLAST of WD repeat-containing protein 59 vs. Ensembl Nematostella
Match: EDO45890 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRV3])

HSP 1 Score: 56.225 bits (134), Expect = 4.076e-8
Identity = 35/123 (28.46%), Postives = 64/123 (52.03%), Query Frame = 3
Query:  324 HNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSK--FPSHKIDSQGIQLVKWSNVKTNSFATTS-SEEIMIWDDRKLTAPTHIFEAHNGNINDFDWSA-NMNIIVSCGQDKKLKIWNLE 680
            H + ++ I +HP +   + + S D +  +  +DIR     F +H   S+ I+ +++S      FAT   +  + +WD R+     H F AHNG +   DW   + N I + G+DK +K+W+++
Sbjct:  100 HKRTVNRIKFHPQDTTLLLSGSQDGT--MNCFDIRKQSVLFSAHG-KSESIRDIEFSPFDGKQFATACDNGNVQLWDMRRTDTYYHQFMAHNGPVFTLDWHPEDRNWIATGGRDKCVKVWDVQ 219          

HSP 2 Score: 55.8398 bits (133), Expect = 5.241e-8
Identity = 33/128 (25.78%), Postives = 58/128 (45.31%), Query Frame = 3
Query:  306 FQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDS-QGIQLVKWSNVKTNSFATTS---SEEIMIWDDRKLTAPTHIFEAHNGNINDFDW-----SANMNIIVSCGQDKKL 662
            +    AHN  + ++DWHP+++N IAT   D  K + +WD++    P + I +   +  +KW   K    A+ +     +I +WD R+   P   F  H        W       + ++ +SC +D  L
Sbjct:  181 YHQFMAHNGPVFTLDWHPEDRNWIATGGRD--KCVKVWDVQGKATPVNNIQTISSVSRIKWRPQKKYQIASCALLVDFDIHVWDIRRPYIPYATFSEHKDVPTGIMWRQTSRGKDPHVFLSCSKDCTL 306          
BLAST of WD repeat-containing protein 59 vs. Ensembl Nematostella
Match: EDO43295 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ49])

HSP 1 Score: 54.6842 bits (130), Expect = 1.512e-7
Identity = 43/223 (19.28%), Postives = 101/223 (45.29%), Query Frame = 3
Query:  222 CQWNKTCNEYFALTQSNVCKIFDI-ELKKFQSLKAHNKIISSIDWHPDNKNQI-----ATASNDNSKSLCIWDIRNSKFPSHKIDSQGIQLVKWSNVKTNSFATTSS--EEIMIWDDRKLTAPTHIFEAHNGNINDFDWSANMNIIVSCGQDKKLKIWNLEESNQNRILEEDYANYSMCKFDTLDNIFTLNSSDVPSENFVSFWSIVEFRKLYSTPPHTNVIT 866
            CQ++         + S +CK++ + + +   ++K HN+ + SI +HP  +  +     + AS+    ++ +W+ + S+ P   I+    ++ + +   +  F  T+       +WD  +L    H  E H+  + D  +  + +++ +CG D +  +W+L       ++  D     +   D   N + + +     +  V  W + + + +Y+ P HTN+I+
Sbjct:  231 CQFSPDSKLLATASWSGLCKLWSVPDCEPVSTMKGHNERVCSIVFHPQARLSLDETTPSMASSGADGTVLLWNFK-SENPIANIEGHDKRVPRLAYHPSGRFLGTTCFDNSWRLWDLEQLKEVLHQ-EGHSREVYDIAFQCDGSMVATCGLDARGMVWDLRTGQC--VMPLDGHLQKVLGIDFSPNGYHIATGS--EDQKVIVWDLRKRQAIYTIPAHTNLIS 447          
BLAST of WD repeat-containing protein 59 vs. Ensembl Nematostella
Match: EDO40932 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5U0])

HSP 1 Score: 54.6842 bits (130), Expect = 1.568e-7
Identity = 45/164 (27.44%), Postives = 70/164 (42.68%), Query Frame = 3
Query:  198 NKSSDPVLCQWNKTCNEYFALTQSNVC-KIFDIELKKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDSQGIQL-VKWSNVKTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDWSANMNIIVSCGQDKKLKIWNLEE 683
            N S D    +WN     Y A    + C +I+D E +   +L+ H   + S+ W+    N +  A  D  K+  IWD             Q   L V W N   NSFA+ S+++++      L  P   F  H   +N   W  +  ++ SC  D   K+W+L+E
Sbjct:  205 NNSYDVTSLEWNSE-GTYLATGCYDGCARIWDPEGQLVTTLREHKGPLFSVKWN-KKGNHLLGAGVD--KACIIWDANTWDVKQQFAFHQAPTLDVDWQN--NNSFASCSTDKLIHVCRLGLDKPIKSFRGHMSEVNAIRWDPSGTLLASCSDDMSAKVWSLKE 362          
BLAST of WD repeat-containing protein 59 vs. Ensembl Medaka
Match: wdr59 (WD repeat domain 59 [Source:NCBI gene;Acc:101168349])

HSP 1 Score: 142.124 bits (357), Expect = 5.999e-34
Identity = 181/784 (23.09%), Postives = 325/784 (41.45%), Query Frame = 3
Query:   75 KEIQASSFAMNSNGSLGLFCGLYEILLLSFDDPKRK-RKESINKSSDPVLCQWNKTCNEY--FALTQSNVCKIF---DIELKKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDS-QGIQLVKWSNVKTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDWSANMN-IIVSCGQDKKLKIWNLEE--------SNQNRILEEDYANYSMCKFDTLDNIFTLNSSDVPSENFVSFWSIVEF-RKLYSTPPHTNVITDFALIYPTETAC---QFVTLHRNSDLKVWEINRSLVSGKRKRGGSSHVAGLDNSISNDRLFLSPSPDHSVNKSKAIPVGQSESFVNMHKNDILSSIIAHRSDPNLIMRDKSNKSLS-EDQEIRVREFEKLSNTNQVTFEKSVDMRS--VTAHF-----NLI---------NLKCSIQFIYRTSIGDIVFLDVLVLRQRAEKI-RPQNLEELEKILKTTIDDCRRNNILPIEKCVDVTLDYLNKLSSRFSLRAIRSLKDQSTP--IHSFTSLPDVKVPFPRICGASFSPTGLLVCFLSPEGYMSRFHSA----PRSLADISKLAN---------TNSSSKGFFYEMNKNTTQKQ-------YYKSNIRKLKSTEFNTETPSRKLSTQSIQKQTHIVLIYNVLQLSLFNVSLAKNYSLKISNAEAMCHKNLSAVTNCNRKDLFEFWQYCAILANGCKPSCNISAGYIRPWATQSMGRGLCELWMKHFLDINDIQSAAMLVIVMRA 2246
            ++ QA++ +++  GS  +  G   + L+  + P    RK   +   D    QWN   +E   FA + +    ++   D   +   SL+ H ++IS +DW   +   + T+S D    + IWD R+++ P+  + +  G   VKW+    N  A++   ++ IWD RK         AH   I+  DW  +   +  +  QD  ++ W+  +        S Q  + +  Y  +S       + + T+    +  EN +  WS ++    +++   H +V+ +F    P +      Q VT  R+  L++W ++  L       G    + G+  ++  ++   S  P+  ++ +    + Q  S  +  + D+          P   +     +  S  +Q+IR            V  E     RS  V+AHF     +L+         N   + QF+  T+I          ++ + +KI R  +L+++++ L   ++ C R  +  +E   D+T +  +  S  F L    +   Q+ P   +++ S  D  +PFPR  GA F  TG LV F  P   M R   A    PRSL+ +S   +         + S S    Y  +   + K        YYK      KS  F T+      S + I K    V++ ++  L   + +L +NY L +S+ +  C KN +A     R+D+ + W   A  A     S +       PWA    GR L E  + H+  ++D+Q+ AML  V +A
Sbjct:   15 RDAQATAMSVDCLGSHAVLSGRRFLYLVDLEAPSEPPRKIGRHSKWDVGTVQWNPHGSEAHIFAASSNQRVDLYSWRDGCGEAHSSLQGHTRVISDLDWSWFDPELLVTSSVDTY--IYIWDTRDARKPTVALSAVAGASQVKWNRKNQNLLASSHDGDVRIWDKRKPNTAVEYVAAHLSKIHGLDWHPDGEFVFATSSQDNSVRFWDFRQPRKYLNILSCQVPVWKARYTPFS-------NGLVTVMVPQLRRENSLLLWSTLDLNSPVHAFVGHDDVVLEFQW-RPQKAGSKDFQLVTWSRDQTLRIWRVDPQLQKLCVSDGVEDLMEGMSLTVDTEKSPSSQGPEGQLSGAGDGLLDQGGSQSSGTRQDLA---------PGSGLTQTLQQEFSLVNQQIR-----------NVNMEMDAMNRSCVVSAHFGSHQVHLVVKFPDQYPNNAAPTFQFVSPTTISS-------TMKTKIQKILRDTSLQKVKRNLN-CLEPCVRQLVSCLES--DMTQED-SPASGPFVLPNPVTPSLQAFPRVTNTYGSYQDANIPFPRTSGARFCGTGCLVYFTRPIS-MHRSAPAIEPTPRSLSALSAYHSGVLTPMKMRSESQSTLRLYSGSPTRSDKDTVSISSFYYKER----KSRRFKTKREGADYSNRPI-KLAGKVIVQDISCLLPVHKTLGENYILNMSDIQETCQKNAAAALAVERRDVAKVWAL-ASAATSQDLSPDSDPDTETPWARHPFGRRLLETLLDHYSHMSDVQTLAMLCSVFKA 750          
BLAST of WD repeat-containing protein 59 vs. Ensembl Medaka
Match: wdr59 (WD repeat domain 59 [Source:NCBI gene;Acc:101168349])

