Serine protease HTRA2, mitochondrial

Overview
NameSerine protease HTRA2, mitochondrial
Smed IDSMED30029373
Length (bp)2035
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine protease HTRA2, mitochondrial (SMED30029373) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine protease HTRA2, mitochondrial (SMED30029373) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine protease HTRA2, mitochondrial (SMED30029373) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine protease HTRA2, mitochondrial (SMED30029373) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029373

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30029373SMESG000006679.1 SmedASXL_011771SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Human
Match: HTRA1 (HtrA serine peptidase 1 [Source:HGNC Symbol;Acc:HGNC:9476])

HSP 1 Score: 169.088 bits (427), Expect = 5.917e-46
Identity = 110/257 (42.80%), Postives = 148/257 (57.59%), Query Frame = 2
Query:  209 NSFNFIADVVETITPSVVSITX------XXXXXXXXXXXXXIVEDSGYILTNAHVVARNPYVSVTLSDGQKFQGEVIAMDRSSDLALVKVNPGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQRDLGHSKGLR-----YVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGSSRSGGGLGDNTYDTNRSSVRLDSNNNKYMGIVMGSLTPQMAYESKMNHPEY 946
            + +NFIADVVE I P+VV I +          + V+ GSGFIV + G I+TNAHVV     V V L +G  ++ ++  +D  +D+AL+K++  + KL  L     S+LR GEFV+A+GSP +L N+VT G+VS  QR  G   GLR     Y+QTDAII  GNSGGPLVNL GEVIG+NT+ V+ G  FAIPS+   +F+                T   +R +        KY+GI M SLT   A E K  H ++
Sbjct:   61 HKYNFIADVVEKIAPAVVHIELFRKLPFSKREVPVASGSGFIVSEDGLIVTNAHVVTNKHRVKVELKNGATYEAKIKDVDEKADIALIKID-HQGKLPVLLLGRSSELRPGEFVVAIGSPFSLQNTVTTGIVSTTQRG-GKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDKIKKFL----------------TESHDRQAKGKAITKKKYIGIRMMSLTSSKAKELKDRHRDF 299          
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Human
Match: HTRA3 (HtrA serine peptidase 3 [Source:HGNC Symbol;Acc:HGNC:30406])

HSP 1 Score: 170.244 bits (430), Expect = 1.209e-45
Identity = 110/282 (39.01%), Postives = 160/282 (56.74%), Query Frame = 2
Query:  215 FNFIADVVETITPSVVSITXXXXXX------XXXXXXXXIVEDSGYILTNAHVVARNP------YVSVTLSDGQKFQGEVIAMDRSSDLALVKVNPGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQRDLGHSKGLR-----YVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGSSRSGGGLGDNTYDTNRSSVRLDSNNNKYMGIVMGSLTPQMAYESKMNHPEYLVHPTTGVVIHSVFQLSPAHK 1009
            FNFIADVVE I P+VV I +            +S GSGFI+ ++G I+TNAHVV+ N        + V L +G  ++  +  +D+ SD+A +K++P K KL  L     + LR GEFV+A+GSP  L N+VT G+VS  QR+ G   GLR     Y+QTDAII  GNSGGPLVNL GEVIG+NT+ V+ G  FAIPS+   +F+                   T     ++     +++GI M ++TP +  E K ++P++    ++G+ +  V   SP+ +
Sbjct:  140 FNFIADVVEKIAPAVVHIELFLRHPLFGRNVPLSSGSGFIMSEAGLIITNAHVVSSNSAAPGRQQLKVQLQNGDSYEATIKDIDKKSDIATIKIHPKK-KLPVLLLGHSADLRPGEFVVAIGSPFALQNTVTTGIVSTAQRE-GRELGLRDSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDRITRFL-------------------TEFQDKQIKDWKKRFIGIRMRTITPSLVDELKASNPDF-PEVSSGIYVQEVAPNSPSQR 399          
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Human
Match: HTRA1 (HtrA serine peptidase 1 [Source:HGNC Symbol;Acc:HGNC:9476])

HSP 1 Score: 168.703 bits (426), Expect = 7.618e-45
Identity = 110/257 (42.80%), Postives = 148/257 (57.59%), Query Frame = 2
Query:  209 NSFNFIADVVETITPSVVSITX------XXXXXXXXXXXXXIVEDSGYILTNAHVVARNPYVSVTLSDGQKFQGEVIAMDRSSDLALVKVNPGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQRDLGHSKGLR-----YVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGSSRSGGGLGDNTYDTNRSSVRLDSNNNKYMGIVMGSLTPQMAYESKMNHPEY 946
            + +NFIADVVE I P+VV I +          + V+ GSGFIV + G I+TNAHVV     V V L +G  ++ ++  +D  +D+AL+K++  + KL  L     S+LR GEFV+A+GSP +L N+VT G+VS  QR  G   GLR     Y+QTDAII  GNSGGPLVNL GEVIG+NT+ V+ G  FAIPS+   +F+                T   +R +        KY+GI M SLT   A E K  H ++
Sbjct:  167 HKYNFIADVVEKIAPAVVHIELFRKLPFSKREVPVASGSGFIVSEDGLIVTNAHVVTNKHRVKVELKNGATYEAKIKDVDEKADIALIKID-HQGKLPVLLLGRSSELRPGEFVVAIGSPFSLQNTVTTGIVSTTQRG-GKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDKIKKFL----------------TESHDRQAKGKAITKKKYIGIRMMSLTSSKAKELKDRHRDF 405          
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Human
Match: HTRA3 (HtrA serine peptidase 3 [Source:HGNC Symbol;Acc:HGNC:30406])

HSP 1 Score: 159.458 bits (402), Expect = 1.213e-42
Identity = 97/204 (47.55%), Postives = 129/204 (63.24%), Query Frame = 2
Query:  215 FNFIADVVETITPSVVSITXXXXXX------XXXXXXXXIVEDSGYILTNAHVVARNP------YVSVTLSDGQKFQGEVIAMDRSSDLALVKVNPGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQRDLGHSKGLR-----YVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFV 775
            FNFIADVVE I P+VV I +            +S GSGFI+ ++G I+TNAHVV+ N        + V L +G  ++  +  +D+ SD+A +K++P K KL  L     + LR GEFV+A+GSP  L N+VT G+VS  QR+ G   GLR     Y+QTDAII  GNSGGPLVNL GEVIG+NT+ V+ G  FAIPS+   +F+
Sbjct:  140 FNFIADVVEKIAPAVVHIELFLRHPLFGRNVPLSSGSGFIMSEAGLIITNAHVVSSNSAAPGRQQLKVQLQNGDSYEATIKDIDKKSDIATIKIHPKK-KLPVLLLGHSADLRPGEFVVAIGSPFALQNTVTTGIVSTAQRE-GRELGLRDSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDRITRFL 341          
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Human
Match: HTRA2 (HtrA serine peptidase 2 [Source:HGNC Symbol;Acc:HGNC:14348])

HSP 1 Score: 159.073 bits (401), Expect = 1.421e-41
Identity = 111/277 (40.07%), Postives = 158/277 (57.04%), Query Frame = 2
Query:  215 FNFIADVVETITPSVVSITXXXX------XXXXXXXXXXIVEDSGYILTNAHVVARNPYVSVTLSDGQKFQGEVIAMDRSSDLALVKVNPGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQR---DLGHSK-GLRYVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGSSRSGGGLGDNTYDTNRSSVRLDSNNNKYMGIVMGSLTPQMAYESKMNHPEY--LVHPTTGVVIHSVFQLSPAHK 1009
            +NFIADVVE   P+VV I +          + +S GSGF+V   G I+TNAHVVA    V V L  G  ++  V A+D  +D+A +++   K  L +L     + +R GEFV+A+GSP  L N++T G+VS+ QR   DLG  +  + Y+QTDA I  GNSGGPLVNL GEVIGVNTM V+ G  FAIPS+   +F+                  +   SS  +  +  +Y+G++M +L+P +  E ++  P +  + H   GV+IH V   SPAH+
Sbjct:  147 YNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQ-TKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRG---------------EKKNSSSGISGSQRRYIGVMMLTLSPSILAELQLREPSFPDVQH---GVLIHKVILGSPAHR 404          
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Fly
Match: HtrA2 (gene:FBgn0038233 transcript:FBtr0082987)

HSP 1 Score: 178.333 bits (451), Expect = 3.979e-49
Identity = 122/282 (43.26%), Postives = 163/282 (57.80%), Query Frame = 2
Query:  215 FNFIADVVETITPSVVSITXXXXX---------XXXXXXXXXIVEDSGYILTNAHVVARNPY--VSVTLSDGQKFQGEVIAMDRSSDLALVKVNPGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQR---DLG-HSKGLRYVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGSSRSGGGLGDNTYDTNRSSVRLDSNNNKYMGIVMGSLTPQMAYESK---MNHPEYLVHPTTGVVIHSVFQLSPAH 1006
            FNFIADVV     SVV I +  +          +  S GSGFI+E +G ILTNAHVV   P+  V V LSDG+ F   +  +D++SDLA +++    + +  +R  + S LR+GE+V+ALGSP+ LSN+VT GV+S+ QR   +LG  ++ + Y+QTDA IT GNSGGPLVNL GE IGVN+M V+ G  FAIP ++   F++ A    R  G      Y   R           YMGI M +LTP + +E K    N P  L H   GV++  V   SPAH
Sbjct:  103 FNFIADVVAGCADSVVYIEIKDTRHFDYFSGQPITASNGSGFIIEQNGLILTNAHVVINKPHTMVQVRLSDGRTFPATIEDVDQTSDLATLRIQVNNLSV--MRLGKSSTLRSGEWVVALGSPLALSNTVTAGVISSTQRASQELGLRNRDINYLQTDAAITFGNSGGPLVNLDGEAIGVNSMKVTAGISFAIPIDYVKVFLERA-AEKRKKGSAYKTGYPVKR-----------YMGITMLTLTPDILFELKSRSQNMPSNLTH---GVLVWKVIVGSPAH 367          
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Fly
Match: HtrA2 (gene:FBgn0038233 transcript:FBtr0330045)

HSP 1 Score: 178.333 bits (451), Expect = 3.979e-49
Identity = 122/282 (43.26%), Postives = 163/282 (57.80%), Query Frame = 2
Query:  215 FNFIADVVETITPSVVSITXXXXX---------XXXXXXXXXIVEDSGYILTNAHVVARNPY--VSVTLSDGQKFQGEVIAMDRSSDLALVKVNPGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQR---DLG-HSKGLRYVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGSSRSGGGLGDNTYDTNRSSVRLDSNNNKYMGIVMGSLTPQMAYESK---MNHPEYLVHPTTGVVIHSVFQLSPAH 1006
            FNFIADVV     SVV I +  +          +  S GSGFI+E +G ILTNAHVV   P+  V V LSDG+ F   +  +D++SDLA +++    + +  +R  + S LR+GE+V+ALGSP+ LSN+VT GV+S+ QR   +LG  ++ + Y+QTDA IT GNSGGPLVNL GE IGVN+M V+ G  FAIP ++   F++ A    R  G      Y   R           YMGI M +LTP + +E K    N P  L H   GV++  V   SPAH
Sbjct:  103 FNFIADVVAGCADSVVYIEIKDTRHFDYFSGQPITASNGSGFIIEQNGLILTNAHVVINKPHTMVQVRLSDGRTFPATIEDVDQTSDLATLRIQVNNLSV--MRLGKSSTLRSGEWVVALGSPLALSNTVTAGVISSTQRASQELGLRNRDINYLQTDAAITFGNSGGPLVNLDGEAIGVNSMKVTAGISFAIPIDYVKVFLERA-AEKRKKGSAYKTGYPVKR-----------YMGITMLTLTPDILFELKSRSQNMPSNLTH---GVLVWKVIVGSPAH 367          
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Zebrafish
Match: htra3a (HtrA serine peptidase 3a [Source:ZFIN;Acc:ZDB-GENE-040801-245])

