Gamma-aminobutyric acid receptor-associated protein-like 2

Overview
NameGamma-aminobutyric acid receptor-associated protein-like 2
Smed IDSMED30029379
Length (bp)526
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Gamma-aminobutyric acid receptor-associated protein-like 2 (SMED30029379) t-SNE clustered cells

Violin plots show distribution of expression levels for Gamma-aminobutyric acid receptor-associated protein-like 2 (SMED30029379) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Gamma-aminobutyric acid receptor-associated protein-like 2 (SMED30029379) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Gamma-aminobutyric acid receptor-associated protein-like 2 (SMED30029379) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029379

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30029379h1SMcG0006647 Contig3707GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30029379h1SMcG0006647 Contig2686GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30029379h1SMcG0006647 dd_Smed_v4_1441_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30029379h1SMcG0006647 dd_Smed_v4_1441_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029379h1SMcG0006647 dd_Smed_v4_1441_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30029379h1SMcG0006647 dd_Smed_v4_1441_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30029379h1SMcG0006647 dd_Smed_v4_1441_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029379h1SMcG0006647 dd_Smed_v4_1441_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Human
Match: GABARAPL2 (GABA type A receptor associated protein like 2 [Source:HGNC Symbol;Acc:HGNC:13291])

HSP 1 Score: 161.77 bits (408), Expect = 2.644e-51
Identity = 74/113 (65.49%), Postives = 95/113 (84.07%), Query Frame = 2
Query:   62 MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            MK+ F+ +HS + R  +S KI+AKYP R+P+IVEK   S++++IDK K+LVP+DITVAQFMWI+RKRI L S+KA+FLFV K+VPQ+S+TMGQLYE  +DEDGFLY AYSGEN
Sbjct:    1 MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGEN 113          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Human
Match: GABARAPL1 (GABA type A receptor associated protein like 1 [Source:HGNC Symbol;Acc:HGNC:4068])

HSP 1 Score: 132.494 bits (332), Expect = 9.207e-40
Identity = 59/113 (52.21%), Postives = 85/113 (75.22%), Query Frame = 2
Query:   62 MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            MKF+++ +H F+ R ++ +KI+ KYP R+P+IVEK P +R+ ++DK K+LVP+D+TV QF +++RKRI L  + ALF FV  ++P  S TMGQLYED  +ED FLY AYS E+
Sbjct:    1 MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDES 113          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Human
Match: GABARAPL1 (GABA type A receptor associated protein like 1 [Source:HGNC Symbol;Acc:HGNC:4068])

HSP 1 Score: 132.494 bits (332), Expect = 9.207e-40
Identity = 59/113 (52.21%), Postives = 85/113 (75.22%), Query Frame = 2
Query:   62 MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            MKF+++ +H F+ R ++ +KI+ KYP R+P+IVEK P +R+ ++DK K+LVP+D+TV QF +++RKRI L  + ALF FV  ++P  S TMGQLYED  +ED FLY AYS E+
Sbjct:    1 MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDES 113          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Human
Match: GABARAP (GABA type A receptor-associated protein [Source:HGNC Symbol;Acc:HGNC:4067])

HSP 1 Score: 130.568 bits (327), Expect = 5.153e-39
Identity = 59/113 (52.21%), Postives = 84/113 (74.34%), Query Frame = 2
Query:   62 MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            MKF ++ EH F+KR  + +KI+ KYP R+P+IVEK P +R+ ++DK K+LVP+D+TV QF +++RKRI L ++ ALF FV   +P  S TMGQLY++  +ED FLY AYS E+
Sbjct:    1 MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDES 113          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Human
Match: GABARAPL2 (GABA type A receptor associated protein like 2 [Source:HGNC Symbol;Acc:HGNC:13291])

HSP 1 Score: 115.161 bits (287), Expect = 2.626e-33
Identity = 53/87 (60.92%), Postives = 72/87 (82.76%), Query Frame = 2
Query:   62 MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQA 322
            MK+ F+ +HS + R  +S KI+AKYP R+P+IVEK   S++++IDK K+LVP+DITVAQFMWI+RKRI L S+KA+FLFV K+VPQ+
Sbjct:    1 MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQS 87          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Celegans
Match: lgg-1 (pep chromosome:WBcel235:II:6346960:6347719:-1 gene:WBGene00002980.1 transcript:C32D5.9.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lgg-1)

HSP 1 Score: 128.642 bits (322), Expect = 1.194e-38
Identity = 60/113 (53.10%), Postives = 83/113 (73.45%), Query Frame = 2
Query:   62 MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            MK+ ++ E++F+KR  +  KI+ KYP RIP+IVEK P S+L ++DK K+LVP+D+TV QF +++RKRI L  + ALF FV   +PQ   TMGQLY+D  +ED FLY AYS E+
Sbjct:    1 MKWAYKEENNFEKRRAEGDKIRRKYPDRIPVIVEKAPKSKLHDLDKKKYLVPSDLTVGQFYFLIRKRIQLRPEDALFFFVNNVIPQTMTTMGQLYQDHHEEDLFLYIAYSDES 113          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Celegans
Match: lgg-2 (pep chromosome:WBcel235:IV:10934201:10935903:-1 gene:WBGene00002981.1 transcript:ZK593.6a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lgg-2)

HSP 1 Score: 74.3294 bits (181), Expect = 2.877e-17
Identity = 42/110 (38.18%), Postives = 69/110 (62.73%), Query Frame = 2
Query:   74 FQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEI-DKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVG-KSVPQASMTMGQLYEDFRDEDGFLYAAYSGE 397
            F+    F +R +D ++I+++ P ++P+I+E+    R + + D+ KFLVP  ITVA+ M I+R+R+ L   +A FL V  +S+   SM+M  LY   RD DGF+Y  Y+ +
Sbjct:   29 FKERRPFHERQKDVEEIRSQQPNKVPVIIERFDGERSLPLMDRCKFLVPEHITVAELMSIVRRRLQLHPQQAFFLLVNERSMVSNSMSMSNLYSQERDPDGFVYMVYTSQ 138          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Celegans
Match: lgg-2 (pep chromosome:WBcel235:IV:10934186:10935914:-1 gene:WBGene00002981.1 transcript:ZK593.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lgg-2)

HSP 1 Score: 74.3294 bits (181), Expect = 2.877e-17
Identity = 42/110 (38.18%), Postives = 69/110 (62.73%), Query Frame = 2
Query:   74 FQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEI-DKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVG-KSVPQASMTMGQLYEDFRDEDGFLYAAYSGE 397
            F+    F +R +D ++I+++ P ++P+I+E+    R + + D+ KFLVP  ITVA+ M I+R+R+ L   +A FL V  +S+   SM+M  LY   RD DGF+Y  Y+ +
Sbjct:   29 FKERRPFHERQKDVEEIRSQQPNKVPVIIERFDGERSLPLMDRCKFLVPEHITVAELMSIVRRRLQLHPQQAFFLLVNERSMVSNSMSMSNLYSQERDPDGFVYMVYTSQ 138          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Celegans
Match: lgg-2 (pep chromosome:WBcel235:IV:10934201:10935825:-1 gene:WBGene00002981.1 transcript:ZK593.6b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lgg-2)