HSP 1 Score: 137.502 bits (345), Expect = 1.951e-32
Identity = 184/801 (22.97%), Postives = 328/801 (40.95%), Query Frame = 3
Query:   75 KEIQASSFAMNSNGSLGLFCGLYEILLLSFDDPKRK-RKESINKSSDPVLCQWNKTCNEY--FALTQSNVCKIF---DIELKKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDS-QGIQLVKWSNVKTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDWSANMN-IIVSCGQDKKLKIWNLEE--------SNQNRILEEDYANYSMCKFDTLDNIFTLNSSDVPSENFVSFWSIVEF-RKLYSTPPHTNVITDFALIYPTETAC---QFVTLHRNSDLKVWEINRSLVSGKRKRGGSSHVAGLDNSISNDRLFLSPSPDHSVNKSKAIPVGQSESFVNMHKNDILSSIIAHRSDPNLIMRDKSNKSLS-EDQEIRVREFEKLSNTNQVTFEKSVDMRS--VTAHF-----NLI---------NLKCSIQFIYRTSIGDIVFLDVLVLRQRAEKI-RPQNLEELEKILKTTIDDCRRNNILPIEKCVDVTLDYLNKLSSRFSLRAIRSLKDQSTP--IHSFTSLPDVKVPFPRICGASFSPTGLLVCFLSPEGYMSRFHSA----PRSLADISKLAN---------TNSSSKGFFYEMNKNTTQKQ-------YYKSNIRKL-----------------KSTEFNTETPSRKLSTQSIQKQTHIVLIYNVLQLSLFNVSLAKNYSLKISNAEAMCHKNLSAVTNCNRKDLFEFWQYCAILANGCKPSCNISAGYIRPWATQSMGRGLCELWMKHFLDINDIQSAAMLVIVMRA 2246
            ++ QA++ +++  GS  +  G   + L+  + P    RK   +   D    QWN   +E   FA + +    ++   D   +   SL+ H ++IS +DW   +   + T+S D    + IWD R+++ P+  + +  G   VKW+    N  A++   ++ IWD RK         AH   I+  DW  +   +  +  QD  ++ W+  +        S Q  + +  Y  +S       + + T+    +  EN +  WS ++    +++   H +V+ +F    P +      Q VT  R+  L++W ++  L       G    + G+  ++  ++   S  P+  ++ +    + Q  S  +  + D+          P   +     +  S  +Q+IR            V  E     RS  V+AHF     +L+         N   + QF+  T+I          ++ + +KI R  +L+++++ L   ++ C R  +  +E   D+T +  +  S  F L    +   Q+ P   +++ S  D  +PFPR  GA F  TG LV F  P   M R   A    PRSL+ +S   +         + S S    Y  +   + K        YYK   RKL                 KS  F T+      S + I K    V++ ++  L   + +L +NY L +S+ +  C KN +A     R+D+ + W   A  A     S +       PWA    GR L E  + H+  ++D+Q+ AML  V +A
Sbjct:   15 RDAQATAMSVDCLGSHAVLSGRRFLYLVDLEAPSEPPRKIGRHSKWDVGTVQWNPHGSEAHIFAASSNQRVDLYSWRDGCGEAHSSLQGHTRVISDLDWSWFDPELLVTSSVDTY--IYIWDTRDARKPTVALSAVAGASQVKWNRKNQNLLASSHDGDVRIWDKRKPNTAVEYVAAHLSKIHGLDWHPDGEFVFATSSQDNSVRFWDFRQPRKYLNILSCQVPVWKARYTPFS-------NGLVTVMVPQLRRENSLLLWSTLDLNSPVHAFVGHDDVVLEFQW-RPQKAGSKDFQLVTWSRDQTLRIWRVDPQLQKLCVSDGVEDLMEGMSLTVDTEKSPSSQGPEGQLSGAGDGLLDQGGSQSSGTRQDLA---------PGSGLTQTLQQEFSLVNQQIR-----------NVNMEMDAMNRSCVVSAHFGSHQVHLVVKFPDQYPNNAAPTFQFVSPTTISS-------TMKTKIQKILRDTSLQKVKRNLN-CLEPCVRQLVSCLES--DMTQED-SPASGPFVLPNPVTPSLQAFPRVTNTYGSYQDANIPFPRTSGARFCGTGCLVYFTRPIS-MHRSAPAIEPTPRSLSALSAYHSGVLTPMKMRSESQSTLRLYSGSPTRSDKDTVSISSFYYKE--RKLPVSASRRWSVQTLYDWPKSRRFKTKREGADYSNRPI-KLAGKVIVQDISCLLPVHKTLGENYILNMSDIQETCQKNAAAALAVERRDVAKVWAL-ASAATSQDLSPDSDPDTETPWARHPFGRRLLETLLDHYSHMSDVQTLAMLCSVFKA 769          
BLAST of WD repeat-containing protein 59 vs. Ensembl Medaka
Match: rbbp4 (RB binding protein 4, chromatin remodeling factor [Source:NCBI gene;Acc:101155071])