HSP 1 Score: 188.734 bits (478), Expect = 3.254e-52
Identity = 124/288 (43.06%), Postives = 172/288 (59.72%), Query Frame = 2
Query:  215 FNFIADVVETITPSVVSITXXX------XXXXXXXXXXXIVEDSGYILTNAHVVARNPYVS------VTLSDGQKFQGEVIAMDRSSDLALVKVNPGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQRDLGHSKGLR-----YVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGSSRSGGGLGDNTYDTNRSSVRLDSNNN----KYMGIVMGSLTPQMAYESKMNHPEYLVHPT--TGVVIHSVFQLSPAHK 1009
            FNFIADVVE I P+VV + +          + +S GSGFI+  SG I+TNAHVVA +  V+      V L DGQ ++  +  +D+ SD+A +K+NP K KLQ L     + LR GEFV+A+GSP  L N+VT G+VS  QRD G   G+R     Y+QTDAII  GNSGGPLVNL GEVIG+NT+ V+ G  FAIPS+  N+F+  +    +        T  T   ++R  S+ N    +++GI M +LT  + +E K ++P +   P   +G+++H V   SPA K
Sbjct:  152 FNFIADVVEKIAPAVVHVELFLNHPLFGRHVPLSSGSGFIMTQSGLIVTNAHVVASSATVTGRQHLRVQLHDGQTYEASIRDIDKKSDIATIKINPKK-KLQVLSLGRSADLRPGEFVVAIGSPFALQNTVTTGIVSTTQRD-GKELGIRDSDMGYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDRINKFLDESNDKQQKVKQRVVRTNYTQSQAMRTASDVNVPMKRFIGIKMVTLTENLVHELKWHNPAF---PDIGSGILVHEVIADSPAQK 434          
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Zebrafish
Match: htra3a (HtrA serine peptidase 3a [Source:ZFIN;Acc:ZDB-GENE-040801-245])

HSP 1 Score: 188.734 bits (478), Expect = 3.254e-52
Identity = 124/288 (43.06%), Postives = 172/288 (59.72%), Query Frame = 2
Query:  215 FNFIADVVETITPSVVSITXXX------XXXXXXXXXXXIVEDSGYILTNAHVVARNPYVS------VTLSDGQKFQGEVIAMDRSSDLALVKVNPGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQRDLGHSKGLR-----YVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGSSRSGGGLGDNTYDTNRSSVRLDSNNN----KYMGIVMGSLTPQMAYESKMNHPEYLVHPT--TGVVIHSVFQLSPAHK 1009
            FNFIADVVE I P+VV + +          + +S GSGFI+  SG I+TNAHVVA +  V+      V L DGQ ++  +  +D+ SD+A +K+NP K KLQ L     + LR GEFV+A+GSP  L N+VT G+VS  QRD G   G+R     Y+QTDAII  GNSGGPLVNL GEVIG+NT+ V+ G  FAIPS+  N+F+  +    +        T  T   ++R  S+ N    +++GI M +LT  + +E K ++P +   P   +G+++H V   SPA K
Sbjct:  152 FNFIADVVEKIAPAVVHVELFLNHPLFGRHVPLSSGSGFIMTQSGLIVTNAHVVASSATVTGRQHLRVQLHDGQTYEASIRDIDKKSDIATIKINPKK-KLQVLSLGRSADLRPGEFVVAIGSPFALQNTVTTGIVSTTQRD-GKELGIRDSDMGYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDRINKFLDESNDKQQKVKQRVVRTNYTQSQAMRTASDVNVPMKRFIGIKMVTLTENLVHELKWHNPAF---PDIGSGILVHEVIADSPAQK 434          
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Zebrafish
Match: htra3a (HtrA serine peptidase 3a [Source:ZFIN;Acc:ZDB-GENE-040801-245])

HSP 1 Score: 188.734 bits (478), Expect = 3.254e-52
Identity = 124/288 (43.06%), Postives = 172/288 (59.72%), Query Frame = 2
Query:  215 FNFIADVVETITPSVVSITXXX------XXXXXXXXXXXIVEDSGYILTNAHVVARNPYVS------VTLSDGQKFQGEVIAMDRSSDLALVKVNPGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQRDLGHSKGLR-----YVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGSSRSGGGLGDNTYDTNRSSVRLDSNNN----KYMGIVMGSLTPQMAYESKMNHPEYLVHPT--TGVVIHSVFQLSPAHK 1009
            FNFIADVVE I P+VV + +          + +S GSGFI+  SG I+TNAHVVA +  V+      V L DGQ ++  +  +D+ SD+A +K+NP K KLQ L     + LR GEFV+A+GSP  L N+VT G+VS  QRD G   G+R     Y+QTDAII  GNSGGPLVNL GEVIG+NT+ V+ G  FAIPS+  N+F+  +    +        T  T   ++R  S+ N    +++GI M +LT  + +E K ++P +   P   +G+++H V   SPA K
Sbjct:  152 FNFIADVVEKIAPAVVHVELFLNHPLFGRHVPLSSGSGFIMTQSGLIVTNAHVVASSATVTGRQHLRVQLHDGQTYEASIRDIDKKSDIATIKINPKK-KLQVLSLGRSADLRPGEFVVAIGSPFALQNTVTTGIVSTTQRD-GKELGIRDSDMGYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDRINKFLDESNDKQQKVKQRVVRTNYTQSQAMRTASDVNVPMKRFIGIKMVTLTENLVHELKWHNPAF---PDIGSGILVHEVIADSPAQK 434          
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Zebrafish
Match: si:dkey-33c12.12 (si:dkey-33c12.12 [Source:ZFIN;Acc:ZDB-GENE-081028-30])

HSP 1 Score: 177.948 bits (450), Expect = 1.127e-48
Identity = 116/275 (42.18%), Postives = 166/275 (60.36%), Query Frame = 2
Query:  215 FNFIADVVETITPSVVSITX------XXXXXXXXXXXXXIVEDSGYILTNAHVVARNPYVSVTLSDGQKFQGEVIAMDRSSDLALVKVNPGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQR---DLGHSKG-LRYVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGSSRSGGGLGDNTYDTNRSSVRLDSNNNKYMGIVMGSLTPQMAYESKMNHPEYLVHPTTGVVIHSVFQLSPAHK 1009
            +NFIADVVE  TP+VV I +       G  + +S GSGFIV   G I+TNAHVVA    V V L++G+ +   V  +D+++D+A +K+N  K  L +LR  + S +R GEFV+A+GSP +L N++T G+VS+ QR   +LG S   + Y+QTDA I  GNSGGPL+NL GEVIG+NTM V+ G  FAIPS+    F+              D + D  +S      +  +Y+G++M +LTP +  E +M  P +    + GV+IH V   SPA++
Sbjct:  124 YNFIADVVEKSTPAVVYIEIVGRHPFSGREVPISNGSGFIVSSDGLIVTNAHVVANKRGVRVKLTNGETYNATVQDVDQAADIATIKINV-KNPLPTLRLGKSSDVRQGEFVVAMGSPFSLKNTITSGIVSSAQRGSKELGLSNSNMDYIQTDATIDFGNSGGPLINLDGEVIGINTMKVTAGISFAIPSDRVRLFL--------------DRSADKQKSWFGESGSKRRYIGVMMLTLTPSIIEELRMRDPSF-PDVSHGVLIHRVIVGSPANR 382          
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Zebrafish
Match: si:dkey-33c12.12 (si:dkey-33c12.12 [Source:ZFIN;Acc:ZDB-GENE-081028-30])

HSP 1 Score: 177.948 bits (450), Expect = 1.127e-48
Identity = 116/275 (42.18%), Postives = 166/275 (60.36%), Query Frame = 2
Query:  215 FNFIADVVETITPSVVSITX------XXXXXXXXXXXXXIVEDSGYILTNAHVVARNPYVSVTLSDGQKFQGEVIAMDRSSDLALVKVNPGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQR---DLGHSKG-LRYVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGSSRSGGGLGDNTYDTNRSSVRLDSNNNKYMGIVMGSLTPQMAYESKMNHPEYLVHPTTGVVIHSVFQLSPAHK 1009
            +NFIADVVE  TP+VV I +       G  + +S GSGFIV   G I+TNAHVVA    V V L++G+ +   V  +D+++D+A +K+N  K  L +LR  + S +R GEFV+A+GSP +L N++T G+VS+ QR   +LG S   + Y+QTDA I  GNSGGPL+NL GEVIG+NTM V+ G  FAIPS+    F+              D + D  +S      +  +Y+G++M +LTP +  E +M  P +    + GV+IH V   SPA++
Sbjct:  124 YNFIADVVEKSTPAVVYIEIVGRHPFSGREVPISNGSGFIVSSDGLIVTNAHVVANKRGVRVKLTNGETYNATVQDVDQAADIATIKINV-KNPLPTLRLGKSSDVRQGEFVVAMGSPFSLKNTITSGIVSSAQRGSKELGLSNSNMDYIQTDATIDFGNSGGPLINLDGEVIGINTMKVTAGISFAIPSDRVRLFL--------------DRSADKQKSWFGESGSKRRYIGVMMLTLTPSIIEELRMRDPSF-PDVSHGVLIHRVIVGSPANR 382          
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Xenopus
Match: psma1 (proteasome subunit alpha 1 [Source:Xenbase;Acc:XB-GENE-995831])

HSP 1 Score: 182.57 bits (462), Expect = 5.040e-50
Identity = 119/282 (42.20%), Postives = 163/282 (57.80%), Query Frame = 2
Query:  215 FNFIADVVETITPSVVSITXXXXXX------XXXXXXXXIVEDSGYILTNAHVVARN------PYVSVTLSDGQKFQGEVIAMDRSSDLALVKVNPGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQRDLGHSKGLR-----YVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGSSRSGGGLGDNTYDTNRSSVRLDSNNNKYMGIVMGSLTPQMAYESKMNHPEYLVHPTTGVVIHSVFQLSPAHK 1009
            FNFIADVVE I P+VV I +            +S GSGFI+ D G I+TNAHVV+ +       Y+ V L +G  ++  +  +D+ SD+A +K+ P K KL  L     + LR GEFV+A+GSP  L N+VT G+VS  QRD G   GLR     YVQTDAII  GNSGGPLVNL GEVIG+NT+ V+ G  FAIPS+   +F+  +           D  Y  N      +    +++GI M ++TP  A E K+++P++    T+G+ +H V   SPA +
Sbjct:  148 FNFIADVVEKIAPAVVHIELFLRHPLFGRNVPLSSGSGFIISDLGLIVTNAHVVSSSNTVSGRQYLKVQLHNGDSYEATIKDIDKKSDIATIKIYPRK-KLPVLLLGHSADLRPGEFVVAIGSPFALQNTVTTGIVSTAQRD-GKELGLRDSDMDYVQTDAIINYGNSGGPLVNLDGEVIGINTLKVAAGISFAIPSDRITKFMTES----------QDKKYKAN------NDGKKRFIGIKMLTITPSFAEEKKLHNPDF-PDVTSGIYVHEVVPNSPAQR 410          
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Xenopus
Match: zic4 (Zic family member 4 [Source:Xenbase;Acc:XB-GENE-1033015])

HSP 1 Score: 167.933 bits (424), Expect = 3.630e-47
Identity = 101/237 (42.62%), Postives = 143/237 (60.34%), Query Frame = 2
Query:  314 IVEDSGYILTNAHVVARNPYVSVTLSDGQKFQGEVIAMDRSSDLALVKVNPGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQRDLGHSKGL-----RYVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGSSRSGGGLGDNTYDTNRSSVRLDSNNNKYMGIVMGSLTPQMAYESKMNHPEYLVHPTTGVVIHSVFQLSPAHK 1009
            +V   G I+TNAHVVA    V V LS+G+ ++  V  +D ++D+A +K+NP K+ L +LR    +++R GEFV+A+GSP +L N++T G+VS+VQR  GH  GL      Y+QTDA I  GNSGGPLVNL GEVIG+NTM V  G  FAIPS+   +F++        G  LG +                +Y+G++M +LTP++  E K   P +    + GV+IH V   SPAH+
Sbjct:    9 LVSPDGLIVTNAHVVANRRRVRVKLSNGESYEAAVRDVDPATDIATIKINP-KVPLPTLRLGRSAEIRQGEFVVAMGSPFSLQNTITSGIVSSVQRG-GHELGLANRDMEYIQTDAAIDFGNSGGPLVNLDGEVIGINTMKVVPGISFAIPSDRVREFLQHGEKRRSQGSLLGSSEV------------KRRYIGVMMLTLTPKILAELKFRDPSF-PDVSHGVLIHKVIVGSPAHE 230          
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Xenopus
Match: mettl3 (methyltransferase like 3 [Source:Xenbase;Acc:XB-GENE-922807])