HSP 1 Score: 55.4546 bits (132), Expect = 1.112e-10
Identity = 32/70 (45.71%), Postives = 45/70 (64.29%), Query Frame = 2
Query:  191 IDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVG-KSVPQASMTMGQLYEDFRDEDGFLYAAYSGE 397
            +D+ KFLVP  ITVA+ M I+R+R+ L   +A FL V  +S+   SM+M  LY   RD DGF+Y  Y+ +
Sbjct:    1 MDRCKFLVPEHITVAELMSIVRRRLQLHPQQAFFLLVNERSMVSNSMSMSNLYSQERDPDGFVYMVYTSQ 70          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Celegans
Match: lgg-2 (pep chromosome:WBcel235:IV:10934201:10935825:-1 gene:WBGene00002981.1 transcript:ZK593.6b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lgg-2)

HSP 1 Score: 55.4546 bits (132), Expect = 1.112e-10
Identity = 32/70 (45.71%), Postives = 45/70 (64.29%), Query Frame = 2
Query:  191 IDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVG-KSVPQASMTMGQLYEDFRDEDGFLYAAYSGE 397
            +D+ KFLVP  ITVA+ M I+R+R+ L   +A FL V  +S+   SM+M  LY   RD DGF+Y  Y+ +
Sbjct:    1 MDRCKFLVPEHITVAELMSIVRRRLQLHPQQAFFLLVNERSMVSNSMSMSNLYSQERDPDGFVYMVYTSQ 70          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Fly
Match: Atg8b (gene:FBgn0038539 transcript:FBtr0346730)

HSP 1 Score: 134.035 bits (336), Expect = 1.196e-40
Identity = 59/115 (51.30%), Postives = 84/115 (73.04%), Query Frame = 2
Query:   56 IEMKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            ++M ++++ +HSFDKR  +  KI+ KYP R+P+IVEK P +R  E+DK K+LVPAD+TV QF +++RKRI+L  D ALF FV   +P  S TMG LY++  D+D FLY +Y+ EN
Sbjct:    1 MDMNYQYKKDHSFDKRRNEGDKIRRKYPDRVPVIVEKAPKTRYAELDKKKYLVPADLTVGQFYFLIRKRINLRPDDALFFFVNNVIPPTSATMGALYQEHFDKDYFLYISYTDEN 115          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Fly
Match: Atg8b (gene:FBgn0038539 transcript:FBtr0083533)

HSP 1 Score: 134.035 bits (336), Expect = 1.196e-40
Identity = 59/115 (51.30%), Postives = 84/115 (73.04%), Query Frame = 2
Query:   56 IEMKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            ++M ++++ +HSFDKR  +  KI+ KYP R+P+IVEK P +R  E+DK K+LVPAD+TV QF +++RKRI+L  D ALF FV   +P  S TMG LY++  D+D FLY +Y+ EN
Sbjct:    1 MDMNYQYKKDHSFDKRRNEGDKIRRKYPDRVPVIVEKAPKTRYAELDKKKYLVPADLTVGQFYFLIRKRINLRPDDALFFFVNNVIPPTSATMGALYQEHFDKDYFLYISYTDEN 115          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Fly
Match: Atg8a (gene:FBgn0052672 transcript:FBtr0071498)

HSP 1 Score: 130.954 bits (328), Expect = 1.633e-39
Identity = 59/113 (52.21%), Postives = 83/113 (73.45%), Query Frame = 2
Query:   62 MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            MKF+++ EH+F+KR  +  KI+ KYP R+P+IVEK P +R+ ++DK K+LVP+D+TV QF +++RKRI L  + ALF FV   +P  S TMG LY++  +ED FLY AYS EN
Sbjct:    1 MKFQYKEEHAFEKRRAEGDKIRRKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHEEDYFLYIAYSDEN 113          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Fly
Match: Atg8a (gene:FBgn0052672 transcript:FBtr0346376)

HSP 1 Score: 99.7525 bits (247), Expect = 2.046e-27
Identity = 48/93 (51.61%), Postives = 64/93 (68.82%), Query Frame = 2
Query:  122 IKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            I  K  Q I +IVEK P +R+ ++DK K+LVP+D+TV QF +++RKRI L  + ALF FV   +P  S TMG LY++  +ED FLY AYS EN
Sbjct:    7 IMNKKKQMIQVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHEEDYFLYIAYSDEN 99          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Fly
Match: Atg8a (gene:FBgn0052672 transcript:FBtr0346375)

HSP 1 Score: 96.6709 bits (239), Expect = 2.708e-26
Identity = 44/83 (53.01%), Postives = 60/83 (72.29%), Query Frame = 2
Query:  152 IIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            +IVEK P +R+ ++DK K+LVP+D+TV QF +++RKRI L  + ALF FV   +P  S TMG LY++  +ED FLY AYS EN
Sbjct:    6 VIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHEEDYFLYIAYSDEN 88          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Zebrafish
Match: gabarapl2 (GABA(A) receptor-associated protein like 2 [Source:ZFIN;Acc:ZDB-GENE-040718-336])

HSP 1 Score: 157.918 bits (398), Expect = 4.276e-50
Identity = 73/113 (64.60%), Postives = 94/113 (83.19%), Query Frame = 2
Query:   62 MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            MK+ F+ +HS + R  +S KI+ KYP R+P+IVEK   S++++IDK K+LVP+DITVAQFMWI+RKRI L S+KA+FLFV K+VPQ+S+TMGQLYE  +DEDGFLY AYSGEN
Sbjct:    1 MKWMFKEDHSLEHRCVESAKIRNKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRILLPSEKAIFLFVDKTVPQSSLTMGQLYEKEQDEDGFLYVAYSGEN 113          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Zebrafish
Match: gabarapb (GABA(A) receptor-associated protein b [Source:ZFIN;Acc:ZDB-GENE-101102-9])

HSP 1 Score: 134.806 bits (338), Expect = 1.614e-40
Identity = 60/119 (50.42%), Postives = 87/119 (73.11%), Query Frame = 2
Query:   44 LINLIEMKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            L+    MKF+++ EH F+KR  + +KI+ KYP R+P+IVEK P +R+ ++DK K+LVP+D+TV QF +++RKRI L ++ ALF FV   +P  S TMGQLY++  +ED FLY AYS E+
Sbjct:   30 LLTATTMKFQYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDES 148          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Zebrafish
Match: gabarapb (GABA(A) receptor-associated protein b [Source:ZFIN;Acc:ZDB-GENE-101102-9])