HSP 1 Score: 61.2326 bits (147), Expect = 3.002e-9
Identity = 47/178 (26.40%), Postives = 84/178 (47.19%), Query Frame = 3
Query:  195 INKSSDPVLCQWNKTCNEYFALTQSNVCKIFDIELKKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIR--NSKFPSHKIDSQGIQLVKWSNVKTNSF--ATTSSEE-IMIWDDRKLTAPTHIFEAHNGNINDFDWSA-NMNIIVSCGQDKKLKIWNLEESNQNRILEE 710
            ++ S D  +C W+ +       T     KI D +         H  ++  + WH  +++   + ++D  + L IWD R  N+  PSH +D+   ++   S    + F  AT S+++ + +WD R L    H FE+H   I    WS  N  I+ S G D++L +W+L +  + +  E+
Sbjct:  194 LSASDDHTICLWDIS-------TVPKEGKIVDAK----TIFTGHTAVVEDVSWHLLHESLFGSVADD--QKLMIWDTRSNNTSKPSHAVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPED 358          

HSP 2 Score: 52.373 bits (124), Expect = 2.125e-6
Identity = 33/133 (24.81%), Postives = 66/133 (49.62%), Query Frame = 3
Query:  315 LKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDSQGI--------QLVKWSNVKTNSFATTSSEE-IMIWDDRK--LTAPTHIFEAHNGNINDFDWSANMNIIVSCG-QDKKLKIWNL 677
            L+ H K    + W+P+    + +AS+D+  ++C+WDI         +D++ I        + V W  +  + F + + ++ +MIWD R    + P+H  +AH   +N   ++     I++ G  DK + +W+L
Sbjct:  173 LRGHQKEGYGLSWNPNLSGCLLSASDDH--TICLWDISTVPKEGKIVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHAVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDL 303          
BLAST of WD repeat-containing protein 59 vs. Ensembl Medaka
Match: rbb4l (histone-binding protein RBBP7 [Source:NCBI gene;Acc:101156710])

HSP 1 Score: 58.5362 bits (140), Expect = 2.834e-8
Identity = 38/136 (27.94%), Postives = 69/136 (50.74%), Query Frame = 3
Query:  321 AHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIR--NSKFPSHKIDSQGIQLVKWSNVKTNSF--ATTSSEE-IMIWDDRKLTAPTHIFEAHNGNINDFDWSA-NMNIIVSCGQDKKLKIWNLEESNQNRILEE 710
             H  ++  + WH  +++   + ++D  + L IWD R  N+   SH +D+   ++   S    + F  AT S+++ + +WD R L    H FE+H   I    WS  N  I+ S G D++L +W+L +  + +  E+
Sbjct:  262 GHTAVVEDVSWHLLHESLFGSVADD--QKLMIWDTRSNNTSKASHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSAED 395          

HSP 2 Score: 50.8322 bits (120), Expect = 6.347e-6
Identity = 33/133 (24.81%), Postives = 65/133 (48.87%), Query Frame = 3
Query:  315 LKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDSQGI--------QLVKWSNVKTNSFATTSSEE-IMIWDDRK--LTAPTHIFEAHNGNINDFDWSANMNIIVSCG-QDKKLKIWNL 677
            LK H K    + W+P+    + +AS+D+  ++C+WDI         +D++ I        + V W  +  + F + + ++ +MIWD R    +  +H  +AH   +N   ++     I++ G  DK + +W+L
Sbjct:  210 LKGHQKEGYGLSWNPNLSGNLLSASDDH--TICLWDIGAGPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKASHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDL 340          
BLAST of WD repeat-containing protein 59 vs. Ensembl Medaka
Match: rbb4l (histone-binding protein RBBP7 [Source:NCBI gene;Acc:101156710])

HSP 1 Score: 58.151 bits (139), Expect = 3.612e-8
Identity = 38/136 (27.94%), Postives = 69/136 (50.74%), Query Frame = 3
Query:  321 AHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIR--NSKFPSHKIDSQGIQLVKWSNVKTNSF--ATTSSEE-IMIWDDRKLTAPTHIFEAHNGNINDFDWSA-NMNIIVSCGQDKKLKIWNLEESNQNRILEE 710
             H  ++  + WH  +++   + ++D  + L IWD R  N+   SH +D+   ++   S    + F  AT S+++ + +WD R L    H FE+H   I    WS  N  I+ S G D++L +W+L +  + +  E+
Sbjct:  262 GHTAVVEDVSWHLLHESLFGSVADD--QKLMIWDTRSNNTSKASHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSAED 395          

HSP 2 Score: 50.447 bits (119), Expect = 7.352e-6
Identity = 33/133 (24.81%), Postives = 65/133 (48.87%), Query Frame = 3
Query:  315 LKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDSQGI--------QLVKWSNVKTNSFATTSSEE-IMIWDDRK--LTAPTHIFEAHNGNINDFDWSANMNIIVSCG-QDKKLKIWNL 677
            LK H K    + W+P+    + +AS+D+  ++C+WDI         +D++ I        + V W  +  + F + + ++ +MIWD R    +  +H  +AH   +N   ++     I++ G  DK + +W+L
Sbjct:  210 LKGHQKEGYGLSWNPNLSGNLLSASDDH--TICLWDIGAGPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKASHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDL 340          
BLAST of WD repeat-containing protein 59 vs. Planmine SMEST
Match: SMESG000025367.1 (SMESG000025367.1)

