Glucose-6-phosphate isomerase

Overview
NameGlucose-6-phosphate isomerase
Smed IDSMED30029370
Length (bp)1471
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glucose-6-phosphate isomerase (SMED30029370) t-SNE clustered cells

Violin plots show distribution of expression levels for Glucose-6-phosphate isomerase (SMED30029370) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glucose-6-phosphate isomerase (SMED30029370) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glucose-6-phosphate isomerase (SMED30029370) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029370

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30029370SMESG000067583.1 dd_Smed_v4_1398_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30029370SMESG000067583.1 dd_Smed_v4_1398_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029370SMESG000067583.1 dd_Smed_v4_1398_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30029370SMESG000067583.1 dd_Smed_v4_1398_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029370SMESG000067583.1 dd_Smed_v4_1398_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30029370SMESG000067583.1 dd_Smed_v4_1398_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30029370SMESG000067583.1 OX_Smed_1.0.03830ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Human
Match: GPI (glucose-6-phosphate isomerase [Source:HGNC Symbol;Acc:HGNC:4458])

HSP 1 Score: 462.225 bits (1188), Expect = 4.324e-158
Identity = 210/286 (73.43%), Postives = 243/286 (84.97%), Query Frame = 1
Query:  484 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIKSQKK 1341
            WVGGRYSLWSAIGLSIAL++G DNFE+LLSG H MD HF+ TPLE+N PV++A+LGI YI+C+  ETHA+LPYDQY+HRFAAYFQQGDMESNGK+I   G RV + TGPI+WGEPGTNGQHAFYQLIHQGT++IP DFLIP QT +PI  GLHH+ILL+NFLAQTEALMRGK  E+ R+EL+A G S  DLE L  HK F GNRPTNS VFTK+ PFMLG L+AMYEHKIFVQG IW+INS+DQWGVELGK LAKKI+PEL G   + SHD+STNGLI+FIK Q++
Sbjct:  280 WVGGRYSLWSAIGLSIALHVGFDNFEQLLSGAHWMDQHFRTTPLEKNAPVLLALLGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESNGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEALMRGKSTEEARKELQAAGKSPEDLERLLPHKVFEGNRPTNSIVFTKLTPFMLGALVAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSAQVTSHDASTNGLINFIKQQRE 565          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Human
Match: GPI (glucose-6-phosphate isomerase [Source:HGNC Symbol;Acc:HGNC:4458])

HSP 1 Score: 460.685 bits (1184), Expect = 1.141e-157
Identity = 210/286 (73.43%), Postives = 243/286 (84.97%), Query Frame = 1
Query:  484 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIKSQKK 1341
            WVGGRYSLWSAIGLSIAL++G DNFE+LLSG H MD HF+ TPLE+N PV++A+LGI YI+C+  ETHA+LPYDQY+HRFAAYFQQGDMESNGK+I   G RV + TGPI+WGEPGTNGQHAFYQLIHQGT++IP DFLIP QT +PI  GLHH+ILL+NFLAQTEALMRGK  E+ R+EL+A G S  DLE L  HK F GNRPTNS VFTK+ PFMLG L+AMYEHKIFVQG IW+INS+DQWGVELGK LAKKI+PEL G   + SHD+STNGLI+FIK Q++
Sbjct:  269 WVGGRYSLWSAIGLSIALHVGFDNFEQLLSGAHWMDQHFRTTPLEKNAPVLLALLGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESNGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEALMRGKSTEEARKELQAAGKSPEDLERLLPHKVFEGNRPTNSIVFTKLTPFMLGALVAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSAQVTSHDASTNGLINFIKQQRE 554          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Human
Match: GPI (glucose-6-phosphate isomerase [Source:HGNC Symbol;Acc:HGNC:4458])

HSP 1 Score: 461.455 bits (1186), Expect = 1.905e-157
Identity = 210/286 (73.43%), Postives = 243/286 (84.97%), Query Frame = 1
Query:  484 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIKSQKK 1341
            WVGGRYSLWSAIGLSIAL++G DNFE+LLSG H MD HF+ TPLE+N PV++A+LGI YI+C+  ETHA+LPYDQY+HRFAAYFQQGDMESNGK+I   G RV + TGPI+WGEPGTNGQHAFYQLIHQGT++IP DFLIP QT +PI  GLHH+ILL+NFLAQTEALMRGK  E+ R+EL+A G S  DLE L  HK F GNRPTNS VFTK+ PFMLG L+AMYEHKIFVQG IW+INS+DQWGVELGK LAKKI+PEL G   + SHD+STNGLI+FIK Q++
Sbjct:  308 WVGGRYSLWSAIGLSIALHVGFDNFEQLLSGAHWMDQHFRTTPLEKNAPVLLALLGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESNGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEALMRGKSTEEARKELQAAGKSPEDLERLLPHKVFEGNRPTNSIVFTKLTPFMLGALVAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSAQVTSHDASTNGLINFIKQQRE 593          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Human
Match: GPI (glucose-6-phosphate isomerase [Source:HGNC Symbol;Acc:HGNC:4458])

HSP 1 Score: 268.855 bits (686), Expect = 2.379e-84
Identity = 123/191 (64.40%), Postives = 148/191 (77.49%), Query Frame = 1
Query:  484 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLS------NFLAQTEALMRGKGAEKVREELEAEG 1038
            WVGGRYSLWSAIGLSIAL++G DNFE+LLSG H MD HF+ TPLE+N PV++A+LGI YI+C+  ETHA+LPYDQY+HRFAAYFQQGDMESNGK+I   G RV + TGPI+WGEPGTNGQHAFYQLIHQGT++IP DFLIP QT +PI  GLHH+I +       N   Q    +  + A+K+  EL+   
Sbjct:  232 WVGGRYSLWSAIGLSIALHVGFDNFEQLLSGAHWMDQHFRTTPLEKNAPVLLALLGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESNGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGLHHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSA 422          

HSP 2 Score: 95.9005 bits (237), Expect = 1.191e-20
Identity = 43/59 (72.88%), Postives = 51/59 (86.44%), Query Frame = 1
Query: 1165 HKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIKSQKK 1341
            HKIFVQG IW+INS+DQWGVELGK LAKKI+PEL G   + SHD+STNGLI+FIK Q++
Sbjct:  385 HKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSAQVTSHDASTNGLINFIKQQRE 443          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Human
Match: AC092073.1 (novel protein, readthrough between GPI and PDCD2)