HSP 1 Score: 131.724 bits (330), Expect = 9.518e-40
Identity = 59/113 (52.21%), Postives = 85/113 (75.22%), Query Frame = 2
Query:   62 MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            MKF+++ EH F+KR  + +KI+ KYP R+P+IVEK P +R+ ++DK K+LVP+D+TV QF +++RKRI L ++ ALF FV   +P  S TMGQLY++  +ED FLY AYS E+
Sbjct:    1 MKFQYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDES 113          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Zebrafish
Match: gabarapa (GABA(A) receptor-associated protein a [Source:ZFIN;Acc:ZDB-GENE-030131-5174])

HSP 1 Score: 127.872 bits (320), Expect = 4.232e-38
Identity = 58/113 (51.33%), Postives = 83/113 (73.45%), Query Frame = 2
Query:   62 MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            MKF ++ EH F+KR  + +KI+ KYP R+P+IVEK P +R+ ++DK K+LVP+D+TV QF +++RKRI L ++ ALF FV   +P  S TMG LY++  +ED FLY AYS E+
Sbjct:    1 MKFMYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGLLYQEHHEEDFFLYIAYSDES 113          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Zebrafish
Match: gabarapa (GABA(A) receptor-associated protein a [Source:ZFIN;Acc:ZDB-GENE-030131-5174])

HSP 1 Score: 127.872 bits (320), Expect = 4.232e-38
Identity = 58/113 (51.33%), Postives = 83/113 (73.45%), Query Frame = 2
Query:   62 MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            MKF ++ EH F+KR  + +KI+ KYP R+P+IVEK P +R+ ++DK K+LVP+D+TV QF +++RKRI L ++ ALF FV   +P  S TMG LY++  +ED FLY AYS E+
Sbjct:    1 MKFMYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGLLYQEHHEEDFFLYIAYSDES 113          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Xenopus
Match: or3a1 (olfactory receptor family 3 subfamily A member 1 [Source:Xenbase;Acc:XB-GENE-6039050])

HSP 1 Score: 161.77 bits (408), Expect = 1.948e-51
Identity = 74/113 (65.49%), Postives = 95/113 (84.07%), Query Frame = 2
Query:   62 MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            MK+ F+ +HS + R  +S KI+AKYP R+P+IVEK   S++++IDK K+LVP+DITVAQFMWI+RKRI L S+KA+FLFV K+VPQ+S+TMGQLYE  +DEDGFLY AYSGEN
Sbjct:    1 MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGEN 113          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Xenopus
Match: or3a1 (olfactory receptor family 3 subfamily A member 1 [Source:Xenbase;Acc:XB-GENE-6039050])

HSP 1 Score: 151.754 bits (382), Expect = 2.685e-47
Identity = 69/102 (67.65%), Postives = 87/102 (85.29%), Query Frame = 2
Query:   95 DKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            + R  +S KI+AKYP R+P+IVEK   S++++IDK K+LVP+DITVAQFMWI+RKRI L S+KA+FLFV K+VPQ+S+TMGQLYE  +DEDGFLY AYSGEN
Sbjct:   17 EHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGEN 118          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Xenopus
Match: gabarapl1 (GABA(A) receptor-associated protein like 1 [Source:NCBI gene;Acc:595040])

HSP 1 Score: 132.494 bits (332), Expect = 8.346e-40
Identity = 59/113 (52.21%), Postives = 85/113 (75.22%), Query Frame = 2
Query:   62 MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            MKF+++ +H F+ R ++ +KI+ KYP R+P+IVEK P +R+ ++DK K+LVP+D+TV QF +++RKRI L  + ALF FV  ++P  S TMGQLYED  +ED FLY AYS E+
Sbjct:    1 MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDES 113          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Xenopus
Match: gabarapl1 (GABA(A) receptor-associated protein like 1 [Source:NCBI gene;Acc:595040])

HSP 1 Score: 132.494 bits (332), Expect = 8.346e-40
Identity = 59/113 (52.21%), Postives = 85/113 (75.22%), Query Frame = 2
Query:   62 MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            MKF+++ +H F+ R ++ +KI+ KYP R+P+IVEK P +R+ ++DK K+LVP+D+TV QF +++RKRI L  + ALF FV  ++P  S TMGQLYED  +ED FLY AYS E+
Sbjct:    1 MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDES 113          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Xenopus
Match: map1lc3c (microtubule associated protein 1 light chain 3 gamma [Source:NCBI gene;Acc:733779])

HSP 1 Score: 98.2117 bits (243), Expect = 2.751e-26
Identity = 48/110 (43.64%), Postives = 74/110 (67.27%), Query Frame = 2
Query:   74 FQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEI-DKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFV-GKSVPQASMTMGQLYEDFRDEDGFLYAAYSGE 397
            F+   S   R E+   IKAK+P +IP+IVE++   + + + DK KFLVP D+++ QF+ I+R R++LS+ +A +L V  KS+   S+TM +LY D +DEDGFLY  Y+ +
Sbjct:   11 FKQRKSLASRKEEVIGIKAKFPTKIPVIVERYRREKYLPLLDKTKFLVPKDLSMMQFINIIRNRMNLSATQAFYLLVNNKSLASMSLTMAELYRDHKDEDGFLYMTYASQ 120          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Mouse
Match: Gabarapl2 (gamma-aminobutyric acid (GABA) A receptor-associated protein-like 2 [Source:MGI Symbol;Acc:MGI:1890602])

HSP 1 Score: 161.77 bits (408), Expect = 1.815e-51
Identity = 74/113 (65.49%), Postives = 95/113 (84.07%), Query Frame = 2
Query:   62 MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            MK+ F+ +HS + R  +S KI+AKYP R+P+IVEK   S++++IDK K+LVP+DITVAQFMWI+RKRI L S+KA+FLFV K+VPQ+S+TMGQLYE  +DEDGFLY AYSGEN
Sbjct:    1 MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGEN 113          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Mouse
Match: Gabarapl1 (gamma-aminobutyric acid (GABA) A receptor-associated protein-like 1 [Source:MGI Symbol;Acc:MGI:1914980])

HSP 1 Score: 132.494 bits (332), Expect = 6.321e-40
Identity = 59/113 (52.21%), Postives = 85/113 (75.22%), Query Frame = 2
Query:   62 MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            MKF+++ +H F+ R ++ +KI+ KYP R+P+IVEK P +R+ ++DK K+LVP+D+TV QF +++RKRI L  + ALF FV  ++P  S TMGQLYED  +ED FLY AYS E+
Sbjct:    1 MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDES 113          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Mouse
Match: Gabarapl1 (gamma-aminobutyric acid (GABA) A receptor-associated protein-like 1 [Source:MGI Symbol;Acc:MGI:1914980])