HSP 1 Score: 1943.32 bits (5033), Expect = 0.000e+0
Identity = 978/1019 (95.98%), Postives = 987/1019 (96.86%), Query Frame = 3
Query:   45 MNIVREDQRPKEIQASSFAMNSNGSLGLFCGLYEILLLSFDDPKRKRKESINKSSDPVLCQWNKTCNEYFALTQSNVCKIFDIELKKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDSQGIQLVKWSNVKTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDWSANMNIIVSCGQDKKLKIWNLEESNQNRILEEDYANYSMCKFDTLDNIFTLNSSDVPSENFVSFWSIVEFRKLYSTPPHTNVITDFALIYPTETACQFVTLHRNSDLKVWEINRSLVSGKRKRGGSSHVAGLDNSISNDRLFLSPSPDHSVNKSKAIPVGQSESFVNMHKNDILSSIIAHRSDPNLIMRDKSNKSLSEDQEIRVREFEKLSNTNQVTFEKSVDMRSVTAHFNLINLKCSIQFIYRTSIGDIVFLDVLVLRQRAEKIRPQNLEELEKILKTTIDDCRRNNILPIEKCVDVTLDYLNKLSSRFSLRAIRSLKDQSTPIHSFTSLPDVKVPFPRICGASFSPTGLLVCFLSPEGYMSRFHSAPRSLADISKLANTNSSSKGFFYEMNKNTTQKQYYKSNIRKLKSTEFNTETPSRKLSTQSIQKQTHIVLIYNVLQLSLFNVSLAKNYSLKISNAEAMCHKNLSAVTNCNRKDLFEFWQYCAILANGCKPSCNISAGYIRPWATQSMGRGLCELWMKHFLDINDIQSAAMLVIVMRAIDLDLENNFKENKNNASSISLTSGSHKNISQESLMDNIHSDTLNSNLCVSIFVDGLQKYKIYDDKRNATLIVMEINEGSPGRFRNNSFGEQEITNNLKKGDNLIPDSSLQHFQQNEQIRLIDPAKNLQYNRVLLHYVLMLSAHKLLNFSSKIVQKILPAKFFNLIFGHYNFDVFLLRNCINDHRCKSVYVDPNRLTVICSECPTRTVSVNNQDTSKTPIICSVCRNFVRGLFSVCDQCNHGGHADHLNSWFARSXXXXXXXXXXXXXXLPSKDFNFEFFVPISAM 3101
            MNIVREDQRPKEIQASSFA+NSNGSLGLFCGLYEILLLSFDDPKRKRKESINKSSDPVLCQWNKTCNEYFALTQSNVCKIFDIELKKFQSLKAHN IISSIDWHPDNKNQIATAS+DNSKSLCIWDIRNSKFPS+KIDSQGIQLVKWSNVKTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDWSANMNIIVSCGQDKKLKIWNLEESNQNRILEEDYANYSMCKFDTLDNIFTLNSSDVPSENFVSFWSIV+FRKLYSTPPHTNVITDFALIYPTETAC+FVTLHRNSDLK+WEINRSLVSGKRKRGGSSHVAGLDNSISNDRLFLSPSPDHSVNKSKAIPVGQSESFVNMHKNDILSSIIAHRSDPNLIMRDKSNKSLSEDQEIRVREFEKLSNTNQVTFEKSVDMRSVTAHFNLINLKCSIQFIYRTSIGDIVFLDVLVLRQRAEKIRPQNLEELEKILKTTIDDCRRNNILPIEKCVDVTLDYLNKLSSRFSLRAIRSLKDQSTPIHSFTSLPDVKVPFPRICGASFSPTGLLVCFLSPEGYMSRFHSAPRSLADISKLANTNSSSKGFFYEMNKNTTQKQYYKSNIRKLKSTEFNTETPSRKLSTQSIQKQTHIVLIYNVLQLSLFNVSLAKNYSLKISNAE MCHKNLSAVTNCNRKDLFEFWQYC ILANGCKPSCNISAGYIRPWATQSMGRGLCELWMKHFLDINDIQSAAMLVIVMRAIDLDLENNFKENKNNASSISLTSGSHKNISQESLMDNIHSDTL  +     +        I D    +TL         PGRFRNNSFGEQEITNNLKKGDNLIPDSSLQHFQQNEQIRLIDPAKNLQYNRVLLHYVLMLSAHKLLNFSSKIVQKILPAKFFNLIFGHYNFDVFLLRNCINDHRCKSVYVDPNRLTVICSECPTRTVSVNNQDTSKTPIICSVCRNFVRGLFSVCDQCNHGGHADHLNSWFARSGAQAACPAGCGCVCLPSKDFNFEFFVPISAM
Sbjct:    1 MNIVREDQRPKEIQASSFAINSNGSLGLFCGLYEILLLSFDDPKRKRKESINKSSDPVLCQWNKTCNEYFALTQSNVCKIFDIELKKFQSLKAHNTIISSIDWHPDNKNQIATASSDNSKSLCIWDIRNSKFPSNKIDSQGIQLVKWSNVKTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDWSANMNIIVSCGQDKKLKIWNLEESNQNRILEEDYANYSMCKFDTLDNIFTLNSSDVPSENFVSFWSIVDFRKLYSTPPHTNVITDFALIYPTETACKFVTLHRNSDLKIWEINRSLVSGKRKRGGSSHVAGLDNSISNDRLFLSPSPDHSVNKSKAIPVGQSESFVNMHKNDILSSIIAHRSDPNLIMRDKSNKSLSEDQEIRVREFEKLSNTNQVTFEKSVDMRSVTAHFNLINLKCSIQFIYRTSIGDIVFLDVLVLRQRAEKIRPQNLEELEKILKTTIDDCRRNNILPIEKCVDVTLDYLNKLSSRFSLRAIRSLKDQSTPIHSFTSLPDVKVPFPRICGASFSPTGLLVCFLSPEGYMSRFHSAPRSLADISKLANTNSSSKGFFYEMNKNTTQKQYYKSNIRKLKSTEFNTETPSRKLSTQSIQKQTHIVLIYNVLQLSLFNVSLAKNYSLKISNAEEMCHKNLSAVTNCNRKDLFEFWQYCTILANGCKPSCNISAGYIRPWATQSMGRGLCELWMKHFLDINDIQSAAMLVIVMRAIDLDLENNFKENKNNASSISLTSGSHKNISQESLMDNIHSDTLMPHYPTQNYYAAYHPCAISDTGSRSTL-------PGPGRFRNNSFGEQEITNNLKKGDNLIPDSSLQHFQQNEQIRLIDPAKNLQYNRVLLHYVLMLSAHKLLNFSSKIVQKILPAKFFNLIFGHYNFDVFLLRNCINDHRCKSVYVDPNRLTVICSECPTRTVSVNNQDTSKTPIICSVCRNFVRGLFSVCDQCNHGGHADHLNSWFARSGAQAACPAGCGCVCLPSKDFNFEFFVPISAM 1012          
BLAST of WD repeat-containing protein 59 vs. Planmine SMEST
Match: SMESG000025367.1 (SMESG000025367.1)

HSP 1 Score: 1652.49 bits (4278), Expect = 0.000e+0
Identity = 804/813 (98.89%), Postives = 810/813 (99.63%), Query Frame = 3
Query:   45 MNIVREDQRPKEIQASSFAMNSNGSLGLFCGLYEILLLSFDDPKRKRKESINKSSDPVLCQWNKTCNEYFALTQSNVCKIFDIELKKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDSQGIQLVKWSNVKTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDWSANMNIIVSCGQDKKLKIWNLEESNQNRILEEDYANYSMCKFDTLDNIFTLNSSDVPSENFVSFWSIVEFRKLYSTPPHTNVITDFALIYPTETACQFVTLHRNSDLKVWEINRSLVSGKRKRGGSSHVAGLDNSISNDRLFLSPSPDHSVNKSKAIPVGQSESFVNMHKNDILSSIIAHRSDPNLIMRDKSNKSLSEDQEIRVREFEKLSNTNQVTFEKSVDMRSVTAHFNLINLKCSIQFIYRTSIGDIVFLDVLVLRQRAEKIRPQNLEELEKILKTTIDDCRRNNILPIEKCVDVTLDYLNKLSSRFSLRAIRSLKDQSTPIHSFTSLPDVKVPFPRICGASFSPTGLLVCFLSPEGYMSRFHSAPRSLADISKLANTNSSSKGFFYEMNKNTTQKQYYKSNIRKLKSTEFNTETPSRKLSTQSIQKQTHIVLIYNVLQLSLFNVSLAKNYSLKISNAEAMCHKNLSAVTNCNRKDLFEFWQYCAILANGCKPSCNISAGYIRPWATQSMGRGLCELWMKHFLDINDIQSAAMLVIVMRAIDLDLENNFKENKNNASSISLTSGSHKNISQESLMDNIHSDTLNSNLCVSIFVDGLQKYKIYDDKRNATLIVMEINEGS 2483
            MNIVREDQRPKEIQASSFA+NSNGSLGLFCGLYEILLLSFDDPKRKRKESINKSSDPVLCQWNKTCNEYFALTQSNVCKIFDIELKKFQSLKAHN IISSIDWHPDNKNQIATAS+DNSKSLCIWDIRNSKFPS+KIDSQGIQLVKWSNVKTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDWSANMNIIVSCGQDKKLKIWNLEESNQNRILEEDYANYSMCKFDTLDNIFTLNSSDVPSENFVSFWSIV+FRKLYSTPPHTNVITDFALIYPTETAC+FVTLHRNSDLK+WEINRSLVSGKRKRGGSSHVAGLDNSISNDRLFLSPSPDHSVNKSKAIPVGQSESFVNMHKNDILSSIIAHRSDPNLIMRDKSNKSLSEDQEIRVREFEKLSNTNQVTFEKSVDMRSVTAHFNLINLKCSIQFIYRTSIGDIVFLDVLVLRQRAEKIRPQNLEELEKILKTTIDDCRRNNILPIEKCVDVTLDYLNKLSSRFSLRAIRSLKDQSTPIHSFTSLPDVKVPFPRICGASFSPTGLLVCFLSPEGYMSRFHSAPRSLADISKLANTNSSSKGFFYEMNKNTTQKQYYKSNIRKLKSTEFNTETPSRKLSTQSIQKQTHIVLIYNVLQLSLFNVSLAKNYSLKISNAE MCHKNLSAVTNCNRKDLFEFWQYC ILANGCKPSCNISAGYIRPWATQSMGRGLCELWMKHFLDINDIQSAAMLVIVMRAIDLDLENNFKENKNNASSISLTSGSHKNISQESLMDNIHSDTLNSNLCVSIFVDGLQKYKIYDDKRNATLIVMEINEGS
Sbjct:    1 MNIVREDQRPKEIQASSFAINSNGSLGLFCGLYEILLLSFDDPKRKRKESINKSSDPVLCQWNKTCNEYFALTQSNVCKIFDIELKKFQSLKAHNTIISSIDWHPDNKNQIATASSDNSKSLCIWDIRNSKFPSNKIDSQGIQLVKWSNVKTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDWSANMNIIVSCGQDKKLKIWNLEESNQNRILEEDYANYSMCKFDTLDNIFTLNSSDVPSENFVSFWSIVDFRKLYSTPPHTNVITDFALIYPTETACKFVTLHRNSDLKIWEINRSLVSGKRKRGGSSHVAGLDNSISNDRLFLSPSPDHSVNKSKAIPVGQSESFVNMHKNDILSSIIAHRSDPNLIMRDKSNKSLSEDQEIRVREFEKLSNTNQVTFEKSVDMRSVTAHFNLINLKCSIQFIYRTSIGDIVFLDVLVLRQRAEKIRPQNLEELEKILKTTIDDCRRNNILPIEKCVDVTLDYLNKLSSRFSLRAIRSLKDQSTPIHSFTSLPDVKVPFPRICGASFSPTGLLVCFLSPEGYMSRFHSAPRSLADISKLANTNSSSKGFFYEMNKNTTQKQYYKSNIRKLKSTEFNTETPSRKLSTQSIQKQTHIVLIYNVLQLSLFNVSLAKNYSLKISNAEEMCHKNLSAVTNCNRKDLFEFWQYCTILANGCKPSCNISAGYIRPWATQSMGRGLCELWMKHFLDINDIQSAAMLVIVMRAIDLDLENNFKENKNNASSISLTSGSHKNISQESLMDNIHSDTLNSNLCVSIFVDGLQKYKIYDDKRNATLIVMEINEGS 813          
BLAST of WD repeat-containing protein 59 vs. Planmine SMEST
Match: SMESG000025367.1 (SMESG000025367.1)