HSP 1 Score: 111.694 bits (278), Expect = 8.740e-28
Identity = 49/79 (62.03%), Postives = 56/79 (70.89%), Query Frame = 1
Query:  757 NGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMR 993
            NGK+I   G RV + TGPI+WGEPGTNGQHAFYQLIHQGT++IP DFLIP QT +PI  GLHH+  L    A      R
Sbjct:    2 NGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGLHHKDALPTVAAPRPVCQR 80          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Celegans
Match: gpi-1 (Glucose-6-phosphate isomerase [Source:UniProtKB/TrEMBL;Acc:Q9U1Q2])

HSP 1 Score: 423.705 bits (1088), Expect = 1.068e-143
Identity = 196/283 (69.26%), Postives = 229/283 (80.92%), Query Frame = 1
Query:  484 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIKS 1332
            WVGGRYSLWSAIGLSIA++IG DN+E+LL G  ++D HF  TPLE+NIPVI+AM+G++Y + Y AETHA+LPYDQYMHRFAAYFQQGDMESNGKF+   G+RV Y TGPI+WGEPGTNGQHAFYQLIHQGTRLIPADF+ P +T NPI  GLHH+ILL+NFLAQTEALM+GK A     EL++ GMS   +  +  HK F GN+PT S V   + PF LG LIA YEHKIFVQG IW+I SYDQWGVELGK LAK IQPEL+  + + SHD+STNGLI FIK+
Sbjct:  267 WVGGRYSLWSAIGLSIAVHIGFDNYEKLLDGAFSVDEHFVNTPLEKNIPVILAMIGVLYNNIYGAETHALLPYDQYMHRFAAYFQQGDMESNGKFVTRHGQRVDYSTGPIVWGEPGTNGQHAFYQLIHQGTRLIPADFIAPVKTLNPIRGGLHHQILLANFLAQTEALMKGKTAAVAEAELKSSGMSPESIAKILPHKVFEGNKPTTSIVLPVVTPFTLGALIAFYEHKIFVQGIIWDICSYDQWGVELGKQLAKVIQPELASADTVTSHDASTNGLIAFIKN 549          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Celegans
Match: gpi-1 (Glucose-6-phosphate isomerase [Source:UniProtKB/TrEMBL;Acc:Q9U1Q2])

HSP 1 Score: 423.705 bits (1088), Expect = 1.068e-143
Identity = 196/283 (69.26%), Postives = 229/283 (80.92%), Query Frame = 1
Query:  484 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIKS 1332
            WVGGRYSLWSAIGLSIA++IG DN+E+LL G  ++D HF  TPLE+NIPVI+AM+G++Y + Y AETHA+LPYDQYMHRFAAYFQQGDMESNGKF+   G+RV Y TGPI+WGEPGTNGQHAFYQLIHQGTRLIPADF+ P +T NPI  GLHH+ILL+NFLAQTEALM+GK A     EL++ GMS   +  +  HK F GN+PT S V   + PF LG LIA YEHKIFVQG IW+I SYDQWGVELGK LAK IQPEL+  + + SHD+STNGLI FIK+
Sbjct:  267 WVGGRYSLWSAIGLSIAVHIGFDNYEKLLDGAFSVDEHFVNTPLEKNIPVILAMIGVLYNNIYGAETHALLPYDQYMHRFAAYFQQGDMESNGKFVTRHGQRVDYSTGPIVWGEPGTNGQHAFYQLIHQGTRLIPADFIAPVKTLNPIRGGLHHQILLANFLAQTEALMKGKTAAVAEAELKSSGMSPESIAKILPHKVFEGNKPTTSIVLPVVTPFTLGALIAFYEHKIFVQGIIWDICSYDQWGVELGKQLAKVIQPELASADTVTSHDASTNGLIAFIKN 549          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Celegans
Match: gpi-1 (Glucose-6-phosphate isomerase [Source:UniProtKB/TrEMBL;Acc:Q9U1Q2])

HSP 1 Score: 423.705 bits (1088), Expect = 1.068e-143
Identity = 196/283 (69.26%), Postives = 229/283 (80.92%), Query Frame = 1
Query:  484 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIKS 1332
            WVGGRYSLWSAIGLSIA++IG DN+E+LL G  ++D HF  TPLE+NIPVI+AM+G++Y + Y AETHA+LPYDQYMHRFAAYFQQGDMESNGKF+   G+RV Y TGPI+WGEPGTNGQHAFYQLIHQGTRLIPADF+ P +T NPI  GLHH+ILL+NFLAQTEALM+GK A     EL++ GMS   +  +  HK F GN+PT S V   + PF LG LIA YEHKIFVQG IW+I SYDQWGVELGK LAK IQPEL+  + + SHD+STNGLI FIK+
Sbjct:  267 WVGGRYSLWSAIGLSIAVHIGFDNYEKLLDGAFSVDEHFVNTPLEKNIPVILAMIGVLYNNIYGAETHALLPYDQYMHRFAAYFQQGDMESNGKFVTRHGQRVDYSTGPIVWGEPGTNGQHAFYQLIHQGTRLIPADFIAPVKTLNPIRGGLHHQILLANFLAQTEALMKGKTAAVAEAELKSSGMSPESIAKILPHKVFEGNKPTTSIVLPVVTPFTLGALIAFYEHKIFVQGIIWDICSYDQWGVELGKQLAKVIQPELASADTVTSHDASTNGLIAFIKN 549          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Celegans
Match: gpi-1 (Glucose-6-phosphate isomerase [Source:UniProtKB/TrEMBL;Acc:Q9U1Q2])

HSP 1 Score: 423.705 bits (1088), Expect = 3.194e-143
Identity = 196/283 (69.26%), Postives = 229/283 (80.92%), Query Frame = 1
Query:  484 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIKS 1332
            WVGGRYSLWSAIGLSIA++IG DN+E+LL G  ++D HF  TPLE+NIPVI+AM+G++Y + Y AETHA+LPYDQYMHRFAAYFQQGDMESNGKF+   G+RV Y TGPI+WGEPGTNGQHAFYQLIHQGTRLIPADF+ P +T NPI  GLHH+ILL+NFLAQTEALM+GK A     EL++ GMS   +  +  HK F GN+PT S V   + PF LG LIA YEHKIFVQG IW+I SYDQWGVELGK LAK IQPEL+  + + SHD+STNGLI FIK+
Sbjct:  302 WVGGRYSLWSAIGLSIAVHIGFDNYEKLLDGAFSVDEHFVNTPLEKNIPVILAMIGVLYNNIYGAETHALLPYDQYMHRFAAYFQQGDMESNGKFVTRHGQRVDYSTGPIVWGEPGTNGQHAFYQLIHQGTRLIPADFIAPVKTLNPIRGGLHHQILLANFLAQTEALMKGKTAAVAEAELKSSGMSPESIAKILPHKVFEGNKPTTSIVLPVVTPFTLGALIAFYEHKIFVQGIIWDICSYDQWGVELGKQLAKVIQPELASADTVTSHDASTNGLIAFIKN 584          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Fly
Match: Pgi (gene:FBgn0003074 transcript:FBtr0088680)