HSP 1 Score: 161.384 bits (407), Expect = 1.903e-42
Identity = 97/254 (38.19%), Postives = 135/254 (53.15%), Query Frame = 2
Query:  215 FNFIADVVETITPSVVSITXXXXXXXXXXXXXX------IVEDSGYILTNAHVVARNPYVSVTLSDGQKFQGEVIAMDRSSDLALVKVNPGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQR---DLG-HSKGLRYVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGSSRSGGGLGDNTYDTNRSSVRLDSNNNKYMGIVMGSLTPQMAYESKMNHPEY 946
            FNFIADVV+ I P+VV + +                   IV D G I+TNAHV+     + V + DG  +  ++  +D+  D+AL+K++P    L  L     + LR GEFV+ALGSP +L N+VT G++S  QR   +LG     + Y+QTDAII  GNSGGPLVNL GEVIG+NT+ V+ G  FAIPS+   QF+                ++D       L     KYMG+ M  L+  +  E K    ++
Sbjct:  159 FNFIADVVQKIAPAVVHLELFRRSPFTGQEMAVSSGSGFIVSDDGLIVTNAHVLTNKQRIKVEVKDGAHYDAKIKDIDQKLDIALIKIDP-DAPLPVLMLGRSADLRPGEFVVALGSPFSLQNTVTTGIISTTQRGGKELGLKDSDMEYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDRIRQFLA--------------ESHDRQTKGKMLP--KKKYMGVRMLQLSSNLIRELKTRDKDF 395          
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Xenopus
Match: htra1 (HtrA serine peptidase 1 [Source:NCBI gene;Acc:780187])

HSP 1 Score: 118.627 bits (296), Expect = 4.915e-28
Identity = 76/183 (41.53%), Postives = 97/183 (53.01%), Query Frame = 2
Query:  476 KLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQRDLGHSKGLR-----YVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGSSRSGGGLGDNTYDTNRSSVRLDSNNNKYMGIVMGSLTPQMAYESKMNHPEYLVHPTTGVVIHSVFQLSPAHK 1009
            KL  L       LR GEFV+A+GSP +L N+VT G+VS  QR  G   GLR     Y+QTDAII  GNSGGPLVNL GEVIG+NT+ V+ G  FAIPS+   +F+                    NR S    +   KY+GI M SL+     E K    ++  + T+G  I  V   +PA +
Sbjct:  197 KLPVLLLGRSEDLRPGEFVVAIGSPFSLQNTVTTGIVSTAQRG-GKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDKIRKFL----------------AESHNRQSTGQGTKKKKYLGIRMMSLSQGKLKELKEQVKDFPEN-TSGAYIVEVIPDTPAEE 361          
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Xenopus
Match: htra1 (HtrA serine peptidase 1 [Source:NCBI gene;Acc:780187])

HSP 1 Score: 118.627 bits (296), Expect = 9.518e-28
Identity = 76/183 (41.53%), Postives = 97/183 (53.01%), Query Frame = 2
Query:  476 KLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQRDLGHSKGLR-----YVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGSSRSGGGLGDNTYDTNRSSVRLDSNNNKYMGIVMGSLTPQMAYESKMNHPEYLVHPTTGVVIHSVFQLSPAHK 1009
            KL  L       LR GEFV+A+GSP +L N+VT G+VS  QR  G   GLR     Y+QTDAII  GNSGGPLVNL GEVIG+NT+ V+ G  FAIPS+   +F+                    NR S    +   KY+GI M SL+     E K    ++  + T+G  I  V   +PA +
Sbjct:  238 KLPVLLLGRSEDLRPGEFVVAIGSPFSLQNTVTTGIVSTAQRG-GKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDKIRKFL----------------AESHNRQSTGQGTKKKKYLGIRMMSLSQGKLKELKEQVKDFPEN-TSGAYIVEVIPDTPAEE 402          
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Mouse
Match: Htra1 (HtrA serine peptidase 1 [Source:MGI Symbol;Acc:MGI:1929076])

HSP 1 Score: 169.088 bits (427), Expect = 3.527e-45
Identity = 117/280 (41.79%), Postives = 156/280 (55.71%), Query Frame = 2
Query:  209 NSFNFIADVVETITPSVVSITX------XXXXXXXXXXXXXIVEDSGYILTNAHVVARNPYVSVTLSDGQKFQGEVIAMDRSSDLALVKVNPGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQRDLGHSKGLR-----YVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGSSRSGGGLGDNTYDTNRSSVRLDSNNNKYMGIVMGSLTPQMAYESKMNH---PEYLVHPTTGVVIHSVFQLSPAH 1006
            + +NFIADVVE I P+VV I +          + V+ GSGFIV + G I+TNAHVV     V V L +G  ++ ++  +D  +D+AL+K++  + KL  L     S+LR GEFV+A+GSP +L N+VT G+VS  QR  G   GLR     Y+QTDAII  GNSGGPLVNL GEVIG+NT+ V+ G  FAIPS+   +F+                T   +R +        KY+GI M SLT   A E K  H   P+ L    +G  I  V   +PA 
Sbjct:  167 HKYNFIADVVEKIAPAVVHIELYRKLPFSKREVPVASGSGFIVSEDGLIVTNAHVVTNKNRVKVELKNGATYEAKIKDVDEKADIALIKID-HQGKLPVLLLGRSSELRPGEFVVAIGSPFSLQNTVTTGIVSTTQRG-GKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDKIKKFL----------------TESHDRQAKGKAVTKKKYIGIRMMSLTSSKAKELKDRHRDFPDVL----SGAYIIEVIPDTPAE 424          
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Mouse
Match: Htra4 (HtrA serine peptidase 4 [Source:MGI Symbol;Acc:MGI:3036260])

HSP 1 Score: 166.007 bits (419), Expect = 5.041e-44
Identity = 107/277 (38.63%), Postives = 148/277 (53.43%), Query Frame = 2
Query:  209 NSFNFIADVVETITPSVVSITXXXXXXXXXXXXXX------IVEDSGYILTNAHVVARNPYVSVTLSDGQKFQGEVIAMDRSSDLALVKVNPGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQRDLGHSKGLR-----YVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGSSRSGGGLGDNTYDTNRSSVRLDSN-NNKYMGIVMGSLTPQMAYESKMNHPEYLVHPTTGVVIHSVFQLSPA 1003
              +NFIA VVE + PSVV + +       +           IV + G I+TNAHV+     + V L  G +++  V  +D   DLAL+K+ P   +L  L     S LRAGEFV+ALGSP +L N+VT G+VS  QR  G   GL+     Y+QTDAII  GNSGGPLVNL G+VIG+NT+ V+ G  FAIPS+   QF++                 D +   ++  +    KY+G+ M  LT  +  E K   PE+    ++GV ++ V Q S A
Sbjct:  171 RKYNFIAAVVEKVAPSVVHLQLFRRSPLTNQEIPSSSGSGFIVSEDGLIVTNAHVLTNQQKIQVELQSGARYEATVKDIDHKLDLALIKIEP-DTELPVLLLGRSSDLRAGEFVVALGSPFSLQNTVTAGIVSTTQRG-GRELGLKNSDIDYIQTDAIINHGNSGGPLVNLDGDVIGINTLKVTAGISFAIPSDRIRQFLE-----------------DYHERQLKGKAPLQKKYLGLRMLPLTLNLLQEMKRQDPEF-PDVSSGVFVYEVIQGSAA 427          
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Mouse
Match: Htra3 (HtrA serine peptidase 3 [Source:MGI Symbol;Acc:MGI:1925808])

HSP 1 Score: 164.466 bits (415), Expect = 9.836e-44
Identity = 109/282 (38.65%), Postives = 159/282 (56.38%), Query Frame = 2
Query:  215 FNFIADVVETITPSVVSITXXXX------XXXXXXXXXXIVEDSGYILTNAHVVARNPYVS------VTLSDGQKFQGEVIAMDRSSDLALVKVNPGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQRDLGHSKGLR-----YVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGSSRSGGGLGDNTYDTNRSSVRLDSNNNKYMGIVMGSLTPQMAYESKMNHPEYLVHPTTGVVIHSVFQLSPAHK 1009
            FNFIADVVE I P+VV I +          + +S GSGFI+ ++G I+TNAHVV+ +   S      V L +G  ++  +  +D+ SD+A + ++P K KL  L     + LR GEFV+A+GSP  L N+VT G+VS  QRD G   GLR     Y+QTDAII  GNSGGPLVNL GEVIG+NT+ V+ G  FAIPS+   +F+                   +   +  +     +++GI M ++TP +  E K  +P++    ++G+ +  V   SP+ +
Sbjct:  146 FNFIADVVEKIAPAVVHIELFLRHPLFGRNVPLSSGSGFIMSEAGLIVTNAHVVSSSSTASGRQQLKVQLQNGDAYEATIQDIDKKSDIATIVIHPKK-KLPVLLLGHSADLRPGEFVVAIGSPFALQNTVTTGIVSTAQRD-GKELGLRDSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVAAGISFAIPSDRITRFL-------------------SEFQNKHVKDWKKRFIGIRMRTITPSLVEELKAANPDFPAV-SSGIYVQEVVPNSPSQR 405          
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Mouse
Match: Htra2 (HtrA serine peptidase 2 [Source:MGI Symbol;Acc:MGI:1928676])

HSP 1 Score: 160.999 bits (406), Expect = 1.711e-42
Identity = 109/279 (39.07%), Postives = 153/279 (54.84%), Query Frame = 2
Query:  209 NSFNFIADVVETITPSVVSITXXXXXXXXXXXXXX------IVEDSGYILTNAHVVARNPYVSVTLSDGQKFQGEVIAMDRSSDLALVKVNPGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQR---DLGHSKG-LRYVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGSSRSGGGLGDNTYDTNRSSVRLDSNNNKYMGIVMGSLTPQMAYESKMNHPEY--LVHPTTGVVIHSVFQLSPAHK 1009
            + +NFIADVVE   P+VV I +                   +V   G I+TNAHVVA    V V L  G  ++  V A+D  +D+A +++   K  L +L     + +R GEFV+A+GSP  L N++T G+VS+ QR   DLG  +  + Y+QTDA I  GNSGGPLVNL GEVIGVNTM V+ G  FAIPS+   +F+           G   N++     S R      +Y+G++M +LTP +  E ++  P +  + H   GV+IH V   SPAH+
Sbjct:  145 SQYNFIADVVEKTAPAVVYIEILDRHPFSGREVPISNGSGFVVASDGLIVTNAHVVADRRRVRVRLPSGDTYEAMVTAVDPVADIATLRIQ-TKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQNNVEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHR---------GEKKNSWFGTSGSQR------RYIGVMMLTLTPSILIELQLREPSFPDVQH---GVLIHKVILGSPAHR 404          
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Mouse
Match: Htra3 (HtrA serine peptidase 3 [Source:MGI Symbol;Acc:MGI:1925808])