HSP 1 Score: 1581.62 bits (4094), Expect = 0.000e+0
Identity = 775/817 (94.86%), Postives = 784/817 (95.96%), Query Frame = 3
Query:   45 MNIVREDQRPKEIQASSFAMNSNGSLGLFCGLYEILLLSFDDPKRKRKESINKSSDPVLCQWNKTCNEYFALTQSNVCKIFDIELKKFQSLKAHNKIISSIDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDSQGIQLVKWSNVKTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDWSANMNIIVSCGQDKKLKIWNLEESNQNRILEEDYANYSMCKFDTLDNIFTLNSSDVPSENFVSFWSIVEFRKLYSTPPHTNVITDFALIYPTETACQFVTLHRNSDLKVWEINRSLVSGKRKRGGSSHVAGLDNSISNDRLFLSPSPDHSVNKSKAIPVGQSESFVNMHKNDILSSIIAHRSDPNLIMRDKSNKSLSEDQEIRVREFEKLSNTNQVTFEKSVDMRSVTAHFNLINLKCSIQFIYRTSIGDIVFLDVLVLRQRAEKIRPQNLEELEKILKTTIDDCRRNNILPIEKCVDVTLDYLNKLSSRFSLRAIRSLKDQSTPIHSFTSLPDVKVPFPRICGASFSPTGLLVCFLSPEGYMSRFHSAPRSLADISKLANTNSSSKGFFYEMNKNTTQKQYYKSNIRKLKSTEFNTETPSRKLSTQSIQKQTHIVLIYNVLQLSLFNVSLAKNYSLKISNAEAMCHKNLSAVTNCNRKDLFEFWQYCAILANGCKPSCNISAGYIRPWATQSMGRGLCELWMKHFLDINDIQSAAMLVIVMRAIDLDLENNFKENKNNASSISLTSGSHKNISQESLMDNIHSDTLNSNLCVSIFVDGLQKYKIYDDKRNATLIVMEINEGSPGRF 2495
            MNIVREDQRPKEIQASSFA+NSNGSLGLFCGLYEILLLSFDDPKRKRKESINKSSDPVLCQWNKTCNEYFALTQSNVCKIFDIELKKFQSLKAHN IISSIDWHPDNKNQIATAS+DNSKSLCIWDIRNSKFPS+KIDSQGIQLVKWSNVKTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDWSANMNIIVSCGQDKKLKIWNLEESNQNRILEEDYANYSMCKFDTLDNIFTLNSSDVPSENFVSFWSIV+FRKLYSTPPHTNVITDFALIYPTETAC+FVTLHRNSDLK+WEINRSLVSGKRKRGGSSHVAGLDNSISNDRLFLSPSPDHSVNKSKAIPVGQSESFVNMHKNDILSSIIAHRSDPNLIMRDKSNKSLSEDQEIRVREFEKLSNTNQVTFEKSVDMRSVTAHFNLINLKCSIQFIYRTSIGDIVFLDVLVLRQRAEKIRPQNLEELEKILKTTIDDCRRNNILPIEKCVDVTLDYLNKLSSRFSLRAIRSLKDQSTPIHSFTSLPDVKVPFPRICGASFSPTGLLVCFLSPEGYMSRFHSAPRSLADISKLANTNSSSKGFFYEMNKNTTQKQYYKSNIRKLKSTEFNTETPSRKLSTQSIQKQTHIVLIYNVLQLSLFNVSLAKNYSLKISNAE MCHKNLSAVTNCNRKDLFEFWQYC ILANGCKPSCNISAGYIRPWATQSMGRGLCELWMKHFLDINDIQSAAMLVIVMRAIDLDLENNFKENKNNASSISLTSGSHKNISQESLMDNIHSDTL  +     +        I D    +TL         PG F
Sbjct:    1 MNIVREDQRPKEIQASSFAINSNGSLGLFCGLYEILLLSFDDPKRKRKESINKSSDPVLCQWNKTCNEYFALTQSNVCKIFDIELKKFQSLKAHNTIISSIDWHPDNKNQIATASSDNSKSLCIWDIRNSKFPSNKIDSQGIQLVKWSNVKTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDWSANMNIIVSCGQDKKLKIWNLEESNQNRILEEDYANYSMCKFDTLDNIFTLNSSDVPSENFVSFWSIVDFRKLYSTPPHTNVITDFALIYPTETACKFVTLHRNSDLKIWEINRSLVSGKRKRGGSSHVAGLDNSISNDRLFLSPSPDHSVNKSKAIPVGQSESFVNMHKNDILSSIIAHRSDPNLIMRDKSNKSLSEDQEIRVREFEKLSNTNQVTFEKSVDMRSVTAHFNLINLKCSIQFIYRTSIGDIVFLDVLVLRQRAEKIRPQNLEELEKILKTTIDDCRRNNILPIEKCVDVTLDYLNKLSSRFSLRAIRSLKDQSTPIHSFTSLPDVKVPFPRICGASFSPTGLLVCFLSPEGYMSRFHSAPRSLADISKLANTNSSSKGFFYEMNKNTTQKQYYKSNIRKLKSTEFNTETPSRKLSTQSIQKQTHIVLIYNVLQLSLFNVSLAKNYSLKISNAEEMCHKNLSAVTNCNRKDLFEFWQYCTILANGCKPSCNISAGYIRPWATQSMGRGLCELWMKHFLDINDIQSAAMLVIVMRAIDLDLENNFKENKNNASSISLTSGSHKNISQESLMDNIHSDTLMPHYPTQNYYAAYHPCAISDTGSRSTL---------PGTF 808          
BLAST of WD repeat-containing protein 59 vs. Planmine SMEST
Match: SMESG000025367.1 (SMESG000025367.1)