HSP 1 Score: 434.876 bits (1117), Expect = 7.675e-148
Identity = 203/286 (70.98%), Postives = 233/286 (81.47%), Query Frame = 1
Query:  484 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIKSQKK 1341
            WVGGRYSLWSAIGLSI L IG +NFE+LL G H MDNHFK TP E+N PVI+A+LG+ Y + +KAETHA+LPYDQY+HRFAAYFQQGDMESNGKF++  GK V Y TGPI+WGEPGTNGQHAFYQLIHQGTRLIP DF+ PAQTHNPI  G HH+ILLSNFLAQTEALM GK  ++ R EL   G+ G +L+ L  HK F GNRPTNS V  K++PF LG LIA+YEHKIFVQG IW+INS+DQWGVELGK LAK I+PEL     + +HDSSTNGLI+FIK+  K
Sbjct:  273 WVGGRYSLWSAIGLSICLSIGFENFEQLLDGAHFMDNHFKTTPFEKNAPVILALLGVWYSNFFKAETHALLPYDQYLHRFAAYFQQGDMESNGKFVSKSGKPVKYSTGPIVWGEPGTNGQHAFYQLIHQGTRLIPCDFIAPAQTHNPIAGGKHHKILLSNFLAQTEALMAGKTVDEARTELSKAGLCGNELDNLLPHKVFVGNRPTNSIVVKKVSPFTLGALIALYEHKIFVQGIIWDINSFDQWGVELGKQLAKAIEPELDHCNEVSTHDSSTNGLINFIKANWK 558          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Fly
Match: Pgi (gene:FBgn0003074 transcript:FBtr0088681)

HSP 1 Score: 434.876 bits (1117), Expect = 7.675e-148
Identity = 203/286 (70.98%), Postives = 233/286 (81.47%), Query Frame = 1
Query:  484 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIKSQKK 1341
            WVGGRYSLWSAIGLSI L IG +NFE+LL G H MDNHFK TP E+N PVI+A+LG+ Y + +KAETHA+LPYDQY+HRFAAYFQQGDMESNGKF++  GK V Y TGPI+WGEPGTNGQHAFYQLIHQGTRLIP DF+ PAQTHNPI  G HH+ILLSNFLAQTEALM GK  ++ R EL   G+ G +L+ L  HK F GNRPTNS V  K++PF LG LIA+YEHKIFVQG IW+INS+DQWGVELGK LAK I+PEL     + +HDSSTNGLI+FIK+  K
Sbjct:  273 WVGGRYSLWSAIGLSICLSIGFENFEQLLDGAHFMDNHFKTTPFEKNAPVILALLGVWYSNFFKAETHALLPYDQYLHRFAAYFQQGDMESNGKFVSKSGKPVKYSTGPIVWGEPGTNGQHAFYQLIHQGTRLIPCDFIAPAQTHNPIAGGKHHKILLSNFLAQTEALMAGKTVDEARTELSKAGLCGNELDNLLPHKVFVGNRPTNSIVVKKVSPFTLGALIALYEHKIFVQGIIWDINSFDQWGVELGKQLAKAIEPELDHCNEVSTHDSSTNGLINFIKANWK 558          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Fly
Match: Pgi (gene:FBgn0003074 transcript:FBtr0088679)

HSP 1 Score: 434.876 bits (1117), Expect = 7.675e-148
Identity = 203/286 (70.98%), Postives = 233/286 (81.47%), Query Frame = 1
Query:  484 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIKSQKK 1341
            WVGGRYSLWSAIGLSI L IG +NFE+LL G H MDNHFK TP E+N PVI+A+LG+ Y + +KAETHA+LPYDQY+HRFAAYFQQGDMESNGKF++  GK V Y TGPI+WGEPGTNGQHAFYQLIHQGTRLIP DF+ PAQTHNPI  G HH+ILLSNFLAQTEALM GK  ++ R EL   G+ G +L+ L  HK F GNRPTNS V  K++PF LG LIA+YEHKIFVQG IW+INS+DQWGVELGK LAK I+PEL     + +HDSSTNGLI+FIK+  K
Sbjct:  273 WVGGRYSLWSAIGLSICLSIGFENFEQLLDGAHFMDNHFKTTPFEKNAPVILALLGVWYSNFFKAETHALLPYDQYLHRFAAYFQQGDMESNGKFVSKSGKPVKYSTGPIVWGEPGTNGQHAFYQLIHQGTRLIPCDFIAPAQTHNPIAGGKHHKILLSNFLAQTEALMAGKTVDEARTELSKAGLCGNELDNLLPHKVFVGNRPTNSIVVKKVSPFTLGALIALYEHKIFVQGIIWDINSFDQWGVELGKQLAKAIEPELDHCNEVSTHDSSTNGLINFIKANWK 558          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Zebrafish
Match: gpia (glucose-6-phosphate isomerase a [Source:ZFIN;Acc:ZDB-GENE-020513-2])

HSP 1 Score: 454.136 bits (1167), Expect = 2.482e-155
Identity = 207/285 (72.63%), Postives = 242/285 (84.91%), Query Frame = 1
Query:  484 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIKSQK 1338
            WVGGRYSLWSAIGLSIAL+IG DNFE+LLSG H MDNHF+  PLEQN PVI+A+LG+ Y++ ++AETHA+LPYDQYMHRFAAYFQQGDMESNGK+I   G RV YHTGPI+WGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQ+ +PI + LHH+IL++NFLAQTEALMRGK +++ ++EL+A G+SG  LE L  HK F GN+P+NS +F K+ PFMLG L+AMYEHKIFVQG +W INSYDQWGVELGK LAKKI+PEL     + SHDSSTNGLI F K  +
Sbjct:  268 WVGGRYSLWSAIGLSIALHIGFDNFEQLLSGAHWMDNHFRSAPLEQNAPVILALLGVWYVNFFQAETHALLPYDQYMHRFAAYFQQGDMESNGKYITKSGTRVNYHTGPIVWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQSQHPIRDNLHHKILMANFLAQTEALMRGKTSDEAKKELQASGLSGDSLEKLLPHKVFQGNKPSNSIIFKKLTPFMLGALVAMYEHKIFVQGVMWNINSYDQWGVELGKQLAKKIEPELQDDAEVHSHDSSTNGLIGFFKKNR 552          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Zebrafish
Match: gpib (glucose-6-phosphate isomerase b [Source:ZFIN;Acc:ZDB-GENE-020513-3])