HSP 1 Score: 132.494 bits (332), Expect = 6.321e-40
Identity = 59/113 (52.21%), Postives = 85/113 (75.22%), Query Frame = 2
Query:   62 MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            MKF+++ +H F+ R ++ +KI+ KYP R+P+IVEK P +R+ ++DK K+LVP+D+TV QF +++RKRI L  + ALF FV  ++P  S TMGQLYED  +ED FLY AYS E+
Sbjct:    1 MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDES 113          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Mouse
Match: Gabarap (gamma-aminobutyric acid receptor associated protein [Source:MGI Symbol;Acc:MGI:1861742])

HSP 1 Score: 130.568 bits (327), Expect = 3.538e-39
Identity = 59/113 (52.21%), Postives = 84/113 (74.34%), Query Frame = 2
Query:   62 MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            MKF ++ EH F+KR  + +KI+ KYP R+P+IVEK P +R+ ++DK K+LVP+D+TV QF +++RKRI L ++ ALF FV   +P  S TMGQLY++  +ED FLY AYS E+
Sbjct:    1 MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDES 113          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Mouse
Match: Map1lc3b (microtubule-associated protein 1 light chain 3 beta [Source:MGI Symbol;Acc:MGI:1914693])

HSP 1 Score: 89.3521 bits (220), Expect = 4.925e-23
Identity = 41/110 (37.27%), Postives = 75/110 (68.18%), Query Frame = 2
Query:   74 FQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEI-DKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFV-GKSVPQASMTMGQLYEDFRDEDGFLYAAYSGE 397
            F+   SF++R+ED + I+ ++P +IP+I+E++   + + + DK KFLVP  + +++ + I+R+R+ L++++A FL V G S+   S  + ++YE  RDEDGFLY  Y+ +
Sbjct:    7 FKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESERDEDGFLYMVYASQ 116          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. UniProt/SwissProt
Match: sp|P60522|GBRL2_RAT (Gamma-aminobutyric acid receptor-associated protein-like 2 OS=Rattus norvegicus OX=10116 GN=Gabarapl2 PE=3 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 1.270e-50
Identity = 74/113 (65.49%), Postives = 95/113 (84.07%), Query Frame = 2
Query:   62 MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            MK+ F+ +HS + R  +S KI+AKYP R+P+IVEK   S++++IDK K+LVP+DITVAQFMWI+RKRI L S+KA+FLFV K+VPQ+S+TMGQLYE  +DEDGFLY AYSGEN
Sbjct:    1 MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGEN 113          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. UniProt/SwissProt
Match: sp|P60521|GBRL2_MOUSE (Gamma-aminobutyric acid receptor-associated protein-like 2 OS=Mus musculus OX=10090 GN=Gabarapl2 PE=1 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 1.270e-50
Identity = 74/113 (65.49%), Postives = 95/113 (84.07%), Query Frame = 2
Query:   62 MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            MK+ F+ +HS + R  +S KI+AKYP R+P+IVEK   S++++IDK K+LVP+DITVAQFMWI+RKRI L S+KA+FLFV K+VPQ+S+TMGQLYE  +DEDGFLY AYSGEN
Sbjct:    1 MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGEN 113          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. UniProt/SwissProt
Match: sp|P60520|GBRL2_HUMAN (Gamma-aminobutyric acid receptor-associated protein-like 2 OS=Homo sapiens OX=9606 GN=GABARAPL2 PE=1 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 1.270e-50
Identity = 74/113 (65.49%), Postives = 95/113 (84.07%), Query Frame = 2
Query:   62 MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            MK+ F+ +HS + R  +S KI+AKYP R+P+IVEK   S++++IDK K+LVP+DITVAQFMWI+RKRI L S+KA+FLFV K+VPQ+S+TMGQLYE  +DEDGFLY AYSGEN
Sbjct:    1 MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGEN 113          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. UniProt/SwissProt
Match: sp|P60519|GBRL2_BOVIN (Gamma-aminobutyric acid receptor-associated protein-like 2 OS=Bos taurus OX=9913 GN=GABARAPL2 PE=1 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 1.270e-50
Identity = 74/113 (65.49%), Postives = 95/113 (84.07%), Query Frame = 2
Query:   62 MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            MK+ F+ +HS + R  +S KI+AKYP R+P+IVEK   S++++IDK K+LVP+DITVAQFMWI+RKRI L S+KA+FLFV K+VPQ+S+TMGQLYE  +DEDGFLY AYSGEN
Sbjct:    1 MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGEN 113          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. UniProt/SwissProt
Match: sp|Q5RF21|GBRL1_PONAB (Gamma-aminobutyric acid receptor-associated protein-like 1 OS=Pongo abelii OX=9601 GN=GABARAPL1 PE=3 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 4.105e-40
Identity = 60/113 (53.10%), Postives = 86/113 (76.11%), Query Frame = 2
Query:   62 MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            MKF+++ +H F+ R ++ +KI+ KYP R+P+IVEK P +R+ ++DK K+LVP+D+TV QF +++RKRI L  + ALF FV  ++P  S TMGQLYED R+ED FLY AYS E+
Sbjct:    1 MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNREEDYFLYVAYSDES 113          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. TrEMBL
Match: A0A1L7H9T6 (ATG8-2 OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 2.516e-75
Identity = 110/113 (97.35%), Postives = 113/113 (100.00%), Query Frame = 2
Query:   62 MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            MKFKFQ+EHSF+KRLEDSQKIKAKYPQRIPIIVEKHPSSRL+EIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN
Sbjct:    1 MKFKFQIEHSFNKRLEDSQKIKAKYPQRIPIIVEKHPSSRLVEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 113          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. TrEMBL
Match: A0A0X3Q9S1 (Gamma-aminobutyric acid receptor-associated protein-like 2 OS=Schistocephalus solidus OX=70667 GN=GBRL2 PE=3 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 5.613e-55
Identity = 83/113 (73.45%), Postives = 100/113 (88.50%), Query Frame = 2
Query:   62 MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            MKFK++ ++SFD RL DS KIK KYP RIP+IVE+HP S++ ++DKHKFLVP DITVAQFMWI+RKRIDL+S+KALFLFVG  +PQAS+T+GQLYED RD+DGFLYA YSGEN
Sbjct:    1 MKFKYKEDNSFDIRLADSAKIKRKYPHRIPVIVERHPYSKIADLDKHKFLVPDDITVAQFMWIIRKRIDLTSEKALFLFVGDVMPQASVTIGQLYEDHRDDDGFLYAHYSGEN 113          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. TrEMBL
Match: Q86E14 (Gamma-aminobutyric acid receptor-associated protein-like 2 OS=Schistosoma japonicum OX=6182 GN=GEF-2 PE=2 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 1.740e-53
Identity = 78/113 (69.03%), Postives = 99/113 (87.61%), Query Frame = 2
Query:   62 MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            MKFKF+  H+F++R +DS KIK KY  R+P++VE+H +S++++IDKHKFLVP D+TVAQFMWI+RKRIDLSS+KALFLFVGK++PQAS T+GQLY DF D DGFLY +YSGEN
Sbjct:    1 MKFKFKESHTFEQRQQDSTKIKNKYAGRVPVVVERHLNSQIVDIDKHKFLVPDDVTVAQFMWIIRKRIDLSSEKALFLFVGKTMPQASATIGQLYADFSDPDGFLYVSYSGEN 113          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. TrEMBL
Match: A0A504YHG6 (Gamma-aminobutyric acid receptor-associated protein 2 OS=Fasciola gigantica OX=46835 GN=FGIG_04272 PE=3 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 1.845e-51
Identity = 77/113 (68.14%), Postives = 95/113 (84.07%), Query Frame = 2
Query:   62 MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            MKFKF+  H+FD+R  DS KIK KYP RIP++VE+HP+S++ +IDKHKFLVP DITVAQF+WI+RKRI LS +KALFLFV  ++PQ S T+GQLY + RD+DGFLYA YSGEN
Sbjct:    1 MKFKFKDHHTFDQRHADSTKIKKKYPNRIPVVVERHPNSQVTDIDKHKFLVPDDITVAQFLWIIRKRIALSEEKALFLFVDNTIPQPSYTIGQLYAECRDDDGFLYAHYSGEN 113          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. TrEMBL
Match: A0A4E0RB59 (Gamma-aminobutyric acid receptor-associated protein 2 OS=Fasciola hepatica OX=6192 GN=D915_005640 PE=3 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 1.845e-51
Identity = 77/113 (68.14%), Postives = 95/113 (84.07%), Query Frame = 2
Query:   62 MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            MKFKF+  H+FD+R  DS KIK KYP RIP++VE+HP+S++ +IDKHKFLVP DITVAQF+WI+RKRI LS +KALFLFV  ++PQ S T+GQLY + RD+DGFLYA YSGEN
Sbjct:    1 MKFKFKDHHTFDQRHADSTKIKKKYPNRIPVVVERHPNSQVTDIDKHKFLVPDDITVAQFLWIIRKRIALSEEKALFLFVDNTIPQPSYTIGQLYAECRDDDGFLYAHYSGEN 113          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Cavefish
Match: gabarapl2 (GABA(A) receptor-associated protein like 2 [Source:ZFIN;Acc:ZDB-GENE-040718-336])