HSP 1 Score: 398.282 bits (1022), Expect = 6.512e-132
Identity = 206/207 (99.52%), Postives = 206/207 (99.52%), Query Frame = 3
Query: 2481 SPGRFRNNSFGEQEITNNLKKGDNLIPDSSLQHFQQNEQIRLIDPAKNLQYNRVLLHYVLMLSAHKLLNFSSKIVQKILPAKFFNLIFGHYNFDVFLLRNCINDHRCKSVYVDPNRLTVICSECPTRTVSVNNQDTSKTPIICSVCRNFVRGLFSVCDQCNHGGHADHLNSWFARSXXXXXXXXXXXXXXLPSKDFNFEFFVPISAM 3101
             PGRFRNNSFGEQEITNNLKKGDNLIPDSSLQHFQQNEQIRLIDPAKNLQYNRVLLHYVLMLSAHKLLNFSSKIVQKILPAKFFNLIFGHYNFDVFLLRNCINDHRCKSVYVDPNRLTVICSECPTRTVSVNNQDTSKTPIICSVCRNFVRGLFSVCDQCNHGGHADHLNSWFARSGAQAACPAGCGCVCLPSKDFNFEFFVPISAM
Sbjct:    5 GPGRFRNNSFGEQEITNNLKKGDNLIPDSSLQHFQQNEQIRLIDPAKNLQYNRVLLHYVLMLSAHKLLNFSSKIVQKILPAKFFNLIFGHYNFDVFLLRNCINDHRCKSVYVDPNRLTVICSECPTRTVSVNNQDTSKTPIICSVCRNFVRGLFSVCDQCNHGGHADHLNSWFARSGAQAACPAGCGCVCLPSKDFNFEFFVPISAM 211          
BLAST of WD repeat-containing protein 59 vs. Planmine SMEST
Match: SMESG000025367.1 (SMESG000025367.1)