HSP 1 Score: 448.358 bits (1152), Expect = 4.920e-153
Identity = 204/283 (72.08%), Postives = 244/283 (86.22%), Query Frame = 1
Query:  484 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIKS 1332
            WVGGRYSLWSAIGLSIAL+IG +NFE+LL+G H MD HF+  P++QN P+++A+LGI YI+ ++AETH +LPYDQYMHRFAAYFQQGDMESNGK+I   G RV YHTGPI+WGEPGTNGQHAFYQLIHQGTR++PADFLIPAQT +PI N LHH+ILL+NFLAQTEALM+GK  E+ ++ELEA G+SG +LE +  HK F GN+PTNS VF K++PF LGVLIAMYEHKIF+QG +WEINS+DQWGVELGK LAKKI+PEL     + SHDSSTNGLI+F+K+
Sbjct:  268 WVGGRYSLWSAIGLSIALHIGYENFEKLLAGAHWMDTHFRTAPVDQNAPMLLALLGIWYINFFQAETHCLLPYDQYMHRFAAYFQQGDMESNGKYITTKGTRVNYHTGPIVWGEPGTNGQHAFYQLIHQGTRMVPADFLIPAQTQHPIRNSLHHKILLANFLAQTEALMKGKTTEEAKKELEAGGLSGDNLEKILPHKVFQGNKPTNSIVFKKLSPFTLGVLIAMYEHKIFIQGVMWEINSFDQWGVELGKQLAKKIEPELQDSAQVSSHDSSTNGLINFLKN 550          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Xenopus
Match: gpi (glucose-6-phosphate isomerase [Source:NCBI gene;Acc:496419])

HSP 1 Score: 459.529 bits (1181), Expect = 2.030e-157
Identity = 211/286 (73.78%), Postives = 243/286 (84.97%), Query Frame = 1
Query:  484 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIKSQKK 1341
            WVGGRYSLWSAIGLSIAL+IG DNFE+LL+G H MDNHF +TPLE N+PV++AMLG+ YI+ Y  ETHA+LPYDQYMHRFAAYFQQGDMESNGK+I   G RV Y+TGP++WGEPGTNGQHAFYQLIHQGTR IP DFLIP QT +PI N LHH+ILLSNFLAQTEALM+GK  E+ ++EL+A G++G  LE L  HK F GNRPTNS VFTK+NPF++G LIAMYEHKIFVQG +W+INSYDQWGVELGK LAKKI+PEL     I SHDSSTNGLI+FIK  ++
Sbjct:  253 WVGGRYSLWSAIGLSIALHIGYDNFEKLLAGAHWMDNHFYKTPLENNVPVLLAMLGVWYINFYGCETHALLPYDQYMHRFAAYFQQGDMESNGKYITRTGARVNYNTGPVVWGEPGTNGQHAFYQLIHQGTRRIPCDFLIPVQTQHPIRNNLHHKILLSNFLAQTEALMKGKSTEEAKKELQASGLTGDALEKLLPHKVFEGNRPTNSIVFTKLNPFIMGALIAMYEHKIFVQGVVWDINSYDQWGVELGKQLAKKIEPELETDAAITSHDSSTNGLIEFIKKHRE 538          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Xenopus
Match: gpi (glucose-6-phosphate isomerase [Source:NCBI gene;Acc:496419])

HSP 1 Score: 459.529 bits (1181), Expect = 2.339e-157
Identity = 211/285 (74.04%), Postives = 242/285 (84.91%), Query Frame = 1
Query:  484 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIKSQK 1338
            WVGGRYSLWSAIGLSIAL+IG DNFE+LL+G H MDNHF +TPLE N+PV++AMLG+ YI+ Y  ETHA+LPYDQYMHRFAAYFQQGDMESNGK+I   G RV Y+TGP++WGEPGTNGQHAFYQLIHQGTR IP DFLIP QT +PI N LHH+ILLSNFLAQTEALM+GK  E+ ++EL+A G++G  LE L  HK F GNRPTNS VFTK+NPF++G LIAMYEHKIFVQG +W+INSYDQWGVELGK LAKKI+PEL     I SHDSSTNGLI+FIK  +
Sbjct:  261 WVGGRYSLWSAIGLSIALHIGYDNFEKLLAGAHWMDNHFYKTPLENNVPVLLAMLGVWYINFYGCETHALLPYDQYMHRFAAYFQQGDMESNGKYITRTGARVNYNTGPVVWGEPGTNGQHAFYQLIHQGTRRIPCDFLIPVQTQHPIRNNLHHKILLSNFLAQTEALMKGKSTEEAKKELQASGLTGDALEKLLPHKVFEGNRPTNSIVFTKLNPFIMGALIAMYEHKIFVQGVVWDINSYDQWGVELGKQLAKKIEPELETDAAITSHDSSTNGLIEFIKKHR 545          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Xenopus
Match: gpi (glucose-6-phosphate isomerase [Source:NCBI gene;Acc:496419])

HSP 1 Score: 459.529 bits (1181), Expect = 2.522e-157
Identity = 211/285 (74.04%), Postives = 242/285 (84.91%), Query Frame = 1
Query:  484 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIKSQK 1338
            WVGGRYSLWSAIGLSIAL+IG DNFE+LL+G H MDNHF +TPLE N+PV++AMLG+ YI+ Y  ETHA+LPYDQYMHRFAAYFQQGDMESNGK+I   G RV Y+TGP++WGEPGTNGQHAFYQLIHQGTR IP DFLIP QT +PI N LHH+ILLSNFLAQTEALM+GK  E+ ++EL+A G++G  LE L  HK F GNRPTNS VFTK+NPF++G LIAMYEHKIFVQG +W+INSYDQWGVELGK LAKKI+PEL     I SHDSSTNGLI+FIK  +
Sbjct:  268 WVGGRYSLWSAIGLSIALHIGYDNFEKLLAGAHWMDNHFYKTPLENNVPVLLAMLGVWYINFYGCETHALLPYDQYMHRFAAYFQQGDMESNGKYITRTGARVNYNTGPVVWGEPGTNGQHAFYQLIHQGTRRIPCDFLIPVQTQHPIRNNLHHKILLSNFLAQTEALMKGKSTEEAKKELQASGLTGDALEKLLPHKVFEGNRPTNSIVFTKLNPFIMGALIAMYEHKIFVQGVVWDINSYDQWGVELGKQLAKKIEPELETDAAITSHDSSTNGLIEFIKKHR 552          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Xenopus
Match: gpi (glucose-6-phosphate isomerase [Source:NCBI gene;Acc:496419])