HSP 1 Score: 159.458 bits (402), Expect = 1.626e-50
Identity = 73/113 (64.60%), Postives = 94/113 (83.19%), Query Frame = 2
Query:   62 MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            MK+ F+ +HS + R  +S KI+ KYP R+P+IVEK   S++++IDK K+LVP+DITVAQFMWI+RKRI L S+KA+FLFV K+VPQ+S+TMGQLYE  +DEDGFLY AYSGEN
Sbjct:   18 MKWMFKEDHSLEHRCVESAKIRNKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGEN 130          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Cavefish
Match: ENSAMXT00000014245.2 (gamma-aminobutyric acid receptor-associated protein [Source:NCBI gene;Acc:103044705])

HSP 1 Score: 130.568 bits (327), Expect = 2.713e-39
Identity = 59/113 (52.21%), Postives = 84/113 (74.34%), Query Frame = 2
Query:   62 MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            MKF ++ EH F+KR  + +KI+ KYP R+P+IVEK P +R+ ++DK K+LVP+D+TV QF +++RKRI L ++ ALF FV   +P  S TMGQLY++  +ED FLY AYS E+
Sbjct:    1 MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDES 113          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Cavefish
Match: gabarapb (gamma-aminobutyric acid receptor-associated protein [Source:NCBI gene;Acc:103039768])

HSP 1 Score: 129.028 bits (323), Expect = 1.184e-38
Identity = 58/113 (51.33%), Postives = 84/113 (74.34%), Query Frame = 2
Query:   62 MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            MKF+++ EH F+KR  + +KI+ KYP R+P+IVEK P +R+ ++DK K+LVP+D+TV QF +++RKRI L ++ ALF FV   +P  S TMG LY++  +ED FLY AYS E+
Sbjct:    1 MKFQYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGLLYQEHHEEDFFLYIAYSDES 113          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Cavefish
Match: ENSAMXT00000050433.1 (gamma-aminobutyric acid receptor-associated protein [Source:NCBI gene;Acc:103044705])

HSP 1 Score: 114.005 bits (284), Expect = 8.883e-33
Identity = 50/96 (52.08%), Postives = 72/96 (75.00%), Query Frame = 2
Query:   62 MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYE 349
            MKF ++ EH F+KR  + +KI+ KYP R+P+IVEK P +R+ ++DK K+LVP+D+TV QF +++RKRI L ++ ALF FV   +P  S TMGQLY+
Sbjct:    1 MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQ 96          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Cavefish
Match: zgc:92606 (gamma-aminobutyric acid receptor-associated protein-like 1 [Source:NCBI gene;Acc:103027931])

HSP 1 Score: 93.2041 bits (230), Expect = 9.741e-25
Identity = 47/113 (41.59%), Postives = 76/113 (67.26%), Query Frame = 2
Query:   62 MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            M  ++Q    FD R  + ++++AK+P +IPIIVE+   SR  E+DK K+LVP+D+TV Q  +++R+R+ +  ++ALF FV  S+P +S  +  +YE+  +ED FLY  YS E+
Sbjct:    1 MSSQYQRSVPFDVRRLEGERVRAKHPDKIPIIVERASRSRAPELDKKKYLVPSDLTVGQLCFLIRQRVSMRPEEALFFFVKNSLPPSSSPLSVVYEEHHEEDLFLYMTYSNES 113          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Sea Lamprey
Match: gabarapl2 (GABA(A) receptor-associated protein like 2 [Source:ZFIN;Acc:ZDB-GENE-040718-336])

HSP 1 Score: 162.155 bits (409), Expect = 2.902e-52
Identity = 73/113 (64.60%), Postives = 95/113 (84.07%), Query Frame = 2
Query:   62 MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            MK+ F+ +HSF+ R  +S KI+ KYP R+P++VEK P S++ +IDK K+LVPADITVAQFMWI+RKR+ L SDKA+FLF+ K+VPQ+S ++GQLYED +DEDGFLY AYSGEN
Sbjct:   14 MKWMFKEDHSFEHRRAESNKIRNKYPDRVPVVVEKVPGSQIGDIDKRKYLVPADITVAQFMWIIRKRVQLPSDKAIFLFIDKTVPQSSASIGQLYEDQKDEDGFLYVAYSGEN 126          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Sea Lamprey
Match: map1lc3a (microtubule-associated protein 1 light chain 3 alpha [Source:ZFIN;Acc:ZDB-GENE-040426-2232])