HSP 1 Score: 397.512 bits (1020), Expect = 1.080e-131
Identity = 206/207 (99.52%), Postives = 206/207 (99.52%), Query Frame = 3
Query: 2481 SPGRFRNNSFGEQEITNNLKKGDNLIPDSSLQHFQQNEQIRLIDPAKNLQYNRVLLHYVLMLSAHKLLNFSSKIVQKILPAKFFNLIFGHYNFDVFLLRNCINDHRCKSVYVDPNRLTVICSECPTRTVSVNNQDTSKTPIICSVCRNFVRGLFSVCDQCNHGGHADHLNSWFARSXXXXXXXXXXXXXXLPSKDFNFEFFVPISAM 3101
             PGRFRNNSFGEQEITNNLKKGDNLIPDSSLQHFQQNEQIRLIDPAKNLQYNRVLLHYVLMLSAHKLLNFSSKIVQKILPAKFFNLIFGHYNFDVFLLRNCINDHRCKSVYVDPNRLTVICSECPTRTVSVNNQDTSKTPIICSVCRNFVRGLFSVCDQCNHGGHADHLNSWFARSGAQAACPAGCGCVCLPSKDFNFEFFVPISAM
Sbjct:    4 GPGRFRNNSFGEQEITNNLKKGDNLIPDSSLQHFQQNEQIRLIDPAKNLQYNRVLLHYVLMLSAHKLLNFSSKIVQKILPAKFFNLIFGHYNFDVFLLRNCINDHRCKSVYVDPNRLTVICSECPTRTVSVNNQDTSKTPIICSVCRNFVRGLFSVCDQCNHGGHADHLNSWFARSGAQAACPAGCGCVCLPSKDFNFEFFVPISAM 210          
The following BLAST results are available for this feature:
BLAST of WD repeat-containing protein 59 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WDR591.851e-4221.23WD repeat domain 59 [Source:HGNC Symbol;Acc:HGNC:2... [more]
WDR597.318e-2121.22WD repeat domain 59 [Source:HGNC Symbol;Acc:HGNC:2... [more]
WDR591.504e-1623.39WD repeat domain 59 [Source:HGNC Symbol;Acc:HGNC:2... [more]
RBBP42.859e-1028.85RB binding protein 4, chromatin remodeling factor ... [more]
RBBP72.815e-927.94RB binding protein 7, chromatin remodeling factor ... [more]
back to top
BLAST of WD repeat-containing protein 59 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
lin-538.760e-1327.27Probable histone-binding protein lin-53 [Source:U... [more]
pfs-25.681e-725.43Polyadenylation Factor Subunit homolog [Source:Un... [more]
pfs-27.964e-725.43Polyadenylation Factor Subunit homolog [Source:Un... [more]
back to top
BLAST of WD repeat-containing protein 59 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wdr593.485e-1625.24gene:FBgn0032339 transcript:FBtr0080196[more]
Wdr593.485e-1625.24gene:FBgn0032339 transcript:FBtr0343622[more]
Caf1-553.865e-1026.11gene:FBgn0263979 transcript:FBtr0083052[more]
Caf1-553.886e-1026.11gene:FBgn0263979 transcript:FBtr0301845[more]
U4-U6-60K3.178e-823.02gene:FBgn0036733 transcript:FBtr0075209[more]
back to top
BLAST of WD repeat-containing protein 59 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr597.834e-1823.81WD repeat domain 59 [Source:ZFIN;Acc:ZDB-GENE-1202... [more]
wdr598.488e-1823.81WD repeat domain 59 [Source:ZFIN;Acc:ZDB-GENE-1202... [more]
rbbp43.856e-926.40retinoblastoma binding protein 4 [Source:NCBI gene... [more]
rbb4l4.148e-928.68retinoblastoma binding protein 4, like [Source:NCB... [more]
rbb4l4.162e-928.68retinoblastoma binding protein 4, like [Source:NCB... [more]
back to top
BLAST of WD repeat-containing protein 59 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddb14.613e-3323.19damage-specific DNA binding protein 1 [Source:Xenb... [more]
ddb16.850e-3122.63damage-specific DNA binding protein 1 [Source:Xenb... [more]
ddb15.744e-2622.87damage-specific DNA binding protein 1 [Source:Xenb... [more]
ddb11.533e-2421.97damage-specific DNA binding protein 1 [Source:Xenb... [more]
ddb12.676e-2422.19damage-specific DNA binding protein 1 [Source:Xenb... [more]
back to top
BLAST of WD repeat-containing protein 59 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wdr597.832e-3921.09WD repeat domain 59 [Source:MGI Symbol;Acc:MGI:244... [more]
Wdr593.868e-3720.72WD repeat domain 59 [Source:MGI Symbol;Acc:MGI:244... [more]
Wdr595.172e-3720.83WD repeat domain 59 [Source:MGI Symbol;Acc:MGI:244... [more]
Rbbp45.717e-928.68retinoblastoma binding protein 4, chromatin remode... [more]
Rbbp78.638e-927.94retinoblastoma binding protein 7, chromatin remode... [more]
back to top
BLAST of WD repeat-containing protein 59 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6PJI9|WDR59_HUMAN8.889e-4221.23GATOR complex protein WDR59 OS=Homo sapiens OX=960... [more]
sp|Q5ZLG9|WDR59_CHICK1.951e-3623.34GATOR complex protein WDR59 OS=Gallus gallus OX=90... [more]
sp|Q8C0M0|WDR59_MOUSE6.041e-3620.92GATOR complex protein WDR59 OS=Mus musculus OX=100... [more]
sp|Q9VKK2|WDR59_DROME3.494e-1525.24GATOR complex protein Wdr59 OS=Drosophila melanoga... [more]
sp|O22469|MSI3_ARATH4.142e-1224.89WD-40 repeat-containing protein MSI3 OS=Arabidopsi... [more]
back to top
BLAST of WD repeat-containing protein 59 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4D5RH961.898e-5123.30Putative conserved wd40 repeat-containing protein ... [more]
A0A131YP781.124e-4823.22Uncharacterized protein OS=Rhipicephalus appendicu... [more]
A0A224Z4X19.541e-4823.05Protein containing WD40 and Zn ribbon domain OS=Rh... [more]
A0A131YR221.587e-4723.05Uncharacterized protein OS=Rhipicephalus appendicu... [more]
A0A293LUA51.090e-4523.12Uncharacterized protein (Fragment) OS=Ornithodoros... [more]
back to top
BLAST of WD repeat-containing protein 59 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr596.929e-3323.31WD repeat domain 59 [Source:NCBI gene;Acc:10304360... [more]
wdr591.367e-3222.32WD repeat domain 59 [Source:NCBI gene;Acc:10304360... [more]
wdr592.143e-2923.04WD repeat domain 59 [Source:NCBI gene;Acc:10304360... [more]
rbb4l3.121e-928.68histone-binding protein RBBP7 [Source:NCBI gene;Ac... [more]
rbbp43.184e-926.40RB binding protein 4, chromatin remodeling factor ... [more]
back to top
BLAST of WD repeat-containing protein 59 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr598.396e-2025.00WD repeat domain 59 [Source:ZFIN;Acc:ZDB-GENE-1202... [more]
ENSPMAT00000008002.12.351e-1028.68pep scaffold:Pmarinus_7.0:GL477852:421:9512:1 gene... [more]
pex74.919e-721.98peroxisomal biogenesis factor 7 [Source:ZFIN;Acc:Z... [more]
POC1A2.411e-621.96POC1 centriolar protein A [Source:HGNC Symbol;Acc:... [more]
snrnp408.486e-623.08small nuclear ribonucleoprotein 40 (U5) [Source:ZF... [more]
back to top
BLAST of WD repeat-containing protein 59 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
MTC52.110e-923.14Subunit of SEACAT, a subcomplex of the SEA complex... [more]
UTP132.497e-726.38Nucleolar protein; component of the small subunit ... [more]
SEC311.410e-624.85Component of the Sec13p-Sec31p complex of the COPI... [more]
RSA47.525e-627.34WD-repeat protein involved in ribosome biogenesis;... [more]
back to top
BLAST of WD repeat-containing protein 59 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO328937.278e-921.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420587.341e-924.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458904.076e-828.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO432951.512e-719.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409321.568e-727.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of WD repeat-containing protein 59 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr595.999e-3423.09WD repeat domain 59 [Source:NCBI gene;Acc:10116834... [more]
wdr591.951e-3222.97WD repeat domain 59 [Source:NCBI gene;Acc:10116834... [more]
rbbp43.002e-926.40RB binding protein 4, chromatin remodeling factor ... [more]
rbb4l2.834e-827.94histone-binding protein RBBP7 [Source:NCBI gene;Ac... [more]
rbb4l3.612e-827.94histone-binding protein RBBP7 [Source:NCBI gene;Ac... [more]
back to top
BLAST of WD repeat-containing protein 59 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000025367.10.000e+095.98SMESG000025367.1[more]
SMESG000025367.10.000e+098.89SMESG000025367.1[more]
SMESG000025367.10.000e+094.86SMESG000025367.1[more]
SMESG000025367.16.512e-13299.52SMESG000025367.1[more]
SMESG000025367.11.080e-13199.52SMESG000025367.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029391 ID=SMED30029391|Name=WD repeat-containing protein 59|organism=Schmidtea mediterranea sexual|type=transcript|length=3156bp
ATTTTAAATTATTCTATTCCAATTTTTTTTAATCGAAATACAAAATGAAT
ATTGTTCGGGAAGATCAGAGACCAAAAGAAATTCAAGCATCATCTTTCGC
TATGAATAGCAATGGATCACTTGGATTATTTTGCGGACTGTACGAAATCC
TTCTGTTGAGTTTTGATGACCCAAAGAGAAAGAGGAAAGAATCGATAAAC
AAATCTTCAGATCCGGTTTTATGTCAGTGGAATAAGACTTGCAACGAGTA
TTTTGCACTAACACAAAGTAATGTATGTAAAATATTCGACATCGAATTGA
AAAAATTCCAATCTCTCAAAGCACACAACAAAATCATCAGTTCAATAGAT
TGGCATCCGGACAACAAGAATCAAATTGCCACCGCATCCAATGACAACAG
CAAATCTCTCTGCATTTGGGATATTAGAAATTCCAAATTTCCATCCCATA
AAATCGACTCACAAGGCATTCAACTGGTGAAATGGAGCAACGTGAAAACA
AATTCTTTTGCCACAACTTCTAGCGAGGAAATCATGATTTGGGATGATAG
AAAATTGACGGCACCGACTCATATTTTTGAGGCACATAATGGGAATATCA
ACGATTTCGATTGGTCGGCCAACATGAACATCATCGTCTCTTGTGGACAG
GATAAGAAACTGAAGATCTGGAATCTAGAGGAATCCAATCAGAATCGGAT
ATTGGAAGAGGATTATGCCAATTATTCCATGTGCAAATTTGACACCTTAG
ATAATATTTTCACTCTCAATTCGTCAGATGTTCCATCTGAAAATTTTGTC
TCTTTTTGGAGTATCGTAGAGTTCAGAAAACTATACTCAACGCCCCCGCA
CACTAATGTCATCACTGACTTTGCTTTGATTTATCCAACCGAAACTGCTT
GCCAATTTGTCACTCTTCATCGAAACTCCGATTTGAAAGTTTGGGAAATT
AACAGATCGCTTGTTTCGGGTAAACGAAAAAGAGGAGGTTCCTCTCATGT
GGCTGGATTAGACAATTCAATATCTAATGATCGATTGTTTCTGTCACCAA
GTCCGGATCATTCTGTAAATAAGTCGAAAGCGATCCCAGTTGGGCAGAGT
GAATCGTTTGTCAATATGCATAAGAATGATATTTTAAGCAGCATTATTGC
TCACCGTTCGGATCCAAATTTGATAATGAGAGACAAATCAAACAAATCTC
TATCGGAGGATCAAGAAATAAGAGTCAGAGAATTCGAGAAACTTTCCAAC
ACAAACCAAGTCACCTTCGAGAAAAGTGTCGACATGAGAAGTGTGACCGC
CCATTTCAATTTGATAAATCTCAAATGCTCTATTCAATTCATCTATCGAA
CGTCGATTGGAGACATTGTCTTTCTTGACGTTCTCGTTCTACGACAACGA
GCTGAAAAAATACGTCCTCAAAATCTCGAAGAATTGGAAAAGATATTAAA
AACTACAATCGATGATTGTCGACGGAATAATATTTTACCAATTGAAAAAT
GCGTTGACGTCACTCTTGATTATCTAAACAAACTCTCGTCTAGATTCAGC
TTGCGAGCTATTCGATCATTAAAGGATCAAAGTACGCCAATACATTCTTT
CACAAGTTTGCCTGATGTAAAAGTGCCATTTCCAAGAATCTGTGGAGCGT
CATTTTCTCCCACAGGTCTCTTGGTTTGTTTCTTGTCTCCAGAAGGGTAC
ATGAGCCGATTTCATAGTGCTCCTCGATCATTAGCGGATATCAGTAAGCT
AGCCAACACGAACTCTTCATCTAAAGGATTTTTCTATGAGATGAATAAAA
ATACCACACAAAAACAATATTACAAATCTAATATCAGAAAGTTGAAATCC
ACTGAATTCAATACCGAAACTCCTAGTCGAAAATTATCAACACAGAGTAT
TCAAAAACAAACCCACATAGTTCTAATATACAATGTTTTACAGTTATCTC
TTTTTAATGTTTCCCTTGCTAAAAATTACAGTTTAAAAATCTCTAATGCT
GAAGCGATGTGCCACAAAAATTTAAGTGCTGTAACTAATTGTAATAGAAA
AGACTTGTTTGAGTTCTGGCAATATTGTGCAATATTGGCTAATGGATGTA
AGCCCAGTTGCAACATAAGTGCTGGCTATATTAGGCCTTGGGCAACCCAG
TCTATGGGTCGTGGATTGTGTGAGTTGTGGATGAAACATTTTCTGGATAT
TAATGACATCCAGAGTGCTGCTATGCTCGTTATAGTTATGCGAGCGATTG
ATTTGGATTTGGAGAATAATTTCAAGGAAAACAAAAATAATGCATCATCG
ATTTCGTTGACATCAGGCAGTCATAAGAATATTTCCCAAGAATCACTGAT
GGATAATATTCATTCTGACACCTTAAACTCGAATTTGTGCGTTAGTATTT
TTGTGGACGGTCTTCAAAAGTACAAAATTTATGATGATAAGAGAAACGCA
ACTCTTATTGTAATGGAAATCAATGAAGGCAGCCCAGGAAGATTTCGTAA
CAACAGTTTCGGTGAGCAAGAAATCACTAACAACCTGAAGAAAGGAGATA
ACTTAATACCTGACTCGAGCTTGCAACATTTCCAACAAAATGAACAAATT
AGGCTCATTGACCCTGCCAAAAATCTCCAATATAACCGAGTACTGCTACA
TTATGTGCTCATGCTCTCTGCCCATAAACTGTTGAATTTCAGTTCGAAAA
TTGTGCAAAAAATATTGCCAGCCAAATTTTTCAATTTGATCTTTGGCCAT
TACAATTTCGATGTGTTTCTTTTAAGAAATTGTATCAATGATCATAGGTG
TAAATCGGTTTACGTTGATCCTAACCGTTTGACAGTGATTTGCTCGGAAT
GTCCTACACGAACTGTGTCCGTGAACAATCAAGACACATCGAAAACTCCA
ATTATCTGTTCGGTTTGTCGAAATTTTGTCCGAGGTTTATTTTCTGTCTG
TGATCAATGCAATCATGGTGGGCATGCTGACCATTTGAATTCCTGGTTTG
CTCGGTCTGGTGCTCAAGCCGCCTGTCCTGCTGGCTGTGGATGTGTCTGT
TTGCCGTCCAAAGATTTTAATTTTGAGTTTTTTGTCCCCATTTCCGCTAT
GTAATGATTTTATTCATGTTTTTTATTCATAAAGAGATTTGTCAATCTAT
TAAAAA
back to top