HSP 1 Score: 155.992 bits (393), Expect = 1.469e-41
Identity = 97/204 (47.55%), Postives = 128/204 (62.75%), Query Frame = 2
Query:  215 FNFIADVVETITPSVVSITXXXXXX------XXXXXXXXIVEDSGYILTNAHVVARNPYVS------VTLSDGQKFQGEVIAMDRSSDLALVKVNPGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQRDLGHSKGLR-----YVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFV 775
            FNFIADVVE I P+VV I +            +S GSGFI+ ++G I+TNAHVV+ +   S      V L +G  ++  +  +D+ SD+A + ++P K KL  L     + LR GEFV+A+GSP  L N+VT G+VS  QRD G   GLR     Y+QTDAII  GNSGGPLVNL GEVIG+NT+ V+ G  FAIPS+   +F+
Sbjct:  146 FNFIADVVEKIAPAVVHIELFLRHPLFGRNVPLSSGSGFIMSEAGLIVTNAHVVSSSSTASGRQQLKVQLQNGDAYEATIQDIDKKSDIATIVIHPKK-KLPVLLLGHSADLRPGEFVVAIGSPFALQNTVTTGIVSTAQRD-GKELGLRDSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVAAGISFAIPSDRITRFL 347          
BLAST of Serine protease HTRA2, mitochondrial vs. UniProt/SwissProt
Match: sp|B4PST0|HTRA2_DROYA (Serine protease HTRA2, mitochondrial OS=Drosophila yakuba OX=7245 GN=HtrA2 PE=3 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 9.209e-49
Identity = 122/282 (43.26%), Postives = 164/282 (58.16%), Query Frame = 2
Query:  215 FNFIADVVETITPSVVSITXXXXX---------XXXXXXXXXIVEDSGYILTNAHVVARNPY--VSVTLSDGQKFQGEVIAMDRSSDLALVKVNPGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQR---DLG-HSKGLRYVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGSSRSGGGLGDNTYDTNRSSVRLDSNNNKYMGIVMGSLTPQMAYESK---MNHPEYLVHPTTGVVIHSVFQLSPAH 1006
            FNFIADVV     SVV I +  +          +  S GSGFI+E +G ILTNAHVV   P+  V V LSDG+ F   +  +D++SDLA +++    + +  +R  + S LR+GE+V+ALGSP+ LSN+VT GV+S+ QR   +LG  ++ + Y+QTDA IT GNSGGPLVNL GE IGVN+M V+ G  FAIP ++   F++ A    R  G      Y   R           YMGI M +LTP + +E K    N P +L H   GV++  V   SPAH
Sbjct:  103 FNFIADVVAGCADSVVYIEIKDTRHFDYFSGQPITASNGSGFIIEQNGLILTNAHVVINKPHTMVQVRLSDGRTFPATIEDVDQTSDLATLRIQVNNLSV--MRLGKSSTLRSGEWVVALGSPLALSNTVTAGVISSTQRASQELGLRNRDINYLQTDAAITFGNSGGPLVNLDGEAIGVNSMKVTAGISFAIPIDYVKVFLERA-AEKRKKGSAYKTGYPVKR-----------YMGITMLTLTPDILFELKSRSQNMPSHLTH---GVLVWKVIVGSPAH 367          
BLAST of Serine protease HTRA2, mitochondrial vs. UniProt/SwissProt
Match: sp|B4JTT7|HTRA2_DROGR (Serine protease HTRA2, mitochondrial OS=Drosophila grimshawi OX=7222 GN=HtrA2 PE=3 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 1.445e-48
Identity = 122/282 (43.26%), Postives = 164/282 (58.16%), Query Frame = 2
Query:  215 FNFIADVVETITPSVVSITXXXXX---------XXXXXXXXXIVEDSGYILTNAHVVARNP--YVSVTLSDGQKFQGEVIAMDRSSDLALVKVNPGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQR---DLG-HSKGLRYVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGSSRSGGGLGDNTYDTNRSSVRLDSNNNKYMGIVMGSLTPQMAYESK---MNHPEYLVHPTTGVVIHSVFQLSPAH 1006
            FNFIADVV +   SVV I +  +          +  S GSGF++E +G ILTNAHVV   P   V V LSDG+ F   +  +D++SDLA +++      L  ++  + S LR+GE+V+ALGSP+ LSN+VT GV+S+ QR   +LG  ++ + Y+QTDA IT GNSGGPLVNL GE IGVN+M V+ G  FAIP ++   F++ A    + G       Y T     R       YMGI M +LTP + +E K    N PE L H   GV++  V   SPAH
Sbjct:  107 FNFIADVVASCADSVVYIEIKDTRHFDYFSGQPITASNGSGFVIEQNGLILTNAHVVINKPNTMVQVRLSDGRTFPATIEDVDQTSDLATLRIQ--VTNLSVMKLGKSSTLRSGEWVVALGSPLALSNTVTAGVISSTQRASQELGLRNRDINYLQTDAAITFGNSGGPLVNLDGEAIGVNSMKVTAGISFAIPIDYVKLFLERAAARRKKGSA-----YKTGYPVKR-------YMGITMLTLTPDILFELKSRTQNMPETLSH---GVLVWKVIVGSPAH 371          
BLAST of Serine protease HTRA2, mitochondrial vs. UniProt/SwissProt
Match: sp|Q9VFJ3|HTRA2_DROME (Serine protease HTRA2, mitochondrial OS=Drosophila melanogaster OX=7227 GN=HtrA2 PE=1 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 3.989e-48
Identity = 122/282 (43.26%), Postives = 163/282 (57.80%), Query Frame = 2
Query:  215 FNFIADVVETITPSVVSITXXXXX---------XXXXXXXXXIVEDSGYILTNAHVVARNPY--VSVTLSDGQKFQGEVIAMDRSSDLALVKVNPGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQR---DLG-HSKGLRYVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGSSRSGGGLGDNTYDTNRSSVRLDSNNNKYMGIVMGSLTPQMAYESK---MNHPEYLVHPTTGVVIHSVFQLSPAH 1006
            FNFIADVV     SVV I +  +          +  S GSGFI+E +G ILTNAHVV   P+  V V LSDG+ F   +  +D++SDLA +++    + +  +R  + S LR+GE+V+ALGSP+ LSN+VT GV+S+ QR   +LG  ++ + Y+QTDA IT GNSGGPLVNL GE IGVN+M V+ G  FAIP ++   F++ A    R  G      Y   R           YMGI M +LTP + +E K    N P  L H   GV++  V   SPAH
Sbjct:  103 FNFIADVVAGCADSVVYIEIKDTRHFDYFSGQPITASNGSGFIIEQNGLILTNAHVVINKPHTMVQVRLSDGRTFPATIEDVDQTSDLATLRIQVNNLSV--MRLGKSSTLRSGEWVVALGSPLALSNTVTAGVISSTQRASQELGLRNRDINYLQTDAAITFGNSGGPLVNLDGEAIGVNSMKVTAGISFAIPIDYVKVFLERA-AEKRKKGSAYKTGYPVKR-----------YMGITMLTLTPDILFELKSRSQNMPSNLTH---GVLVWKVIVGSPAH 367          
BLAST of Serine protease HTRA2, mitochondrial vs. UniProt/SwissProt
Match: sp|B4HEM8|HTRA2_DROSE (Serine protease HTRA2, mitochondrial OS=Drosophila sechellia OX=7238 GN=HtrA2 PE=3 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 4.279e-48
Identity = 122/282 (43.26%), Postives = 163/282 (57.80%), Query Frame = 2
Query:  215 FNFIADVVETITPSVVSITXXXXX---------XXXXXXXXXIVEDSGYILTNAHVVARNPY--VSVTLSDGQKFQGEVIAMDRSSDLALVKVNPGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQR---DLG-HSKGLRYVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGSSRSGGGLGDNTYDTNRSSVRLDSNNNKYMGIVMGSLTPQMAYESK---MNHPEYLVHPTTGVVIHSVFQLSPAH 1006
            FNFIADVV     SVV I +  +          +  S GSGFI+E +G ILTNAHVV   P+  V V LSDG+ F   +  +D++SDLA +++    + +  +R  + S LR+GE+V+ALGSP+ LSN+VT GV+S+ QR   +LG  ++ + Y+QTDA IT GNSGGPLVNL GE IGVN+M V+ G  FAIP ++   F++ A    R  G      Y   R           YMGI M +LTP + +E K    N P  L H   GV++  V   SPAH
Sbjct:  103 FNFIADVVAGCADSVVYIEIKDTRHFDYFSGQPITASNGSGFIIEQNGLILTNAHVVINKPHTMVQVRLSDGRTFPATIEDVDQTSDLATLRIQVNNLSV--MRLGKSSTLRSGEWVVALGSPLALSNTVTAGVISSTQRASQELGLRNRDINYLQTDAAITFGNSGGPLVNLDGEAIGVNSMKVTAGISFAIPIDYVKVFLERA-AEKRKKGSAYKTGYPVKR-----------YMGITMLTLTPDILFELKSRSQNMPSNLTH---GVLVWKVIVGSPAH 367          
BLAST of Serine protease HTRA2, mitochondrial vs. UniProt/SwissProt
Match: sp|B4QZU6|HTRA2_DROSI (Serine protease HTRA2, mitochondrial OS=Drosophila simulans OX=7240 GN=HtrA2 PE=3 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 4.636e-48
Identity = 122/282 (43.26%), Postives = 163/282 (57.80%), Query Frame = 2
Query:  215 FNFIADVVETITPSVVSITXXXXX---------XXXXXXXXXIVEDSGYILTNAHVVARNPY--VSVTLSDGQKFQGEVIAMDRSSDLALVKVNPGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQR---DLG-HSKGLRYVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGSSRSGGGLGDNTYDTNRSSVRLDSNNNKYMGIVMGSLTPQMAYESK---MNHPEYLVHPTTGVVIHSVFQLSPAH 1006
            FNFIADVV     SVV I +  +          +  S GSGFI+E +G ILTNAHVV   P+  V V LSDG+ F   +  +D++SDLA +++    + +  +R  + S LR+GE+V+ALGSP+ LSN+VT GV+S+ QR   +LG  ++ + Y+QTDA IT GNSGGPLVNL GE IGVN+M V+ G  FAIP ++   F++ A    R  G      Y   R           YMGI M +LTP + +E K    N P  L H   GV++  V   SPAH
Sbjct:  103 FNFIADVVAGCADSVVYIEIKDTRHFDYFSGQPITASNGSGFIIEQNGLILTNAHVVINKPHTMVQVRLSDGRTFPATIEDVDQTSDLATLRIQVNNLSV--MRLGKSSTLRSGEWVVALGSPLALSNTVTAGVISSTQRASQELGLRNRDINYLQTDAAITFGNSGGPLVNLDGEAIGVNSMKVTAGISFAIPIDYVKVFLERA-AEKRKKGSAYKTGYPVKR-----------YMGITMLTLTPDILFELKSRSQNMPNNLTH---GVLVWKVIVGSPAH 367          
BLAST of Serine protease HTRA2, mitochondrial vs. TrEMBL
Match: A0A183AD69 (PDZ domain-containing protein OS=Echinostoma caproni OX=27848 PE=4 SV=1)

HSP 1 Score: 230.72 bits (587), Expect = 5.092e-65
Identity = 135/289 (46.71%), Postives = 186/289 (64.36%), Query Frame = 2
Query:  194 RQDQINSFNFIADVVETITPSVVSITXXXXXXXXXXXXXX----IVEDSGYILTNAHVVARNPYVSVTLSDGQKFQGEVIAMDRSSDLALVK--VNPGKIK-LQSLRFA-EISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQRDLGHSKGLRYVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGSS----RSGGG----LGDNTYDTNRSSVRLDSNNNKYMGIVMGSLTPQMAYE-SKMNHPEYLVHPTTGVVIHSVFQLSPAHK 1009
            R   I S + +ADV + + P+VVSIT                  I++DSG+++TNAHVV     V V LSDG+ + G V+A+D SSDLAL++  V P   + L  L  A ++  +R G FV+ALGSP+ L+NSVTVGVVSA+ RDLGHS+GL+Y+QTDAIITVGNSGGPLVNLYGEVIGVN+M+   G GFAIP +   +F +LA+ +S    +S  G     GD+   T   S    +   +Y+G+VM +LTP++A+E +    P++L   T GV+IH++ + SPA K
Sbjct:   82 RLSAIRSLDVVADVAQEVQPAVVSITSRDKGFLSRHIQSSGSGFIIDDSGHVITNAHVVGYRSDVFVHLSDGRSYPGRVLAVDVSSDLALIQLDVKPETARSLPQLPLARDLKSVRPGHFVLALGSPLMLANSVTVGVVSALDRDLGHSEGLKYIQTDAIITVGNSGGPLVNLYGEVIGVNSMIAGIGVGFAIPVDQVRKFSELALQASQRAEKSAHGTPEVAGDSYILTESGSPPRGAPQRRYLGLVMRTLTPELAFELASRGGPQFL-EITEGVLIHAILRNSPAQK 369          
BLAST of Serine protease HTRA2, mitochondrial vs. TrEMBL
Match: A0A3P8K1L0 (PDZ domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS4904 PE=4 SV=1)