HSP 1 Score: 83.1889 bits (204), Expect = 2.544e-21
Identity = 38/102 (37.25%), Postives = 70/102 (68.63%), Query Frame = 2
Query:   98 KRLEDSQKIKAKYPQRIPIIVEKHPSSR-LIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVG-KSVPQASMTMGQLYEDFRDEDGFLYAAYSGE 397
            +R  D ++I++++P +IP+I+E++   + L  +DK KFLVP  + +++ + ILR+R+ LS ++A FL V  +S+   ++ + Q+YE  +DEDGFLY  Y+ +
Sbjct:   19 ERQRDVEQIRSQHPNKIPVIIERYRGEKQLPMLDKTKFLVPDHVNISELVKILRRRLQLSPNQAFFLLVNQRSMVSVAVPISQVYEQEKDEDGFLYMVYASQ 120          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Sea Lamprey
Match: map1lc3a (microtubule-associated protein 1 light chain 3 alpha [Source:ZFIN;Acc:ZDB-GENE-040426-2232])

HSP 1 Score: 82.4185 bits (202), Expect = 4.392e-21
Identity = 38/110 (34.55%), Postives = 74/110 (67.27%), Query Frame = 2
Query:   74 FQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSR-LIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVG-KSVPQASMTMGQLYEDFRDEDGFLYAAYSGE 397
            F+   SF +R++D + I++++P +IP+I+E++   + L  +DK KFLVP  + +++ + I+R+R+ L+ ++A FL V  +S+   +  + ++YE  RD+DGFLY  Y+ +
Sbjct:    7 FKQRRSFTERVKDVELIRSQHPNKIPVIIERYRGEKQLPMLDKTKFLVPDHVNMSELVKIIRRRLQLNPNQAFFLLVNQRSMVSVAAPICEVYEQERDDDGFLYMVYASQ 116          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Yeast
Match: ATG8 (Component of autophagosomes and Cvt vesicles; regulator of Atg1p, targets it to autophagosomes; binds the Atg1p-Atg13p complex, triggering its vacuolar degradation; unique ubiquitin-like protein whose conjugation target is lipid phosphatidylethanolamine (PE); Atg8p-PE is anchored to membranes, is involved in phagophore expansion, and may mediate membrane fusion during autophagosome formation; deconjugation of Atg8p-PE is required for efficient autophagosome biogenesis [Source:SGD;Acc:S000000174])

HSP 1 Score: 120.939 bits (302), Expect = 2.264e-36
Identity = 54/113 (47.79%), Postives = 81/113 (71.68%), Query Frame = 2
Query:   62 MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            MK  F+ E+ F+KR  +S++I  ++  RIP+I EK   S + EIDK K+LVPAD+TV QF++++RKRI L  +KA+F+FV  ++P  +  M  +Y++ +D+DGFLY  YSGEN
Sbjct:    1 MKSTFKSEYPFEKRKAESERIADRFKNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGEN 113          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Nematostella
Match: EDO45913 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRA1])

HSP 1 Score: 152.91 bits (385), Expect = 1.518e-48
Identity = 70/113 (61.95%), Postives = 89/113 (78.76%), Query Frame = 2
Query:   62 MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            MK+ F+ EHS D R ++S KI+ KYP RIP++VEK P S + +IDK KFLVP+D+TVAQFM+I+RKRI L  +KA+FLFV K +P  S TMG +YE+ +DEDGFLY AYSGEN
Sbjct:    1 MKWAFKEEHSLDSRCQESSKIRLKYPDRIPVVVEKAPKSTIQDIDKRKFLVPSDLTVAQFMYIIRKRIQLPPEKAMFLFVNKVLPTTSSTMGSIYEEHKDEDGFLYIAYSGEN 113          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Nematostella
Match: EDO42340 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1K4])

HSP 1 Score: 128.642 bits (322), Expect = 6.433e-39
Identity = 58/113 (51.33%), Postives = 84/113 (74.34%), Query Frame = 2
Query:   62 MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            MK++++ EH F+KR  + +KI+ KYP R+P+IVEK P +R+ ++DK K+LVP+D+TV QF +++RKRI L  + ALF FV   +P  S TMGQLY++  +ED FLY AYS E+
Sbjct:    1 MKWEYKEEHPFEKRRAEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDES 113          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Nematostella
Match: EDO43061 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZW6])

HSP 1 Score: 97.4413 bits (241), Expect = 1.524e-26
Identity = 50/110 (45.45%), Postives = 74/110 (67.27%), Query Frame = 2
Query:   74 FQVEHSFDKRLEDSQKIKAKYPQRIPIIVEK-HPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFV-GKSVPQASMTMGQLYEDFRDEDGFLYAAYSGE 397
            F+   SF  R ++   I+AK+P +IP+IVE+ H    L  +DK KFLVP ++T++QF+ I+R R+ LSS +A +L V  KS+   SMTM +LY + +DEDGFLY  Y+ +
Sbjct:   14 FKQRKSFVSRRDEVAGIRAKFPSKIPVIVERYHKEKDLPLLDKTKFLVPQELTMSQFVTIIRNRMSLSSTQAFYLIVNNKSLASMSMTMAELYREEKDEDGFLYMVYASQ 123          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Nematostella
Match: EDO35774 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKK3])

HSP 1 Score: 86.2705 bits (212), Expect = 1.776e-22
Identity = 43/101 (42.57%), Postives = 66/101 (65.35%), Query Frame = 2
Query:  101 RLEDSQKIKAKYPQRIPIIVEKHPSSRLIEI-DKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVG-KSVPQASMTMGQLYEDFRDEDGFLYAAYSGE 397
            R  DS+ I  +YP +IP+IVE+  + + + I DK K+LVP D+T++    I+RKR+ L   +A FL V  K++   S T+G++Y D RDEDGFLY  ++ +
Sbjct:    5 RRRDSETITKQYPDKIPVIVERLKTEKNLPILDKIKYLVPGDLTMSSLASIIRKRLQLGPTQAFFLLVNEKNMVSISTTVGEVYRDERDEDGFLYMVFASQ 105          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Medaka
Match: GABARAPL2 (gamma-aminobutyric acid receptor-associated protein-like 2 [Source:NCBI gene;Acc:101171396])