protein sequence of SMED30029391-orf-1

>SMED30029391-orf-1 ID=SMED30029391-orf-1|Name=SMED30029391-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1020bp
MNIVREDQRPKEIQASSFAMNSNGSLGLFCGLYEILLLSFDDPKRKRKES
INKSSDPVLCQWNKTCNEYFALTQSNVCKIFDIELKKFQSLKAHNKIISS
IDWHPDNKNQIATASNDNSKSLCIWDIRNSKFPSHKIDSQGIQLVKWSNV
KTNSFATTSSEEIMIWDDRKLTAPTHIFEAHNGNINDFDWSANMNIIVSC
GQDKKLKIWNLEESNQNRILEEDYANYSMCKFDTLDNIFTLNSSDVPSEN
FVSFWSIVEFRKLYSTPPHTNVITDFALIYPTETACQFVTLHRNSDLKVW
EINRSLVSGKRKRGGSSHVAGLDNSISNDRLFLSPSPDHSVNKSKAIPVG
QSESFVNMHKNDILSSIIAHRSDPNLIMRDKSNKSLSEDQEIRVREFEKL
SNTNQVTFEKSVDMRSVTAHFNLINLKCSIQFIYRTSIGDIVFLDVLVLR
QRAEKIRPQNLEELEKILKTTIDDCRRNNILPIEKCVDVTLDYLNKLSSR
FSLRAIRSLKDQSTPIHSFTSLPDVKVPFPRICGASFSPTGLLVCFLSPE
GYMSRFHSAPRSLADISKLANTNSSSKGFFYEMNKNTTQKQYYKSNIRKL
KSTEFNTETPSRKLSTQSIQKQTHIVLIYNVLQLSLFNVSLAKNYSLKIS
NAEAMCHKNLSAVTNCNRKDLFEFWQYCAILANGCKPSCNISAGYIRPWA
TQSMGRGLCELWMKHFLDINDIQSAAMLVIVMRAIDLDLENNFKENKNNA
SSISLTSGSHKNISQESLMDNIHSDTLNSNLCVSIFVDGLQKYKIYDDKR
NATLIVMEINEGSPGRFRNNSFGEQEITNNLKKGDNLIPDSSLQHFQQNE
QIRLIDPAKNLQYNRVLLHYVLMLSAHKLLNFSSKIVQKILPAKFFNLIF
GHYNFDVFLLRNCINDHRCKSVYVDPNRLTVICSECPTRTVSVNNQDTSK
TPIICSVCRNFVRGLFSVCDQCNHGGHADHLNSWFARSGAQAACPAGCGC
VCLPSKDFNFEFFVPISAM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR003133T_Ag_DNA-bd
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0003688DNA replication origin binding
GO:0005515protein binding
GO:0003674molecular_function
Vocabulary: biological process
TermDefinition
GO:0006260DNA replication
GO:0008150biological_process
GO:0032008positive regulation of TOR signaling
GO:0034198cellular response to amino acid starvation
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
GO:0061700GATOR2 complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 84..126
e-value: 6.9E-7
score: 38.9
coord: 171..210
e-value: 1.9E-7
score: 40.7
coord: 130..167
e-value: 310.0
score: 1.3
coord: 259..301
e-value: 440.0
score: 0.3
IPR001680WD40 repeatPFAMPF00400WD40coord: 174..210
e-value: 3.5E-6
score: 27.6
coord: 87..126
e-value: 0.015
score: 16.1
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 91..135
score: 9.005
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 178..219
score: 13.583
NoneNo IPR availablePFAMPF17120Zn_ribbon_17coord: 955..1004
e-value: 7.4E-11
score: 41.5
NoneNo IPR availablePANTHERPTHR46170FAMILY NOT NAMEDcoord: 14..1003
NoneNo IPR availableCDDcd16693mRING-H2-C3H3C2_WDR24coord: 954..1002
e-value: 1.94085E-17
score: 74.6117
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 168..420
e-value: 7.2E-14
score: 53.5
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 5..162
e-value: 6.7E-14
score: 54.0
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 197..211
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 91..219
score: 15.215
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 45..340