HSP 1 Score: 459.529 bits (1181), Expect = 2.998e-157
Identity = 211/285 (74.04%), Postives = 242/285 (84.91%), Query Frame = 1
Query:  484 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIKSQK 1338
            WVGGRYSLWSAIGLSIAL+IG DNFE+LL+G H MDNHF +TPLE N+PV++AMLG+ YI+ Y  ETHA+LPYDQYMHRFAAYFQQGDMESNGK+I   G RV Y+TGP++WGEPGTNGQHAFYQLIHQGTR IP DFLIP QT +PI N LHH+ILLSNFLAQTEALM+GK  E+ ++EL+A G++G  LE L  HK F GNRPTNS VFTK+NPF++G LIAMYEHKIFVQG +W+INSYDQWGVELGK LAKKI+PEL     I SHDSSTNGLI+FIK  +
Sbjct:  267 WVGGRYSLWSAIGLSIALHIGYDNFEKLLAGAHWMDNHFYKTPLENNVPVLLAMLGVWYINFYGCETHALLPYDQYMHRFAAYFQQGDMESNGKYITRTGARVNYNTGPVVWGEPGTNGQHAFYQLIHQGTRRIPCDFLIPVQTQHPIRNNLHHKILLSNFLAQTEALMKGKSTEEAKKELQASGLTGDALEKLLPHKVFEGNRPTNSIVFTKLNPFIMGALIAMYEHKIFVQGVVWDINSYDQWGVELGKQLAKKIEPELETDAAITSHDSSTNGLIEFIKKHR 551          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Xenopus
Match: gpi (glucose-6-phosphate isomerase [Source:NCBI gene;Acc:496419])

HSP 1 Score: 459.144 bits (1180), Expect = 5.623e-157
Identity = 211/285 (74.04%), Postives = 242/285 (84.91%), Query Frame = 1
Query:  484 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIKSQK 1338
            WVGGRYSLWSAIGLSIAL+IG DNFE+LL+G H MDNHF +TPLE N+PV++AMLG+ YI+ Y  ETHA+LPYDQYMHRFAAYFQQGDMESNGK+I   G RV Y+TGP++WGEPGTNGQHAFYQLIHQGTR IP DFLIP QT +PI N LHH+ILLSNFLAQTEALM+GK  E+ ++EL+A G++G  LE L  HK F GNRPTNS VFTK+NPF++G LIAMYEHKIFVQG +W+INSYDQWGVELGK LAKKI+PEL     I SHDSSTNGLI+FIK  +
Sbjct:  278 WVGGRYSLWSAIGLSIALHIGYDNFEKLLAGAHWMDNHFYKTPLENNVPVLLAMLGVWYINFYGCETHALLPYDQYMHRFAAYFQQGDMESNGKYITRTGARVNYNTGPVVWGEPGTNGQHAFYQLIHQGTRRIPCDFLIPVQTQHPIRNNLHHKILLSNFLAQTEALMKGKSTEEAKKELQASGLTGDALEKLLPHKVFEGNRPTNSIVFTKLNPFIMGALIAMYEHKIFVQGVVWDINSYDQWGVELGKQLAKKIEPELETDAAITSHDSSTNGLIEFIKKHR 562          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Mouse
Match: Gpi1 (glucose phosphate isomerase 1 [Source:MGI Symbol;Acc:MGI:95797])

HSP 1 Score: 454.907 bits (1169), Expect = 1.521e-155
Identity = 210/285 (73.68%), Postives = 241/285 (84.56%), Query Frame = 1
Query:  484 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIKSQK 1338
            WVGGRYSLWSAIGLSIAL++G D+FE+LLSG H MD HF +TPLE+N PV++A+LGI YI+CY  ETHA+LPYDQYMHRFAAYFQQGDMESNGK+I   G RV + TGPI+WGEPGTNGQHAFYQLIHQGT++IP DFLIP QT +PI  GLHH+ILL+NFLAQTEALM+GK  E+ R+EL+A G S  DLE L  HK F GNRPTNS VFTK+ PF+LG LIAMYEHKIFVQG +W+INS+DQWGVELGK LAKKI+PEL G   + SHDSSTNGLI FIK Q+
Sbjct:  269 WVGGRYSLWSAIGLSIALHVGFDHFEQLLSGAHWMDQHFLKTPLEKNAPVLLALLGIWYINCYGCETHALLPYDQYMHRFAAYFQQGDMESNGKYITKSGARVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEALMKGKLPEEARKELQAAGKSPEDLEKLLPHKVFEGNRPTNSIVFTKLTPFILGALIAMYEHKIFVQGIMWDINSFDQWGVELGKQLAKKIEPELEGSSAVTSHDSSTNGLISFIKQQR 553          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Mouse
Match: Gpi1 (glucose phosphate isomerase 1 [Source:MGI Symbol;Acc:MGI:95797])

HSP 1 Score: 263.077 bits (671), Expect = 8.312e-86
Identity = 124/170 (72.94%), Postives = 141/170 (82.94%), Query Frame = 1
Query:  829 GTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIKSQK 1338
            GTNGQHAFYQLIHQGT++IP DFLIP QT +PI  GLHH+ILL+NFLAQTEALM+GK  E+ R+EL+A G S  DLE L  HK F GNRPTNS VFTK+ PF+LG LIAMYEHKIFVQG +W+INS+DQWGVELGK LAKKI+PEL G   + SHDSSTNGLI FIK Q+
Sbjct:   17 GTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEALMKGKLPEEARKELQAAGKSPEDLEKLLPHKVFEGNRPTNSIVFTKLTPFILGALIAMYEHKIFVQGIMWDINSFDQWGVELGKQLAKKIEPELEGSSAVTSHDSSTNGLISFIKQQR 186          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Mouse
Match: Gpi1 (glucose phosphate isomerase 1 [Source:MGI Symbol;Acc:MGI:95797])

HSP 1 Score: 90.5077 bits (223), Expect = 4.561e-21
Identity = 45/78 (57.69%), Postives = 56/78 (71.79%), Query Frame = 1
Query:  832 TNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELL 1065
            + G  A    +  GT++IP DFLIP QT +PI  GLHH+ILL+NFLAQTEALM+GK  E+ R+EL+A G S  DLE L
Sbjct:   74 SRGVEAARDNMFSGTKMIPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEALMKGKLPEEARKELQAAGKSPEDLEKL 151          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Mouse
Match: Gpi1 (glucose phosphate isomerase 1 [Source:MGI Symbol;Acc:MGI:95797])

HSP 1 Score: 54.6842 bits (130), Expect = 3.642e-9
Identity = 23/35 (65.71%), Postives = 30/35 (85.71%), Query Frame = 1
Query:  550 DNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGI 654
            D+FE+LLSG H MD HF +TPLE+N PV++A+LGI
Sbjct:    2 DHFEQLLSGAHWMDQHFLKTPLEKNAPVLLALLGI 36          
BLAST of Glucose-6-phosphate isomerase vs. UniProt/SwissProt
Match: sp|P06744|G6PI_HUMAN (Glucose-6-phosphate isomerase OS=Homo sapiens OX=9606 GN=GPI PE=1 SV=4)