HSP 1 Score: 230.72 bits (587), Expect = 5.253e-65
Identity = 135/289 (46.71%), Postives = 186/289 (64.36%), Query Frame = 2
Query:  194 RQDQINSFNFIADVVETITPSVVSITXXXXXXXXXXXXXX----IVEDSGYILTNAHVVARNPYVSVTLSDGQKFQGEVIAMDRSSDLALVK--VNPGKIK-LQSLRFA-EISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQRDLGHSKGLRYVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGSS----RSGGG----LGDNTYDTNRSSVRLDSNNNKYMGIVMGSLTPQMAYE-SKMNHPEYLVHPTTGVVIHSVFQLSPAHK 1009
            R   I S + +ADV + + P+VVSIT                  I++DSG+++TNAHVV     V V LSDG+ + G V+A+D SSDLAL++  V P   + L  L  A ++  +R G FV+ALGSP+ L+NSVTVGVVSA+ RDLGHS+GL+Y+QTDAIITVGNSGGPLVNLYGEVIGVN+M+   G GFAIP +   +F +LA+ +S    +S  G     GD+   T   S    +   +Y+G+VM +LTP++A+E +    P++L   T GV+IH++ + SPA K
Sbjct:   82 RLSAIRSLDVVADVAQEVQPAVVSITSRDKGFLSRHIQSSGSGFIIDDSGHVITNAHVVGYRSDVFVHLSDGRSYPGRVLAVDVSSDLALIQLDVKPETARSLPQLPLARDLKSVRPGHFVLALGSPLMLANSVTVGVVSALDRDLGHSEGLKYIQTDAIITVGNSGGPLVNLYGEVIGVNSMIAGIGVGFAIPVDQVRKFSELALQASQRAEKSAHGTPEVAGDSYILTESGSPPRGAPQRRYLGLVMRTLTPELAFELASRGGPQFL-EITEGVLIHAILRNSPAQK 369          
BLAST of Serine protease HTRA2, mitochondrial vs. TrEMBL
Match: A0A1S8X5U0 (Trypsin (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_02087 PE=4 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 2.031e-64
Identity = 138/293 (47.10%), Postives = 182/293 (62.12%), Query Frame = 2
Query:  194 RQDQINSFNFIADVVETITPSVVSITXXXXXXXXXXXXXX----IVEDSGYILTNAHVVARNPYVSVTLSDGQKFQGEVIAMDRSSDLALVKVN-PGKIK--LQSLRFAEISKL-RAGEFVIALGSPMTLSNSVTVGVVSAVQRDLGHSKGLRYVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLA------------IGSSRSGGGLGDNTYDTNRSSVRLDSNNNKYMGIVMGSLTPQMAYE-SKMNHPEYLVHPTTGVVIHSVFQLSPAHK 1009
            RQ  I S   +ADV +   P+VVSIT                  I++D+G+++TNAHVV     V V LSDG+ F G V+A+D SSDLAL++++   KI   L  L  A   KL R G FV+ALGSP+ L+NSVTVGVVSA+ RDLGHS+GL+Y+QTDAIIT GNSGGPLVNL GEVIGVN+M+  TG GFAIP +    FV++A            IGS R     GD    T   +    +   +Y+G+VM +LTP++A+E      P+Y+ + T GV+IHS+ + SPAH+
Sbjct:  106 RQAAIRSLEVVADVAQEAQPAVVSITSMDKGFLARHTQSTGSGFIIDDAGHVITNAHVVGYRTNVFVHLSDGRSFPGRVLAVDMSSDLALIRLDVKEKIAKALPQLALAPDLKLVRPGHFVLALGSPLMLANSVTVGVVSALDRDLGHSEGLKYIQTDAIITFGNSGGPLVNLMGEVIGVNSMIAGTGVGFAIPVDQVRNFVQMALQAAARTGKSGPIGSRRDA---GDPHILTESGTTPSGAPARRYLGLVMRTLTPELAFELGSRGGPQYM-NVTEGVLIHSIMRNSPAHR 394          
BLAST of Serine protease HTRA2, mitochondrial vs. TrEMBL
Match: A0A074ZJF5 (PDZ domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_06722 PE=4 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 3.914e-64
Identity = 138/293 (47.10%), Postives = 182/293 (62.12%), Query Frame = 2
Query:  194 RQDQINSFNFIADVVETITPSVVSITXXXXXXXXXXXXXX----IVEDSGYILTNAHVVARNPYVSVTLSDGQKFQGEVIAMDRSSDLALVKVN-PGKIK--LQSLRFAEISKL-RAGEFVIALGSPMTLSNSVTVGVVSAVQRDLGHSKGLRYVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLA------------IGSSRSGGGLGDNTYDTNRSSVRLDSNNNKYMGIVMGSLTPQMAYE-SKMNHPEYLVHPTTGVVIHSVFQLSPAHK 1009
            RQ  I S   +ADV +   P+VVSIT                  I++D+G+++TNAHVV     V V LSDG+ F G V+A+D SSDLAL++++   KI   L  L  A   KL R G FV+ALGSP+ L+NSVTVGVVSA+ RDLGHS+GL+Y+QTDAIIT GNSGGPLVNL GEVIGVN+M+  TG GFAIP +    FV++A            IGS R     GD    T   +    +   +Y+G+VM +LTP++A+E      P+Y+ + T GV+IHS+ + SPAH+
Sbjct:  139 RQAAIRSLEVVADVAQEAQPAVVSITSMDKGFLARHTQSTGSGFIIDDAGHVITNAHVVGYRTNVFVHLSDGRSFPGRVLAVDMSSDLALIRLDVKEKIAKALPQLALAPDLKLVRPGHFVLALGSPLMLANSVTVGVVSALDRDLGHSEGLKYIQTDAIITFGNSGGPLVNLMGEVIGVNSMIAGTGVGFAIPVDQVRNFVQMALQAAARTGKSGPIGSRRDA---GDPHILTESGTTPSGAPARRYLGLVMRTLTPELAFELGSRGGPQYM-NVTEGVLIHSIMRNSPAHR 427          
BLAST of Serine protease HTRA2, mitochondrial vs. TrEMBL
Match: A0A4S2L6Y3 (PDZ domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009389 PE=4 SV=1)

HSP 1 Score: 229.18 bits (583), Expect = 6.624e-64
Identity = 133/292 (45.55%), Postives = 184/292 (63.01%), Query Frame = 2
Query:  194 RQDQINSFNFIADVVETITPSVVSITXXXXXXXXXXXXXX----IVEDSGYILTNAHVVARNPYVSVTLSDGQKFQGEVIAMDRSSDLALVKVNPGKI---KLQSLRFAEISKL-RAGEFVIALGSPMTLSNSVTVGVVSAVQRDLGHSKGLRYVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGSSRSGGGLGD----NTYDTNRSSVRLDSNN-------NKYMGIVMGSLTPQMAYE-SKMNHPEYLVHPTTGVVIHSVFQLSPAHK 1009
            RQ  I S   +ADV +   P+VVSIT                  I++D+G+++TNAHVV     V V LSDG+ F G V+A+D SSDLAL++++  ++    L  L  A   KL R G FV+ALGSP+ L+NSVTVGVVSA+ RDLGHS+GL+Y+QTDAIIT GNSGGPLVNL GEVIGVN+M+  TG GFAIP +    FV++A+ ++   G  G     +  D   S +  +S          +Y+G+VM +LTP++A+E S    P+++   T GV+IH++ + SPAH+
Sbjct:  129 RQAAIRSLEVVADVAQEAQPAVVSITSMDKGFLARHTQSTGSGFIIDDAGHVITNAHVVGYRTNVFVHLSDGRSFPGRVLAVDMSSDLALIRLDVKEVISKALPQLALAPDLKLVRPGHFVLALGSPLMLANSVTVGVVSALDRDLGHSEGLKYIQTDAIITFGNSGGPLVNLMGEVIGVNSMVAGTGVGFAIPVDQVRNFVQIALQAAAQTGKSGPIGSGSRRDAGDSHILTESGTTPSGAPARRYLGLVMRTLTPELAFELSSRGGPQFM-DVTEGVLIHAIMRNSPAHR 419          
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Cavefish
Match: si:dkey-33c12.12 (serine protease HTRA2, mitochondrial [Source:NCBI gene;Acc:103043568])

HSP 1 Score: 184.882 bits (468), Expect = 2.733e-51
Identity = 119/275 (43.27%), Postives = 165/275 (60.00%), Query Frame = 2
Query:  215 FNFIADVVETITPSVVSITX------XXXXXXXXXXXXXIVEDSGYILTNAHVVARNPYVSVTLSDGQKFQGEVIAMDRSSDLALVKVNPGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQR---DLGHSK-GLRYVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGSSRSGGGLGDNTYDTNRSSVRLDSNNNKYMGIVMGSLTPQMAYESKMNHPEYLVHPTTGVVIHSVFQLSPAHK 1009
            +NFIADVVE  TP+VV I +       G  + VS GSGFIV   G I+TNAHVVA    V V L+ G+ +   V  +D+++D+A +K+ P K  L +LR A+ S++R GEFV+A+GSP  L N++T G+VS+ QR   +LG S   + Y+QTDA I  GNSGGPL+NL GEVIG+NTM V+ G  FAIPS+    F+  A               D  +S     +   +Y+G++M +LTP +  E KM  P +    T G++IH +   SPAH+
Sbjct:  133 YNFIADVVEKSTPAVVYIEIVGRHMFSGRDVAVSNGSGFIVSSDGLIVTNAHVVANKRDVRVKLTSGETYNAVVQDVDQAADIATIKIQP-KHPLPTLRLAQSSEVRQGEFVVAMGSPFALRNTITSGIVSSTQRGSKELGLSNPNMDYIQTDATIDFGNSGGPLINLDGEVIGINTMKVTAGISFAIPSDRVRVFLNQA--------------ADKKKSWFSESTTKRRYVGVMMLTLTPSIIAELKMRDPLF-PDVTHGILIHRIISGSPAHR 391          
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Cavefish
Match: htra1a (serine protease HTRA1A [Source:NCBI gene;Acc:103042183])

HSP 1 Score: 176.792 bits (447), Expect = 6.004e-48
Identity = 117/275 (42.55%), Postives = 158/275 (57.45%), Query Frame = 2
Query:  215 FNFIADVVETITPSVVSITX------XXXXXXXXXXXXXIVEDSGYILTNAHVVARNPYVSVTLSDGQKFQGEVIAMDRSSDLALVKVN-PGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQRDLGHSKGLR-----YVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGSSRSGGGLGDNTYDTNRSSVRLDSNNNKYMGIVMGSLTPQMAYESKMNHPEYLVHPTTGVVIHSVFQLSPA 1003
            +NFIADVVE I P+VV I +          + V+ GSGF+V D G I+TNAHVVA    V V L +G  +  ++  +D  SD+AL+K++ P K+ + SL     + LR GEFV+A+GSP +L N+VT G+VS  QR  G   GLR     Y+QTDAII  GNSGGPLVNL GEVIG+NT+ V+ G  FAIPS+   QF+                +YD  R +        KY+G+ M +LTP +A E K    ++    T+G  +  V   +PA
Sbjct:  170 YNFIADVVEKIAPAVVHIELYRKMVYSKREMAVASGSGFVVSDDGLIVTNAHVVANKNRVKVELKNGASYDAKIKDVDEKSDIALIKIDSPSKLSVLSL--GRSADLRPGEFVVAIGSPFSLQNTVTTGIVSTTQRG-GKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDKITQFLS--------------ESYD--RQARGRGGVKKKYIGVRMMTLTPALAKELKAKQRDF-PDITSGAYVIEVITKTPA 424          
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Cavefish
Match: htra1b (serine protease HTRA1B-like [Source:NCBI gene;Acc:103041103])

HSP 1 Score: 173.711 bits (439), Expect = 6.525e-47
Identity = 109/277 (39.35%), Postives = 150/277 (54.15%), Query Frame = 2
Query:  209 NSFNFIADVVETITPSVVSITXXXXXXXXXXXXXX------IVEDSGYILTNAHVVARNPYVSVTLSDGQKFQGEVIAMDRSSDLALVKVNPGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQRDLGHSKGLR-----YVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGSSRSGGGLGDNTYDTNRSSVRLDSNNNKYMGIVMGSLTPQMAYESKMNHPEYLVHPTTGVVIHSVFQLSPAH 1006
            + +NFIADVVE I P+VV I +   ++              IV + G I+TNAHVVA    V V L  G  +  ++  +D  +D+AL+K++   +KL  L     + LR GEFV+A+GSP +L N+VT G+VS  QR  G   GLR     Y+QTDAII  GNSGGPLVNL GEVIG+NT+ V+ G  FAIPS+   QF+                T   +R +        KY+G+ M +LTP +A E K    ++    T+G  +  V   +PA 
Sbjct:  158 HKYNFIADVVEKIAPAVVHIELYRKMVFSKREVAVASGSGFIVSEDGLIVTNAHVVANKHRVKVELKSGATYDAKIKDVDEKADIALIKID-APMKLPVLLLGRSADLRPGEFVVAIGSPFSLQNTVTTGIVSTTQRG-GKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDKIRQFL----------------TESHDRQAKGKLPMKKKYIGVRMMTLTPTLAKELKERQSDF-PDVTSGAYVIEVIPKTPAE 415          
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Cavefish
Match: HTRA3 (HtrA serine peptidase 3 [Source:HGNC Symbol;Acc:HGNC:30406])