HSP 1 Score: 158.303 bits (399), Expect = 2.567e-50
Identity = 72/113 (63.72%), Postives = 95/113 (84.07%), Query Frame = 2
Query:   62 MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            MK+ F+ +HS + R  +S KI++KYP R+P+IVEK   S++++IDK K+LVP+DITVAQFMWI+RKRI L S+KA+FLFV K+VPQ+S+TMGQLY+  +DEDGFLY AYSGEN
Sbjct:    1 MKWTFKEDHSVEHRCIESAKIRSKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSITMGQLYDKEKDEDGFLYVAYSGEN 113          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Medaka
Match: gabarapb (GABA type A receptor-associated protein [Source:NCBI gene;Acc:101158482])

HSP 1 Score: 128.257 bits (321), Expect = 6.541e-38
Identity = 58/113 (51.33%), Postives = 84/113 (74.34%), Query Frame = 2
Query:   62 MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            MKF+++ EH F+KR  + +KI+ KYP R+P+IVEK P +R+ ++DK K+LVP+D+TV QF +++RKRI L ++ ALF FV   +P  S TMG LY++  +ED FLY AYS E+
Sbjct:    1 MKFQYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGLLYQEHHEEDFFLYIAYSDES 113          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Medaka
Match: ENSORLT00000018992.2 (gamma-aminobutyric acid receptor-associated protein-like 2 [Source:NCBI gene;Acc:101168456])

HSP 1 Score: 112.849 bits (281), Expect = 8.574e-33
Identity = 52/87 (59.77%), Postives = 71/87 (81.61%), Query Frame = 2
Query:   62 MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQA 322
            MK+ F+ +HS + R  +S KI+ KYP R+P+IVEK   S++++IDK K+LVP+DITVAQFMWI+RKRI L S+KA+FLFV K+VPQ+
Sbjct:    1 MKWMFKEDHSLEHRCVESAKIRNKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQS 87          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Medaka
Match: zgc:92606 (gamma-aminobutyric acid receptor-associated protein-like 1 [Source:NCBI gene;Acc:101170049])

HSP 1 Score: 105.531 bits (262), Expect = 1.600e-29
Identity = 47/113 (41.59%), Postives = 75/113 (66.37%), Query Frame = 2
Query:   62 MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            M  ++Q     + R  + ++++AK+P +IPIIVE+ P SR  E+DK K+LVP+D+TV Q  +++R+R+ L  ++ALF FV  S+P +S  +  +YE+   ED FLY  YS E+
Sbjct:    1 MGSQYQRSVPLEVRRAEGERVRAKHPDKIPIIVERAPKSRAPELDKKKYLVPSDLTVGQLCFLIRQRVSLRPEEALFFFVNNSLPPSSFPLSAVYEEHHQEDLFLYMTYSTES 113          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Medaka
Match: map1lc3c (microtubule associated protein 1 light chain 3 gamma [Source:NCBI gene;Acc:101162187])

HSP 1 Score: 95.5153 bits (236), Expect = 1.611e-25
Identity = 46/110 (41.82%), Postives = 73/110 (66.36%), Query Frame = 2
Query:   74 FQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSR-LIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKS-VPQASMTMGQLYEDFRDEDGFLYAAYSGE 397
            F+   SF  R ++   IK+K+P +IP+I+E++   R L  +DK KFLVP ++T+ QF+ I+R R+ L   +A +L +  S +P  S+TM Q+Y+D +DEDGFLY  Y+ +
Sbjct:   14 FKQRKSFATRKQEVAGIKSKFPNKIPVIIERYDKERFLPPLDKTKFLVPHELTMTQFVTIIRNRMALLPSQAFYLLINSSGLPSMSLTMAQVYKDHQDEDGFLYMTYASQ 123          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Planmine SMEST
Match: SMESG000033716.1 (SMESG000033716.1)

HSP 1 Score: 232.261 bits (591), Expect = 1.701e-79
Identity = 113/113 (100.00%), Postives = 113/113 (100.00%), Query Frame = 2
Query:   62 MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN
Sbjct:    1 MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 113          
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Planmine SMEST
Match: SMESG000026465.1 (SMESG000026465.1)