HSP 1 Score: 460.685 bits (1184), Expect = 5.477e-157
Identity = 210/286 (73.43%), Postives = 243/286 (84.97%), Query Frame = 1
Query:  484 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIKSQKK 1341
            WVGGRYSLWSAIGLSIAL++G DNFE+LLSG H MD HF+ TPLE+N PV++A+LGI YI+C+  ETHA+LPYDQY+HRFAAYFQQGDMESNGK+I   G RV + TGPI+WGEPGTNGQHAFYQLIHQGT++IP DFLIP QT +PI  GLHH+ILL+NFLAQTEALMRGK  E+ R+EL+A G S  DLE L  HK F GNRPTNS VFTK+ PFMLG L+AMYEHKIFVQG IW+INS+DQWGVELGK LAKKI+PEL G   + SHD+STNGLI+FIK Q++
Sbjct:  269 WVGGRYSLWSAIGLSIALHVGFDNFEQLLSGAHWMDQHFRTTPLEKNAPVLLALLGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESNGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEALMRGKSTEEARKELQAAGKSPEDLERLLPHKVFEGNRPTNSIVFTKLTPFMLGALVAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSAQVTSHDASTNGLINFIKQQRE 554          
BLAST of Glucose-6-phosphate isomerase vs. UniProt/SwissProt
Match: sp|Q3ZBD7|G6PI_BOVIN (Glucose-6-phosphate isomerase OS=Bos taurus OX=9913 GN=GPI PE=2 SV=4)

HSP 1 Score: 460.299 bits (1183), Expect = 6.518e-157
Identity = 210/286 (73.43%), Postives = 243/286 (84.97%), Query Frame = 1
Query:  484 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIKSQKK 1341
            WVGGRYSLWSAIGLSIAL++G DNFE+LLSG H MD HF+ TPLE+N PV++A+LGI YI+C+  ETHA+LPYDQY+HRFAAYFQQGDMESNGK+I   G RV Y TGPI+WGEPGTNGQHAFYQLIHQGT++IP DFLIP Q+ +PI NGLHH+ILL+NFLAQTEALMRGK  E+ R+EL+A G S  D E L  HK F GNRPTNS VFTK+ PF+LG LIAMYEHKIFVQG IW+INS+DQWGVELGK LAKKI+PEL G   + SHDSSTNGLI+FIK +++
Sbjct:  269 WVGGRYSLWSAIGLSIALHVGFDNFEQLLSGAHWMDQHFRTTPLEKNAPVLLALLGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESNGKYITKSGTRVNYQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQSQHPIRNGLHHKILLANFLAQTEALMRGKSTEEARKELQAAGRSPEDFEKLLPHKVFEGNRPTNSIVFTKLTPFILGALIAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSSPVTSHDSSTNGLINFIKQERE 554          
BLAST of Glucose-6-phosphate isomerase vs. UniProt/SwissProt
Match: sp|Q5R4E3|G6PI_PONAB (Glucose-6-phosphate isomerase OS=Pongo abelii OX=9601 GN=GPI PE=2 SV=3)

HSP 1 Score: 460.299 bits (1183), Expect = 9.227e-157
Identity = 209/286 (73.08%), Postives = 243/286 (84.97%), Query Frame = 1
Query:  484 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIKSQKK 1341
            WVGGRYSLWSAIGLSIAL++G DNFE+LLSG H MD HF+ TPLE+N PV++A+LGI YI+C+  ETHA+LPYDQY+HRFAAYFQQGDMESNGK+I   G RV + TGPI+WGEPGTNGQHAFYQLIHQGT++IP DFLIP QT +PI  GLHH++LL+NFLAQTEALMRGK  E+ R+EL+A G S  DLE L  HK F GNRPTNS VFTK+ PFMLG L+AMYEHKIFVQG IW+INS+DQWGVELGK LAKKI+PEL G   + SHD+STNGLI+FIK Q++
Sbjct:  269 WVGGRYSLWSAIGLSIALHVGFDNFEQLLSGAHWMDQHFRTTPLEKNAPVLLALLGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESNGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGLHHKVLLANFLAQTEALMRGKSTEEARKELQAAGKSPEDLERLLPHKVFEGNRPTNSIVFTKLTPFMLGALVAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSAQVTSHDASTNGLINFIKQQRE 554          
BLAST of Glucose-6-phosphate isomerase vs. UniProt/SwissProt
Match: sp|Q4R591|G6PI_MACFA (Glucose-6-phosphate isomerase OS=Macaca fascicularis OX=9541 GN=GPI PE=2 SV=3)

HSP 1 Score: 459.529 bits (1181), Expect = 1.752e-156
Identity = 209/286 (73.08%), Postives = 243/286 (84.97%), Query Frame = 1
Query:  484 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIKSQKK 1341
            WVGGRYSLWSAIGLSIAL++G DNFE+LLSG H MD HF+ TPLE+N PV++A+LGI YI+C+  ETHA+LPYDQY+HRFAAYFQQGDMESNGK+I   G RV + TGPI+WGEPGTNGQHAFYQLIHQGT++IP DFLIP QT +PI  GLHH+ILL+NFLAQTEALMRGK  ++ R+EL+A G S  DLE L  HK F GNRPTNS VFTK+ PFMLG L+AMYEHKIFVQG IW+INS+DQWGVELGK LAKKI+PEL G   + SHD+STNGLI+FIK Q++
Sbjct:  269 WVGGRYSLWSAIGLSIALHVGFDNFEQLLSGAHWMDQHFRTTPLEKNAPVLLALLGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESNGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEALMRGKSTDEARKELQAAGKSPEDLERLLPHKVFEGNRPTNSIVFTKLTPFMLGALVAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSAQVTSHDASTNGLINFIKQQRE 554          
BLAST of Glucose-6-phosphate isomerase vs. UniProt/SwissProt
Match: sp|Q9N1E2|G6PI_RABIT (Glucose-6-phosphate isomerase OS=Oryctolagus cuniculus OX=9986 GN=GPI PE=1 SV=3)