HSP 1 Score: 169.474 bits (428), Expect = 1.527e-45
Identity = 114/281 (40.57%), Postives = 163/281 (58.01%), Query Frame = 2
Query:  215 FNFIADVVETITPSVVSITXXXX------XXXXXXXXXXIVEDSGYILTNAHVVARNPYVS------VTLSDGQKFQGEVIAMDRSSDLALVKVNPGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQRD---LG-HSKGLRYVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGSSRSGGGLGDNTYDTNRSSVRLDSNNNKYMGIVMGSLTPQMAYESKMNHPEYLVHPTTGVVIHSVFQLSPAHK 1009
            FNFIADVVE I P+VV + +  S       + +S GSGF++ ++G I+TNAHVV+    VS      V + DG  ++  +  +D+ SD+A +K+N  K KL  L     + LR GEFV+A+GSP  L N+VT G+VS  QRD   LG     + Y+QTDAII  GNSGGPLVNL GEVIG+NT+ V+ G  FAIPS+   +F+  ++G                +S V+      +++GI M ++T  +  E K  +P++    T+G+ +H V   SPA K
Sbjct:  143 FNFIADVVEKIAPAVVHVELFLSHPLFGRTVPLSSGSGFVMSETGLIVTNAHVVSSTTAVSGRQQLKVQMHDGNVYEATIKDIDKKSDIATIKINTQK-KLPVLLLGHSADLRPGEFVVAIGSPFALQNTVTTGIVSTAQRDGKELGIQDSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVAAGISFAIPSDRITRFLNDSMG---------------KQSKVK-----KRFIGIRMLTITEALVDELKQQNPDF-PDVTSGIYVHEVVPHSPAQK 401          
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Cavefish
Match: htra3a (HtrA serine peptidase 3a [Source:ZFIN;Acc:ZDB-GENE-040801-245])

HSP 1 Score: 161.77 bits (408), Expect = 7.872e-43
Identity = 115/281 (40.93%), Postives = 156/281 (55.52%), Query Frame = 2
Query:  215 FNFIADVVETITPSVVSITXXXX------XXXXXXXXXXIVEDSGYILTNAHVVARNPYVS------VTLSDGQKFQGEVIAMDRSSDLALVKVNPGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQRD---LG-HSKGLRYVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGSSRSGGGLGDNTYDTNRSSVRLDSNNNKYMGIVMGSLTPQMAYESKMNHPEYLVHPTTGVVIHSVFQLSPAHK 1009
            FNFIADVVE I P+VV I +  S       + +S GSGFI+ DSG I+TNAHVV  +  V+      V L DGQ F+  +  +D+ SD+A +KVN                    +FV+A+GSP  L N+VT G+VS  QRD   LG     + Y+QTDAII  GNSGGPLVNL GEVIG+NT+ V+ G  FAIPS+  N+F+         G  L      T R           Y+GI M +LT  +  E K ++P++    ++G++++ V Q SPA +
Sbjct:  150 FNFIADVVEKIAPAVVHIELFVSHPVFGRRVPLSSGSGFIMTDSGLIVTNAHVVTSSATVAGRQQLRVQLHDGQTFEATIRDIDKKSDIATIKVN-------------------TKFVVAIGSPFALQNTVTTGIVSTAQRDGKELGIQDSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDRINRFLDEFNEKHNKGKNLTMPYITTKR-----------YIGIRMMTLTEDLVEELKQHNPDF-PDISSGILVYDVIQDSPAQQ 399          
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Sea Lamprey
Match: HTRA1 (HtrA serine peptidase 1 [Source:HGNC Symbol;Acc:HGNC:9476])

HSP 1 Score: 135.191 bits (339), Expect = 1.549e-35
Identity = 87/201 (43.28%), Postives = 123/201 (61.19%), Query Frame = 2
Query:  215 FNFIADVVETITPSVVSITXXXXXX------XXXXXXXXIVEDSGYILTNAHVVARNP---YVSVTLSDGQKFQGEVIAMDRSSDLALVKVNPGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQRDLGHSKGLR-----YVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFV 775
             NFIA+V E    +VV + +    L       VS GSGF+V + G ILTNAHVV        V V L++G  ++   + +D  +++A++K+N  K KL  LR A  ++LR GEFV+A+GSP  L N+VT G+VS  QR  G   GL      Y+QTDA++  G++GGPLVNL GEV+G+NT+ V+ G  FAIPS+   + +
Sbjct:  100 LNFIANVTERARRAVVHVELLARHLLFDRNVSVSSGSGFLVSEDGLILTNAHVVTHKRDLVAVKVQLTNGDTYEAWPLHVDMHANIAVIKIN-AKQKLPVLRLARSAELRPGEFVVAIGSPFKLQNTVTTGIVSTAQRG-GQELGLDDSDHDYIQTDAMVNYGSAGGPLVNLDGEVVGINTLKVTAGISFAIPSDRIRELL 298          
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Sea Lamprey
Match: HTRA1 (HtrA serine peptidase 1 [Source:HGNC Symbol;Acc:HGNC:9476])

HSP 1 Score: 129.413 bits (324), Expect = 9.607e-35
Identity = 83/189 (43.92%), Postives = 108/189 (57.14%), Query Frame = 2
Query:  209 NSFNFIADVVETITPSVVSITXXXXX------XXXXXXXXXIVEDSGYILTNAHVVARNPYVSVTLSDGQKFQGEVIAMDRSSDLALVKVN------------------PGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQRDLGHSKGLR-----YVQTDAIITVGNSGGPLVNL 688
            + FNFIADVVE I P+VV I +          + V+ GSGF+V + G I+TNAHVV    YV V L DG+ ++  V+  D  +D+A +++                   P + KL  LR A  ++LR GEFV+A+GSP  L N+VT G+VS  QR  G   GL      Y+QTDAII  GNSGGPLVNL
Sbjct:    7 DRFNFIADVVEKIVPAVVHIELYSRHPFFNRNISVASGSGFMVSEDGVIVTNAHVVVNKRYVKVQLHDGESYEASVVDADEKADIATIRIKAKVTCRLRSSADVAAAPLPSQQKLPVLRLARSAELRPGEFVVAIGSPFKLQNTVTTGIVSTAQRG-GQELGLEDSDADYIQTDAIINYGNSGGPLVNL 194          
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Sea Lamprey
Match: HTRA1 (HtrA serine peptidase 1 [Source:HGNC Symbol;Acc:HGNC:9476])

HSP 1 Score: 127.102 bits (318), Expect = 3.824e-34
Identity = 77/178 (43.26%), Postives = 98/178 (55.06%), Query Frame = 2
Query:  218 NFIADVVETITPSVVSITXXXXXXXXXXXXXX-----------------IVEDSGYILTNAHVVARNPYVSVTLSDGQKFQGEVIAMDRSSDLALVKVNPGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQRDLGHSKGLR-----YVQTDAIITVGNSGGPLVN 685
            NFIADVVE I P+VV I +    L                         +V + G I+TNAHVV    YV V L DG+ ++  V+  D  +D+A +++   K KL  LR A  ++LR GEFV+A+GSP  L N+VT G+VS  QR  G   GL      Y+QTDAII  GNSGGPLVN
Sbjct:    1 NFIADVVEKIVPAVVHIELYSRSLSRQSSYAARHPFFNRNISVASGSGFMVSEDGVIVTNAHVVVNKRYVKVQLHDGESYEASVVDADEKADIATIRIK-AKQKLPVLRLARSAELRPGEFVVAIGSPFKLQNTVTTGIVSTAQRG-GQELGLEDSDADYIQTDAIINYGNSGGPLVN 176          
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002935.1 (pep scaffold:Pmarinus_7.0:GL478486:180388:188108:-1 gene:ENSPMAG00000002674.1 transcript:ENSPMAT00000002935.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.3673 bits (246), Expect = 2.651e-24
Identity = 69/175 (39.43%), Postives = 98/175 (56.00%), Query Frame = 2
Query:  215 FNFIADVVETITPSVVSITXXXXXXXXXXXXXX------IVEDSGYILTNAHVVA---RNPYVSVTLSDGQKFQGEVIAMDRSSDLALVKVNPGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQ--RDLG--HSKGLRYVQTDAIITVGNSGGPLVNLYGEV 700
            +NFIADVV+   P+VV I +  S    +  +        +V D G I+TNAHVV        V VTL  G+ ++ EV  +D   D+A ++++P +  L  L+    S+LR GEFV+A+GSP  L N+VT G+ +A +  R+LG  +SK   Y         GNSGGPLVNL  +V
Sbjct:   15 YNFIADVVQRAAPAVVHIEIFKSPPSYARAAPVSSGSGFLVSDEGLIVTNAHVVGGGGATRVVMVTLRGGRSYEAEVTDVDTKVDIATIRIHP-QHPLAVLQLGRSSELRPGEFVVAIGSPFALQNTVTTGMSTAQRGGRELGLHNSKRDTYWIAKHTKHYGNSGGPLVNLVSDV 188          
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Nematostella
Match: EDO41765 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3G1])

HSP 1 Score: 60.8474 bits (146), Expect = 1.039e-9
Identity = 57/156 (36.54%), Postives = 76/156 (48.72%), Query Frame = 2
Query:  335 ILTNAHVVARNPYVSVTLS-DGQKFQGEVIAMDRSSDLALVKVNPGKI--KLQSLRFAEISKLRAGEFVIALGSPMTLSN-SVTVGVVSAV--QRDLGHSKGLRYVQTDAIITVGNSGGPLVNLYGEVIGV--NTMMVSTGFGFAIPSNHCNQFVK 778
            ILTN HVVA    V V    D +K+   VI +    D+A++ V   K    L  L F  + +L   E V+ +G P    N SVT GVVS V  QR    S  L  +Q DA I  GNSGGP +    +VIG+   T+  +   G+ IP      F++
Sbjct:   23 ILTNGHVVAYQKSVRVRKHGDAKKYNAHVIHVGHECDIAMLGVEDEKFWEDLYPLSFGVVPELE--EDVVCVGFPTGGDNISVTRGVVSRVEIQRYAHSSVQLLAIQIDAAINSGNSGGPALQ-DDKVIGIAFETLDNAENIGYIIPVTIIQHFLE 175          
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Medaka
Match: htra1a (serine protease HTRA1A [Source:NCBI gene;Acc:105355810])

HSP 1 Score: 183.341 bits (464), Expect = 1.875e-50
Identity = 120/276 (43.48%), Postives = 160/276 (57.97%), Query Frame = 2
Query:  209 NSFNFIADVVETITPSVVSI------TXXXXXXXXXXXXXXIVEDSGYILTNAHVVARNPYVSVTLSDGQKFQGEVIAMDRSSDLALVKVNPGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQRDLGHSKGLR-----YVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGSSRSGGGLGDNTYDTNRSSVRLDSNNNKYMGIVMGSLTPQMAYESKMNHPEYLVHPTTGVVIHSVFQLSPA 1003
            + +NFIADVVE I PSVV I      T     + V+ GSGF+V + G I+TNAHVVA    V V L +G  +  ++  +D  +D+AL+K++    KL  L     S LR GEFV+A+GSP +L N+VT G+VS  QR  G   GLR     Y+QTDAII  GNSGGPLVNL GEVIG+NT+ V+ G  FAIPS+   QF+                +YD  +S  R D+   KY+G+ M +LTP +A E K  H ++    T+G  +  V   +PA
Sbjct:  163 HKYNFIADVVEKIAPSVVHIELFRKMTYSKREVAVASGSGFVVSEDGQIVTNAHVVANKHRVKVELKNGASYDAKIKDVDEKADIALIKID-APTKLPVLLLGHSSDLRPGEFVVAIGSPFSLQNTVTTGIVSTTQRG-GKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDKIRQFLA--------------ESYD-RQSRGRKDA-KKKYIGVRMMTLTPALAKELKTRHRDF-PDITSGAYVMEVIAKTPA 419          
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Medaka
Match: HTRA3 (HtrA serine peptidase 3 [Source:NCBI gene;Acc:101162823])

HSP 1 Score: 174.096 bits (440), Expect = 3.405e-47
Identity = 115/282 (40.78%), Postives = 168/282 (59.57%), Query Frame = 2
Query:  215 FNFIADVVETITPSVVSITX------XXXXXXXXXXXXXIVEDSGYILTNAHVVAR------NPYVSVTLSDGQKFQGEVIAMDRSSDLALVKVNPGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQRDLGHSKGLR-----YVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGSSRSGGGLGDNTYDTNRSSVRLDSNNNKYMGIVMGSLTPQMAYESKMNHPEYLVHPTTGVVIHSVFQLSPAHK 1009
            FNFIADVVE I P+VV I +       G  + +S GSGF++ ++G I+TNAHVV+         ++ V + +G  ++  +  +D+ SD+A +K+NP +IKL  L   + + LR GEFV+A+GSP  L N+VT G+VS+ QRD G   GLR     Y+QTDAII  GNSGGPLVNL GEVIG+NT+ V+ G  FAIPS+   +F+  ++                N+ S  L     +++GI M ++TP +  E K  + ++  + T+G+ +H V   SPA K
Sbjct:  151 FNFIADVVEKIAPAVVHIELFLRHPLLGRNIALSSGSGFVMTENGLIVTNAHVVSSSSPVSGQQHLKVQMHNGDVYEATIKDIDKKSDIATIKINP-QIKLPVLFLGQSADLRPGEFVVAIGSPFALQNTVTTGIVSSAQRD-GKELGLRDSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVAAGISFAIPSDRITRFLNDSL----------------NKHSKELRPIKKRFIGIRMLTITPALIEELKQQNSDF-PNVTSGIYVHEVVPHSPAQK 413          
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Medaka
Match: si:dkey-33c12.12 (serine protease HTRA2, mitochondrial-like [Source:NCBI gene;Acc:101174474])