HSP 1 Score: 133.265 bits (334), Expect = 1.814e-40
Identity = 61/113 (53.98%), Postives = 84/113 (74.34%), Query Frame = 2
Query:   62 MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFLVPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRDEDGFLYAAYSGEN 400
            MK++++ EHSFDKR  + +KI+ KYP R+P+IVEK P +R+ ++DK K+LVP D+TV QF +++RKRI L S+ ALF FV   +P  S TMG LYE+  +ED FLY AYS E+
Sbjct:    1 MKWQYKEEHSFDKRRAEGEKIRKKYPDRVPVIVEKAPKARVPDLDKKKYLVPNDLTVGQFYFLIRKRIQLRSEDALFFFVNNVIPPTSFTMGALYEEHHEEDLFLYVAYSDES 113          
The following BLAST results are available for this feature:
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GABARAPL22.644e-5165.49GABA type A receptor associated protein like 2 [So... [more]
GABARAPL19.207e-4052.21GABA type A receptor associated protein like 1 [So... [more]
GABARAPL19.207e-4052.21GABA type A receptor associated protein like 1 [So... [more]
GABARAP5.153e-3952.21GABA type A receptor-associated protein [Source:HG... [more]
GABARAPL22.626e-3360.92GABA type A receptor associated protein like 2 [So... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lgg-11.194e-3853.10pep chromosome:WBcel235:II:6346960:6347719:-1 gene... [more]
lgg-22.877e-1738.18pep chromosome:WBcel235:IV:10934201:10935903:-1 ge... [more]
lgg-22.877e-1738.18pep chromosome:WBcel235:IV:10934186:10935914:-1 ge... [more]
lgg-21.112e-1045.71pep chromosome:WBcel235:IV:10934201:10935825:-1 ge... [more]
lgg-21.112e-1045.71pep chromosome:WBcel235:IV:10934201:10935825:-1 ge... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atg8b1.196e-4051.30gene:FBgn0038539 transcript:FBtr0346730[more]
Atg8b1.196e-4051.30gene:FBgn0038539 transcript:FBtr0083533[more]
Atg8a1.633e-3952.21gene:FBgn0052672 transcript:FBtr0071498[more]
Atg8a2.046e-2751.61gene:FBgn0052672 transcript:FBtr0346376[more]
Atg8a2.708e-2653.01gene:FBgn0052672 transcript:FBtr0346375[more]
back to top
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gabarapl24.276e-5064.60GABA(A) receptor-associated protein like 2 [Source... [more]
gabarapb1.614e-4050.42GABA(A) receptor-associated protein b [Source:ZFIN... [more]
gabarapb9.518e-4052.21GABA(A) receptor-associated protein b [Source:ZFIN... [more]
gabarapa4.232e-3851.33GABA(A) receptor-associated protein a [Source:ZFIN... [more]
gabarapa4.232e-3851.33GABA(A) receptor-associated protein a [Source:ZFIN... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
or3a11.948e-5165.49olfactory receptor family 3 subfamily A member 1 [... [more]
or3a12.685e-4767.65olfactory receptor family 3 subfamily A member 1 [... [more]
gabarapl18.346e-4052.21GABA(A) receptor-associated protein like 1 [Source... [more]
gabarapl18.346e-4052.21GABA(A) receptor-associated protein like 1 [Source... [more]
map1lc3c2.751e-2643.64microtubule associated protein 1 light chain 3 gam... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gabarapl21.815e-5165.49gamma-aminobutyric acid (GABA) A receptor-associat... [more]
Gabarapl16.321e-4052.21gamma-aminobutyric acid (GABA) A receptor-associat... [more]
Gabarapl16.321e-4052.21gamma-aminobutyric acid (GABA) A receptor-associat... [more]
Gabarap3.538e-3952.21gamma-aminobutyric acid receptor associated protei... [more]
Map1lc3b4.925e-2337.27microtubule-associated protein 1 light chain 3 bet... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P60522|GBRL2_RAT1.270e-5065.49Gamma-aminobutyric acid receptor-associated protei... [more]
sp|P60521|GBRL2_MOUSE1.270e-5065.49Gamma-aminobutyric acid receptor-associated protei... [more]
sp|P60520|GBRL2_HUMAN1.270e-5065.49Gamma-aminobutyric acid receptor-associated protei... [more]
sp|P60519|GBRL2_BOVIN1.270e-5065.49Gamma-aminobutyric acid receptor-associated protei... [more]
sp|Q5RF21|GBRL1_PONAB4.105e-4053.10Gamma-aminobutyric acid receptor-associated protei... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1L7H9T62.516e-7597.35ATG8-2 OS=Dugesia japonica OX=6161 PE=2 SV=1[more]
A0A0X3Q9S15.613e-5573.45Gamma-aminobutyric acid receptor-associated protei... [more]
Q86E141.740e-5369.03Gamma-aminobutyric acid receptor-associated protei... [more]
A0A504YHG61.845e-5168.14Gamma-aminobutyric acid receptor-associated protei... [more]
A0A4E0RB591.845e-5168.14Gamma-aminobutyric acid receptor-associated protei... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gabarapl21.626e-5064.60GABA(A) receptor-associated protein like 2 [Source... [more]
ENSAMXT00000014245.22.713e-3952.21gamma-aminobutyric acid receptor-associated protei... [more]
gabarapb1.184e-3851.33gamma-aminobutyric acid receptor-associated protei... [more]
ENSAMXT00000050433.18.883e-3352.08gamma-aminobutyric acid receptor-associated protei... [more]
zgc:926069.741e-2541.59gamma-aminobutyric acid receptor-associated protei... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
gabarapl22.902e-5264.60GABA(A) receptor-associated protein like 2 [Source... [more]
map1lc3a2.544e-2137.25microtubule-associated protein 1 light chain 3 alp... [more]
map1lc3a4.392e-2134.55microtubule-associated protein 1 light chain 3 alp... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ATG82.264e-3647.79Component of autophagosomes and Cvt vesicles; regu... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO459131.518e-4861.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO423406.433e-3951.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO430611.524e-2645.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO357741.776e-2242.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GABARAPL22.567e-5063.72gamma-aminobutyric acid receptor-associated protei... [more]
gabarapb6.541e-3851.33GABA type A receptor-associated protein [Source:NC... [more]
ENSORLT00000018992.28.574e-3359.77gamma-aminobutyric acid receptor-associated protei... [more]
zgc:926061.600e-2941.59gamma-aminobutyric acid receptor-associated protei... [more]
map1lc3c1.611e-2541.82microtubule associated protein 1 light chain 3 gam... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor-associated protein-like 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000033716.11.701e-79100.00SMESG000033716.1[more]
SMESG000026465.11.814e-4053.98SMESG000026465.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029379 ID=SMED30029379|Name=Gamma-aminobutyric acid receptor-associated protein-like 2|organism=Schmidtea mediterranea sexual|type=transcript|length=526bp
TTTTATTTTCTGAGAATCTTATTGGTTTTATCAAAATTTGAGCTTAATTA
ACTTAATAGAAATGAAATTCAAATTTCAAGTTGAACATAGTTTTGATAAG
CGGTTAGAAGATTCTCAGAAAATAAAAGCTAAATATCCTCAAAGAATACC
AATAATTGTTGAAAAACATCCATCATCAAGACTTATTGAAATTGATAAGC
ATAAATTTTTGGTACCGGCCGACATCACCGTAGCGCAATTTATGTGGATT
CTAAGGAAGCGTATAGATTTATCTTCGGATAAAGCACTGTTTTTATTTGT
TGGTAAATCAGTTCCACAAGCAAGTATGACTATGGGTCAACTGTATGAAG
ACTTTAGGGATGAAGACGGATTTCTCTATGCTGCATACAGTGGCGAGAAT
TCGTTTGGATTTTTTTCTTGATTTTATAAATATGACTGAATTTTATTATG
CATTCAGGAGTTTATTTAATTCAATTTTCTAACTTTATTACAAATAAAAA
ATCAGATAGTCCTCTATGTAACGGTG
back to top

protein sequence of SMED30029379-orf-1

>SMED30029379-orf-1 ID=SMED30029379-orf-1|Name=SMED30029379-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=120bp
MKFKFQVEHSFDKRLEDSQKIKAKYPQRIPIIVEKHPSSRLIEIDKHKFL
VPADITVAQFMWILRKRIDLSSDKALFLFVGKSVPQASMTMGQLYEDFRD
EDGFLYAAYSGENSFGFFS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR004241Atg8-like
IPR029071Ubiquitin-like_domsf
Vocabulary: biological process
TermDefinition
GO:0006914autophagy
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 10..128
e-value: 4.5E-50
score: 170.5
NoneNo IPR availablePANTHERPTHR10969:SF33GABA(A) RECEPTOR-ASSOCIATED PROTEIN Bcoord: 13..128
NoneNo IPR availableCDDcd17163Ubl_ATG8_GABARAPL2coord: 17..128
e-value: 5.99033E-66
score: 193.406
IPR004241Autophagy protein Atg8 ubiquitin-likePFAMPF02991Atg8coord: 25..128
e-value: 3.0E-44
score: 149.4
IPR004241Autophagy protein Atg8 ubiquitin-likePANTHERPTHR10969MICROTUBULE-ASSOCIATED PROTEINS 1A/1B LIGHT CHAIN 3-RELATEDcoord: 13..128
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 13..128