HSP 1 Score: 455.677 bits (1171), Expect = 5.307e-155
Identity = 208/286 (72.73%), Postives = 241/286 (84.27%), Query Frame = 1
Query:  484 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIKSQKK 1341
            WVGGRYSLWSAIGLSIAL++G DNFE+LLSG H MD HF+ TPLE+N PV++AMLGI YI+C+  ET A+LPYDQY+HRFAAYFQQGDMESNGK+I   G RV + TGPI+WGEPGTNGQHAFYQLIHQGT++IP DFLIP QT +PI  GLHH+ILL+NFLAQTEALM+GK  E+ R+EL+A G S  DL  L  HK F GNRPTNS VFTK+ PF+LG LIAMYEHKIFVQG +W+INS+DQWGVELGK LAKKI+PEL G   + SHDSSTNGLI+FIK Q++
Sbjct:  269 WVGGRYSLWSAIGLSIALHVGFDNFEQLLSGAHWMDQHFRTTPLEKNAPVLLAMLGIWYINCFGCETQAVLPYDQYLHRFAAYFQQGDMESNGKYITKSGARVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEALMKGKSTEEARKELQAAGKSPEDLMKLLPHKVFEGNRPTNSIVFTKLTPFILGALIAMYEHKIFVQGVVWDINSFDQWGVELGKQLAKKIEPELDGSSPVTSHDSSTNGLINFIKQQRE 554          
BLAST of Glucose-6-phosphate isomerase vs. TrEMBL
Match: H9G532 (Glucose-6-phosphate isomerase OS=Anolis carolinensis OX=28377 GN=GPI PE=3 SV=1)

HSP 1 Score: 471.47 bits (1212), Expect = 8.873e-159
Identity = 216/285 (75.79%), Postives = 245/285 (85.96%), Query Frame = 1
Query:  484 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIKSQK 1338
            WVGGRYSLWSAIGLSIAL+IG DNFE+LL+G H MDNHF+ TPLE+N+PV++AMLG+ YI+CY  ETHA+LPYDQYMHRFAAYFQQGDMESNGK+I   G RV Y TGPI+WGEPGTNGQHAFYQLIHQGTR+IP DFLIP QT NPI NGLHH+ILL+NFLAQTEALM+GK  E+ R+EL+A GMSG  LE L  HK F GNRPTNS +FTK+NPF+LG LIAMYEHKIFVQG +W+INSYDQWGVELGK LAKKI+PELS    + SHDSSTNGLI FI+  +
Sbjct:  268 WVGGRYSLWSAIGLSIALHIGYDNFEKLLAGAHWMDNHFRTTPLEKNVPVVLAMLGVWYINCYGTETHALLPYDQYMHRFAAYFQQGDMESNGKYITKKGTRVNYSTGPIVWGEPGTNGQHAFYQLIHQGTRMIPCDFLIPVQTQNPIRNGLHHKILLANFLAQTEALMKGKTTEEARQELQAAGMSGDALEKLLPHKVFEGNRPTNSIMFTKLNPFILGALIAMYEHKIFVQGVVWDINSYDQWGVELGKQLAKKIEPELSSDAPVTSHDSSTNGLIGFIQKHR 552          
BLAST of Glucose-6-phosphate isomerase vs. TrEMBL
Match: A0A0R3TC04 (Glucose-6-phosphate isomerase OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS4591 PE=3 SV=1)

HSP 1 Score: 469.929 bits (1208), Expect = 1.165e-158
Identity = 217/285 (76.14%), Postives = 242/285 (84.91%), Query Frame = 1
Query:  484 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIKSQK 1338
            WVGGRYS+WSAIGLSIALYIGMDNFE LL G HAMD HFKETP+E+NIP+I+ +LG+MYI+ YKAET AILPYDQYM+RF AYFQQGDMESNGK++   G  V YHTGPI+WGEPGTNGQHAFYQLIHQGT LIP DFL+P  THNPI NG  HEILLSNFLAQTEALM GK  E+ + EL+A GM G  LE+L++HK+F GN+PTNS VFTK++PFMLGVL+AMYEHKIF QGAIW INSYDQWGVELGK LAKKIQPEL   +VI SHD STNGLI FIK  K
Sbjct:  234 WVGGRYSMWSAIGLSIALYIGMDNFERLLDGAHAMDKHFKETPIEKNIPMILGLLGVMYINAYKAETQAILPYDQYMNRFPAYFQQGDMESNGKYVTRDGNTVDYHTGPIVWGEPGTNGQHAFYQLIHQGTSLIPCDFLVPIHTHNPIKNGEFHEILLSNFLAQTEALMLGKTTEQAKNELQAAGMCGEKLEMLAKHKTFRGNKPTNSIVFTKLDPFMLGVLVAMYEHKIFTQGAIWNINSYDQWGVELGKELAKKIQPELHSKDVITSHDGSTNGLIAFIKHNK 518          
BLAST of Glucose-6-phosphate isomerase vs. TrEMBL
Match: A0A0R3X197 (Glucose-6-phosphate isomerase OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS6945 PE=3 SV=1)

HSP 1 Score: 470.315 bits (1209), Expect = 1.684e-158
Identity = 214/286 (74.83%), Postives = 246/286 (86.01%), Query Frame = 1
Query:  484 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIKSQKK 1341
            WVGGRYSLWSAIGLSIALYIGMDNFE LL+G HAMD HFKE P+E+N+P+I+A+LG+MYI+CY AET AILPYDQYM+RF AYFQQGDMESNGK++   G  V YHTGPI+WGEPGTNGQHAFYQLIHQGT LIP DFL+P ++HNPI NG  HEILLSNFLAQTEALM GK  E  R+ELEA+G+SG  LE+L +HK+F GN+PTNS +FT++NPFMLGV+IAMYEHKIF QGAIW INSYDQWGVELGK LAKK+QPE+   +V+ SHD STNGLI FIK  +K
Sbjct:  260 WVGGRYSLWSAIGLSIALYIGMDNFERLLAGAHAMDKHFKEAPIEKNVPMILALLGVMYINCYNAETQAILPYDQYMNRFPAYFQQGDMESNGKYVTRDGVTVSYHTGPIVWGEPGTNGQHAFYQLIHQGTLLIPCDFLVPVRSHNPIKNGEFHEILLSNFLAQTEALMLGKTPETARKELEAQGLSGDKLEMLVKHKTFRGNKPTNSIIFTELNPFMLGVIIAMYEHKIFTQGAIWNINSYDQWGVELGKELAKKLQPEIHSEDVVTSHDGSTNGLIAFIKHNRK 545          
BLAST of Glucose-6-phosphate isomerase vs. TrEMBL
Match: A0A3Q0H0I9 (Glucose-6-phosphate isomerase OS=Alligator sinensis OX=38654 GN=GPI PE=3 SV=1)