HSP 1 Score: 172.555 bits (436), Expect = 8.301e-47
Identity = 115/275 (41.82%), Postives = 160/275 (58.18%), Query Frame = 2
Query:  215 FNFIADVVETITPSVVSITX------XXXXXXXXXXXXXIVEDSGYILTNAHVVARNPYVSVTLSDGQKFQGEVIAMDRSSDLALVKVNPGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQRD---LGHSK-GLRYVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGSSRSGGGLGDNTYDTNRSSVRLDSNNNKYMGIVMGSLTPQMAYESKMNHPEYLVHPTTGVVIHSVFQLSPAHK 1009
            +NFIADVVE  TP+VV I +       G  + VS GSGFI+   G I+TNAHVVA    V V L++G  +   V  +D  +D+A +K+   K  L +L+  + S +R GEFV+A+GSP  L N++T G+VS+ QRD   LG S   + Y+QTDA I  GNSGGPL+NL GEVIG+NTM V+ G  FAIPS+    F+              D      +SSV       +Y+G++M +LTP +  E ++  P +  + T G++IH V   SPA +
Sbjct:  124 YNFIADVVEKSTPAVVYIEILGRHPFSGREVPVSNGSGFIISSDGLIVTNAHVVANKRGVRVKLTNGDMYHASVQDVDPVADIATIKITT-KNPLPTLKLGQSSDIRQGEFVVAMGSPFALRNTITSGIVSSAQRDSKELGLSNPNMEYIQTDATIDFGNSGGPLINLDGEVIGINTMKVTAGISFAIPSDRLKIFL--------------DQAAKKTKSSVGESRTKARYIGVMMLTLTPSIITELQLRDPMF-PNVTHGILIHRVIIGSPASR 382          
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Medaka
Match: htra1b (HtrA serine peptidase 1 [Source:NCBI gene;Acc:101160199])

HSP 1 Score: 165.622 bits (418), Expect = 3.812e-44
Identity = 115/275 (41.82%), Postives = 151/275 (54.91%), Query Frame = 2
Query:  215 FNFIADVVETITPSVVSITX------XXXXXXXXXXXXXIVEDSGYILTNAHVVARNPYVSVTLSDGQKFQGEVIAMDRSSDLALVKVNPGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQRDLGHSKGLR-----YVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGSSRSGGGLGDNTYDTNRSSVRLDSNNNKYMGIVMGSLTPQMAYESKMNHPEYLVHPTTGVVIHSVFQLSPAH 1006
            +NFIADVVE I P+VV I +          + V+ GSGF+V + G I+TNAHVVA    V V L  G  +  ++  +D  +D+AL+K++    KL  L     + LR GEFV+A+GSP +L N+VT G+VS  QR  G   GLR     Y+QTDAII  GNSGGPLVNL GEVIG+NT+ V+ G  FAIPS+   QF  LA    R   GL  +   +  S+VRL                   A E K  HP++    T+G  +  V   +PA 
Sbjct:  165 YNFIADVVEKIAPAVVHIELFRKMVFSKREVSVASGSGFVVSEDGLIVTNAHVVANKHRVKVELKSGATYDAKIKDIDEKADIALIKIDTPN-KLPVLLLGRSADLRPGEFVVAIGSPFSLQNTVTTGIVSTTQRG-GKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDKILQF--LAESHDRQAKGLTRHHISSPFSAVRL-------------------AKELKARHPDF-PDLTSGAYVMEVIGRTPAE 415          
BLAST of Serine protease HTRA2, mitochondrial vs. Planmine SMEST
Match: SMESG000006679.1 (SMESG000006679.1)

HSP 1 Score: 519.235 bits (1336), Expect = 0.000e+0
Identity = 306/306 (100.00%), Postives = 306/306 (100.00%), Query Frame = 2
Query:   92 MTSGVSYYISKNRKXXXXXXXXXXXXXXXXXXXXRQDQINSFNFIADVVETITPSVVSITXXXXXXXXXXXXXXIVEDSGYILTNAHVVARNPYVSVTLSDGQKFQGEVIAMDRSSDLALVKVNPGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQRDLGHSKGLRYVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGSSRSGGGLGDNTYDTNRSSVRLDSNNNKYMGIVMGSLTPQMAYESKMNHPEYLVHPTTGVVIHSVFQLSPAHK 1009
            MTSGVSYYISKNRKLNNVSTSSLTSLITANAATSRQDQINSFNFIADVVETITPSVVSITVGGSLLGVSFGSGFIVEDSGYILTNAHVVARNPYVSVTLSDGQKFQGEVIAMDRSSDLALVKVNPGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQRDLGHSKGLRYVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGSSRSGGGLGDNTYDTNRSSVRLDSNNNKYMGIVMGSLTPQMAYESKMNHPEYLVHPTTGVVIHSVFQLSPAHK
Sbjct:    1 MTSGVSYYISKNRKLNNVSTSSLTSLITANAATSRQDQINSFNFIADVVETITPSVVSITVGGSLLGVSFGSGFIVEDSGYILTNAHVVARNPYVSVTLSDGQKFQGEVIAMDRSSDLALVKVNPGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQRDLGHSKGLRYVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGSSRSGGGLGDNTYDTNRSSVRLDSNNNKYMGIVMGSLTPQMAYESKMNHPEYLVHPTTGVVIHSVFQLSPAHK 306          
BLAST of Serine protease HTRA2, mitochondrial vs. Planmine SMEST
Match: SMESG000006679.1 (SMESG000006679.1)

HSP 1 Score: 514.612 bits (1324), Expect = 2.428e-179
Identity = 296/307 (96.42%), Postives = 296/307 (96.42%), Query Frame = 2
Query:   92 MTSGVSYYISKNRKXXXXXXXXXXXXXXXXXXXXRQDQINSFNFIADVVETITPSVVSITXXXXXXXXXXXXX-XIVEDSGYILTNAHVVARNPYVSVTLSDGQKFQGEVIAMDRSSDLALVKVNPGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQRDLGHSKGLRYVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGSSRSGGGLGDNTYDTNRSSVRLDSNNNKYMGIVMGSLTPQMAYESKMNHPEYLVHPTTGVVIHSVFQLSPAHK 1009
            MTSGVSYYISKNRKLNNVSTSSLTSLITANAATSRQDQINSFNFIADVVETITPSVVSITVG   L        FIVEDSGYILTNAHVVARNPYVSVTLSDGQKFQGEVIAMDRSSDLALVKVNPGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQRDLGHSKGLRYVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGSSRSGGGLGDNTYDTNRSSVRLDSNNNKYMGIVMGSLTPQMAYESKMNHPEYLVHPTTGVVIHSVFQLSPAHK
Sbjct:    1 MTSGVSYYISKNRKLNNVSTSSLTSLITANAATSRQDQINSFNFIADVVETITPSVVSITVGSGSLLGVSFGSGFIVEDSGYILTNAHVVARNPYVSVTLSDGQKFQGEVIAMDRSSDLALVKVNPGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQRDLGHSKGLRYVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGSSRSGGGLGDNTYDTNRSSVRLDSNNNKYMGIVMGSLTPQMAYESKMNHPEYLVHPTTGVVIHSVFQLSPAHK 307          
BLAST of Serine protease HTRA2, mitochondrial vs. Planmine SMEST
Match: SMESG000017614.1 (SMESG000017614.1)

HSP 1 Score: 147.132 bits (370), Expect = 2.453e-38
Identity = 92/244 (37.70%), Postives = 141/244 (57.79%), Query Frame = 2
Query:   80 VAFVMT-SGVSYYISKN---RKXXXXXXXXXXXXXXXXXXXXRQDQINSFNFIADVVETITPSVVSITXXXXXXXXXXXXXXIVEDSGYILTNAHVVARNPYVSVTLSDGQKFQGEVIAMDRSSDLALVKVNPGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQRDLGHSKGLRYVQTDAI--ITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGS 793
            + FVMT SGV+YY  K    +K++     +     ++ +   ++D I+S N ++  VE++T S+V + + G  +        IV ++GYILTN H +   P +SV L + + ++ E+IA D+  DLAL+K+NPG IKL  L FA+  KL  GE+VIA+ S     NSV  GV+S V+ D   S  ++Y+ +DAI  I     GGPL+N +GE+IG N++     FG A  S  C +FV+  I +
Sbjct:   21 ICFVMTASGVTYYAGKIINIQKVSMSKIKTNVLAKSSKSLKEKKDDIDSMNIVSKTVESVTSSLVHVCICGVCICSGV----IVNENGYILTNVHEIFNKPCLSVRLYNDENYKAEIIACDKMLDLALIKINPGNIKLSKLDFADERKLNVGEYVIAISSTKGFPNSVMFGVISDVELD-KKSHSIKYIYSDAINKIIRFFVGGPLLNFHGEIIGFNSIRTFQRFGLACSSIFCQKFVQEEINN 259          
BLAST of Serine protease HTRA2, mitochondrial vs. Planmine SMEST
Match: SMESG000017614.1 (SMESG000017614.1)

HSP 1 Score: 143.28 bits (360), Expect = 2.724e-37
Identity = 81/200 (40.50%), Postives = 119/200 (59.50%), Query Frame = 2
Query:  200 DQINSFNFIADVVETITPSVVSITXXXXXXXXXXXXXXIVEDSGYILTNAHVVARNPYVSVTLSDGQKFQGEVIAMDRSSDLALVKVNPGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQRDLGHSKGLRYVQTDAI--ITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGS 793
            D I+S N ++  VE++T S+V + + G  +        IV ++GYILTN H +   P +SV L + + ++ E+IA D+  DLAL+K+NPG IKL  L FA+  KL  GE+VIA+ S     NSV  GV+S V+ D   S  ++Y+ +DAI  I     GGPL+N +GE+IG N++     FG A  S  C +FV+  I +
Sbjct:   21 DDIDSMNIVSKTVESVTSSLVHVCICGVCICSGV----IVNENGYILTNVHEIFNKPCLSVRLYNDENYKAEIIACDKMLDLALIKINPGNIKLSKLDFADERKLNVGEYVIAISSTKGFPNSVMFGVISDVELD-KKSHSIKYIYSDAINKIIRFFVGGPLLNFHGEIIGFNSIRTFQRFGLACSSIFCQKFVQEEINN 215          
BLAST of Serine protease HTRA2, mitochondrial vs. Planmine SMEST
Match: SMESG000017614.1 (SMESG000017614.1)

HSP 1 Score: 143.28 bits (360), Expect = 4.112e-37
Identity = 81/200 (40.50%), Postives = 119/200 (59.50%), Query Frame = 2
Query:  200 DQINSFNFIADVVETITPSVVSITXXXXXXXXXXXXXXIVEDSGYILTNAHVVARNPYVSVTLSDGQKFQGEVIAMDRSSDLALVKVNPGKIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQRDLGHSKGLRYVQTDAI--ITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQFVKLAIGS 793
            D I+S N ++  VE++T S+V + + G  +        IV ++GYILTN H +   P +SV L + + ++ E+IA D+  DLAL+K+NPG IKL  L FA+  KL  GE+VIA+ S     NSV  GV+S V+ D   S  ++Y+ +DAI  I     GGPL+N +GE+IG N++     FG A  S  C +FV+  I +
Sbjct:   41 DDIDSMNIVSKTVESVTSSLVHVCICGVCICSGV----IVNENGYILTNVHEIFNKPCLSVRLYNDENYKAEIIACDKMLDLALIKINPGNIKLSKLDFADERKLNVGEYVIAISSTKGFPNSVMFGVISDVELD-KKSHSIKYIYSDAINKIIRFFVGGPLLNFHGEIIGFNSIRTFQRFGLACSSIFCQKFVQEEINN 235          
The following BLAST results are available for this feature:
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HTRA15.917e-4642.80HtrA serine peptidase 1 [Source:HGNC Symbol;Acc:HG... [more]
HTRA31.209e-4539.01HtrA serine peptidase 3 [Source:HGNC Symbol;Acc:HG... [more]
HTRA17.618e-4542.80HtrA serine peptidase 1 [Source:HGNC Symbol;Acc:HG... [more]
HTRA31.213e-4247.55HtrA serine peptidase 3 [Source:HGNC Symbol;Acc:HG... [more]
HTRA21.421e-4140.07HtrA serine peptidase 2 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
HtrA23.979e-4943.26gene:FBgn0038233 transcript:FBtr0082987[more]
HtrA23.979e-4943.26gene:FBgn0038233 transcript:FBtr0330045[more]
back to top
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
htra3a3.254e-5243.06HtrA serine peptidase 3a [Source:ZFIN;Acc:ZDB-GENE... [more]
htra3a3.254e-5243.06HtrA serine peptidase 3a [Source:ZFIN;Acc:ZDB-GENE... [more]
htra3a3.254e-5243.06HtrA serine peptidase 3a [Source:ZFIN;Acc:ZDB-GENE... [more]
si:dkey-33c12.121.127e-4842.18si:dkey-33c12.12 [Source:ZFIN;Acc:ZDB-GENE-081028-... [more]
si:dkey-33c12.121.127e-4842.18si:dkey-33c12.12 [Source:ZFIN;Acc:ZDB-GENE-081028-... [more]
back to top
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psma15.040e-5042.20proteasome subunit alpha 1 [Source:Xenbase;Acc:XB-... [more]
zic43.630e-4742.62Zic family member 4 [Source:Xenbase;Acc:XB-GENE-10... [more]
mettl31.903e-4238.19methyltransferase like 3 [Source:Xenbase;Acc:XB-GE... [more]
htra14.915e-2841.53HtrA serine peptidase 1 [Source:NCBI gene;Acc:7801... [more]
htra19.518e-2841.53HtrA serine peptidase 1 [Source:NCBI gene;Acc:7801... [more]
back to top
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Htra13.527e-4541.79HtrA serine peptidase 1 [Source:MGI Symbol;Acc:MGI... [more]
Htra45.041e-4438.63HtrA serine peptidase 4 [Source:MGI Symbol;Acc:MGI... [more]
Htra39.836e-4438.65HtrA serine peptidase 3 [Source:MGI Symbol;Acc:MGI... [more]
Htra21.711e-4239.07HtrA serine peptidase 2 [Source:MGI Symbol;Acc:MGI... [more]
Htra31.469e-4147.55HtrA serine peptidase 3 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Serine protease HTRA2, mitochondrial vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B4PST0|HTRA2_DROYA9.209e-4943.26Serine protease HTRA2, mitochondrial OS=Drosophila... [more]
sp|B4JTT7|HTRA2_DROGR1.445e-4843.26Serine protease HTRA2, mitochondrial OS=Drosophila... [more]
sp|Q9VFJ3|HTRA2_DROME3.989e-4843.26Serine protease HTRA2, mitochondrial OS=Drosophila... [more]
sp|B4HEM8|HTRA2_DROSE4.279e-4843.26Serine protease HTRA2, mitochondrial OS=Drosophila... [more]
sp|B4QZU6|HTRA2_DROSI4.636e-4843.26Serine protease HTRA2, mitochondrial OS=Drosophila... [more]
back to top
BLAST of Serine protease HTRA2, mitochondrial vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183AD695.092e-6546.71PDZ domain-containing protein OS=Echinostoma capro... [more]
A0A3P8K1L05.253e-6546.71PDZ domain-containing protein OS=Echinostoma capro... [more]
A0A1S8X5U02.031e-6447.10Trypsin (Fragment) OS=Opisthorchis viverrini OX=61... [more]
A0A074ZJF53.914e-6447.10PDZ domain-containing protein OS=Opisthorchis vive... [more]
A0A4S2L6Y36.624e-6445.55PDZ domain-containing protein OS=Opisthorchis feli... [more]
back to top
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-33c12.122.733e-5143.27serine protease HTRA2, mitochondrial [Source:NCBI ... [more]
htra1a6.004e-4842.55serine protease HTRA1A [Source:NCBI gene;Acc:10304... [more]
htra1b6.525e-4739.35serine protease HTRA1B-like [Source:NCBI gene;Acc:... [more]
HTRA31.527e-4540.57HtrA serine peptidase 3 [Source:HGNC Symbol;Acc:HG... [more]
htra3a7.872e-4340.93HtrA serine peptidase 3a [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
HTRA11.549e-3543.28HtrA serine peptidase 1 [Source:HGNC Symbol;Acc:HG... [more]
HTRA19.607e-3543.92HtrA serine peptidase 1 [Source:HGNC Symbol;Acc:HG... [more]
HTRA13.824e-3443.26HtrA serine peptidase 1 [Source:HGNC Symbol;Acc:HG... [more]
ENSPMAT00000002935.12.651e-2439.43pep scaffold:Pmarinus_7.0:GL478486:180388:188108:-... [more]
back to top
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO417651.039e-936.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Serine protease HTRA2, mitochondrial vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
htra1a1.875e-5043.48serine protease HTRA1A [Source:NCBI gene;Acc:10535... [more]
HTRA33.405e-4740.78HtrA serine peptidase 3 [Source:NCBI gene;Acc:1011... [more]
si:dkey-33c12.128.301e-4741.82serine protease HTRA2, mitochondrial-like [Source:... [more]
htra1b3.812e-4441.82HtrA serine peptidase 1 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Serine protease HTRA2, mitochondrial vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000006679.10.000e+0100.00SMESG000006679.1[more]
SMESG000006679.12.428e-17996.42SMESG000006679.1[more]
SMESG000017614.12.453e-3837.70SMESG000017614.1[more]
SMESG000017614.12.724e-3740.50SMESG000017614.1[more]
SMESG000017614.14.112e-3740.50SMESG000017614.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029373 ID=SMED30029373|Name=Serine protease HTRA2, mitochondrial|organism=Schmidtea mediterranea sexual|type=transcript|length=2035bp
ACGTTTTATATAAAATTGAATGGCTCATAAAGTTTTACATTTTAATTTTC
AATCATGTAAAAGGATCTCAAAAGTACTTGTAGCATTTGTTATGACTAGT
GGAGTGTCCTATTATATTAGTAAAAATAGAAAGTTAAATAATGTTTCAAC
TTCTTCTCTGACATCGCTAATAACGGCAAATGCTGCAACTTCTCGCCAAG
ATCAAATCAATTCTTTTAACTTTATTGCAGATGTGGTAGAAACAATTACA
CCTAGCGTCGTATCAATAACAGTTGGTGGGAGTCTCTTAGGCGTTAGTTT
TGGGTCAGGATTTATTGTAGAAGACTCCGGTTATATTTTGACAAATGCTC
ACGTGGTTGCAAGAAATCCATACGTCTCTGTTACGCTGTCTGATGGTCAA
AAATTTCAAGGTGAAGTCATTGCTATGGACAGAAGTTCGGATTTGGCGTT
AGTAAAGGTTAATCCGGGAAAAATAAAATTACAGTCATTGCGATTTGCAG
AAATATCAAAATTAAGAGCTGGCGAATTCGTTATAGCTCTAGGTAGTCCT
ATGACTCTTTCAAATTCAGTAACAGTTGGTGTTGTGTCTGCTGTTCAACG
TGACCTAGGGCACTCAAAAGGTTTGAGATATGTTCAAACCGACGCTATCA
TCACGGTAGGTAACTCTGGAGGTCCACTTGTTAATTTGTATGGAGAAGTG
ATCGGTGTTAATACAATGATGGTGTCAACTGGGTTCGGATTTGCCATTCC
CAGCAATCACTGTAACCAGTTCGTGAAACTGGCCATAGGTAGCAGTCGAT
CTGGTGGCGGATTGGGAGACAATACATATGACACTAATCGATCTTCTGTC
AGACTAGACTCCAATAATAATAAATACATGGGCATTGTGATGGGCTCATT
GACTCCGCAGATGGCATACGAGAGCAAAATGAATCATCCAGAATATCTAG
TTCATCCGACTACTGGAGTAGTAATTCATTCAGTTTTCCAGCTCTCTCCA
GCACATAAGTAATTAATCGATAAAAGATTATAACTATATATATGTATATA
TTCGCTTATCGAGCCAAGCAAAGATTGGATATTTTTCATATTTGTGACTG
ACCGCAAATTAAAATTTTCATCAAAAGAAACATTTTTCTAGGTGGAAATT
CTTTGAGGTTTTTGAAAATTTTTCTTTTTAAAATATCTAAAATTTTTGCT
AAAAACTATATATTTTATATTGTTTTAAGGAAATGATTGAGGATTTGTAA
CGCGAATAATATGAATTTTAACTGTTTATGGTTGCTGACAGATTTGTCAT
TGACTCTTTTTTTAGTGCCTCGGTGACTTTTTTTACTTTCTACAATCCGA
GTACCAGTGGTAACTAGAATTACTCTTCGTTACATTTTCGATATCCTGCC
GATTGAAAGCCTTTGGCCTCGTGATCATTTTATTTATTTTGTATCTTTAA
CGGCTTTATTTACCTGGATGCTTTTTATTGGATTTTATTGAATTCGTCTT
CAAAATTTTGATAATGAATCCCTCCTTATTTCTCACCTTTAGTTGTTTTA
GACCAATTCTTAGACTATGCAACCACTTACCTCGATAAGCTTTTATTCTT
GTTGAACCTTTTGACTCGCATTTCGCTCAATTTGTTGAACTTATTTTCTA
GCAATTATTGGCCCGAACGCTACTCAAATTCATTACTGTTCTTTCAGCAA
TTCTGTGTCCCAAACCTTGTTTAGCCTTGGTTTAGAATTGTCAATTATTT
TTTGGGTTGCTGATGACTTAATCATTTTTAGAATGAATATTCGGCCTTTA
TTTATTCGTTTTGGTGTGTTTTCGTGATTGAATGCATCAATTTCTCTGTG
CCCAACACCAAGAATTTTCCAATTTTTTAAAGTTACTATTTTTAGTAACG
TCATTTAATTAAATTTATTGTATAAAACAAACGTAGTTTTAATCTAATTT
TCTATTAATTCAAGAATTTTCCTATTGATTATAATAGTATTGAATATAAG
TATAAAATGGTGATTTCCTGGTAGCAGTATAAATT
back to top

protein sequence of SMED30029373-orf-1

>SMED30029373-orf-1 ID=SMED30029373-orf-1|Name=SMED30029373-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=331bp
MAHKVLHFNFQSCKRISKVLVAFVMTSGVSYYISKNRKLNNVSTSSLTSL
ITANAATSRQDQINSFNFIADVVETITPSVVSITVGGSLLGVSFGSGFIV
EDSGYILTNAHVVARNPYVSVTLSDGQKFQGEVIAMDRSSDLALVKVNPG
KIKLQSLRFAEISKLRAGEFVIALGSPMTLSNSVTVGVVSAVQRDLGHSK
GLRYVQTDAIITVGNSGGPLVNLYGEVIGVNTMMVSTGFGFAIPSNHCNQ
FVKLAIGSSRSGGGLGDNTYDTNRSSVRLDSNNNKYMGIVMGSLTPQMAY
ESKMNHPEYLVHPTTGVVIHSVFQLSPAHK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR001940Peptidase_S1C
IPR001478PDZ
IPR009003Peptidase_S1_PA
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
Vocabulary: molecular function
TermDefinition
GO:0004252serine-type endopeptidase activity
GO:0005515protein binding
GO:0008233peptidase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001940Peptidase S1CPRINTSPR00834PROTEASES2Ccoord: 143..167
score: 46.24
coord: 80..92
score: 54.97
coord: 199..216
score: 42.14
coord: 101..121
score: 32.75
coord: 177..194
score: 52.57
NoneNo IPR availableGENE3DG3DSA:2.40.10.120coord: 33..233
e-value: 1.4E-64
score: 219.5
NoneNo IPR availablePFAMPF13365Trypsin_2coord: 71..206
e-value: 3.0E-28
score: 99.6
NoneNo IPR availablePANTHERPTHR22939SERINE PROTEASE FAMILY S1C HTRA-RELATEDcoord: 14..306
IPR009003Peptidase S1, PA clanSUPERFAMILYSSF50494Trypsin-like serine proteasescoord: 42..229