HSP 1 Score: 468.774 bits (1205), Expect = 6.133e-158
Identity = 214/285 (75.09%), Postives = 244/285 (85.61%), Query Frame = 1
Query:  484 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIKSQK 1338
            WVGGRYSLWSAIGLSIAL+IG DNFE LL+G H MDNHF+  PLE+N+PV++AMLG+ YI+CY  ETHA+LPYDQYMHRFAAYFQQGDMESNGK+I   G RV Y+TGPI+WGEPGTNGQHAFYQLIHQGTR+IP DFLIP QT NPI NGLHH+ILL+NFLAQTEALM+GK  ++ R+EL+A G+SG  LE L  HK F GNRPTNS +FTK+NPF+LG LIAMYEHKIFVQG +W+INSYDQWGVELGK LAKKI+PEL     + SHDSSTNGLI+FIK  K
Sbjct:  256 WVGGRYSLWSAIGLSIALHIGFDNFENLLAGAHWMDNHFRSAPLEKNVPVLLAMLGVWYINCYGTETHALLPYDQYMHRFAAYFQQGDMESNGKYITKKGSRVDYNTGPIVWGEPGTNGQHAFYQLIHQGTRMIPCDFLIPVQTQNPIRNGLHHKILLANFLAQTEALMKGKTTDEARKELQAAGLSGDTLEKLLPHKVFEGNRPTNSILFTKLNPFILGALIAMYEHKIFVQGVVWDINSYDQWGVELGKQLAKKIEPELDSDAPVTSHDSSTNGLINFIKKHK 540          
BLAST of Glucose-6-phosphate isomerase vs. TrEMBL
Match: A0A402ENM9 (Glucose-6-phosphate isomerase OS=Paroedura picta OX=143630 GN=parPi_0005429 PE=3 SV=1)

HSP 1 Score: 468.389 bits (1204), Expect = 1.180e-157
Identity = 214/285 (75.09%), Postives = 246/285 (86.32%), Query Frame = 1
Query:  484 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIKSQK 1338
            WVGGRYSLWSAIGLSIAL+IG DNFE+LL+G H MDNHF+  PLE+N+PV++AMLG+ YI+C+ AETHA+LPYDQYMHRFAAYFQQGDMESNGK+I   G RV Y+TGPI+WGEPGTNGQHAFYQLIHQGTR+IP DFLIPAQT NPI  GLHH+ILLSNFLAQTEALM+GK  ++ R+EL+A G+SG  LE +  HK F GNRPTNS VFTK+NPF+LG LIAMYEHKIFVQG +W+INSYDQWGVELGK LAKKI+PEL     + SHDSSTNGLI+FIK  +
Sbjct:  268 WVGGRYSLWSAIGLSIALHIGFDNFEKLLAGAHWMDNHFRTAPLEKNVPVLLAMLGVWYINCFGAETHALLPYDQYMHRFAAYFQQGDMESNGKYITKKGTRVDYNTGPIVWGEPGTNGQHAFYQLIHQGTRMIPCDFLIPAQTQNPIRKGLHHKILLSNFLAQTEALMKGKTTDEARKELQASGLSGDTLEKILPHKVFEGNRPTNSIVFTKLNPFILGALIAMYEHKIFVQGVVWDINSYDQWGVELGKQLAKKIEPELETDAPVTSHDSSTNGLINFIKKHR 552          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Cavefish
Match: gpia (glucose-6-phosphate isomerase-like [Source:NCBI gene;Acc:103031298])

HSP 1 Score: 449.899 bits (1156), Expect = 7.579e-154
Identity = 206/285 (72.28%), Postives = 241/285 (84.56%), Query Frame = 1
Query:  484 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIKSQK 1338
            WVGGRYSLWSAIGLSIAL++G DNFE+LL+G H MDNHF   PLEQN PV++A+LGI Y++ ++AETHA+LPYDQYMHRFAAYFQQGDMESNGK+I   G RV YHTGPI+WGEPGTNGQHAFYQLIHQGTR+IPADFLIPAQT +PI + LHH+IL++NFLAQTEALM+GK +++ R+ELEA G SG  LE L  HK F GN+P+NS +F K++PFMLG L+AMYEHKIFVQG +W INSYDQWGVELGK LAKKI+PEL     + SHDSSTNGLI F K  +
Sbjct:  268 WVGGRYSLWSAIGLSIALHVGFDNFEQLLAGAHWMDNHFCSAPLEQNAPVLLALLGIWYVNFFQAETHALLPYDQYMHRFAAYFQQGDMESNGKYITKNGTRVNYHTGPIVWGEPGTNGQHAFYQLIHQGTRMIPADFLIPAQTQHPIRDNLHHKILMANFLAQTEALMKGKTSDEARKELEAAGKSGEALEKLLPHKVFEGNKPSNSIIFKKLSPFMLGALVAMYEHKIFVQGVMWNINSYDQWGVELGKQLAKKIEPELQDDSEVHSHDSSTNGLISFFKKNR 552          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Cavefish
Match: gpib (glucose-6-phosphate isomerase [Source:NCBI gene;Acc:103043831])

HSP 1 Score: 440.654 bits (1132), Expect = 2.070e-150
Identity = 200/282 (70.92%), Postives = 240/282 (85.11%), Query Frame = 1
Query:  484 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIK 1329
            WVGGRYSLWSAIGLSIAL+IG +NFE+LL+G H MD HF+  PL+QN PV++AMLGI YI+ ++ ETH +LPYDQYMHRFAAYFQQGDMESNGK+I + G RV YHTGPI+WGEPGTNGQHAFYQLIHQGTR +P+DFLIPAQ+ +PI N LHH+IL++NFLAQTEA+M+GK  E+ ++ELEA G+SG  L+ +  HK F GN+PTNS +F K+ P+ LGVLIAMYEHKIF+QG +WEINS+DQWGVELGK LAKKI+PEL     + SHDSSTNGLI+FIK
Sbjct:  245 WVGGRYSLWSAIGLSIALHIGFENFEKLLAGAHWMDTHFRTAPLDQNAPVLLAMLGIWYINFFQMETHCLLPYDQYMHRFAAYFQQGDMESNGKYITNHGTRVNYHTGPIVWGEPGTNGQHAFYQLIHQGTRTVPSDFLIPAQSQHPIRNNLHHKILIANFLAQTEAMMKGKTTEEAKKELEAGGLSGEKLDKILPHKVFLGNKPTNSIIFKKLTPYTLGVLIAMYEHKIFIQGVMWEINSFDQWGVELGKQLAKKIEPELQDKTEVSSHDSSTNGLINFIK 526          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Cavefish
Match: gpib (glucose-6-phosphate isomerase [Source:NCBI gene;Acc:103043831])

HSP 1 Score: 440.654 bits (1132), Expect = 3.316e-150
Identity = 200/282 (70.92%), Postives = 240/282 (85.11%), Query Frame = 1
Query:  484 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIK 1329
            WVGGRYSLWSAIGLSIAL+IG +NFE+LL+G H MD HF+  PL+QN PV++AMLGI YI+ ++ ETH +LPYDQYMHRFAAYFQQGDMESNGK+I + G RV YHTGPI+WGEPGTNGQHAFYQLIHQGTR +P+DFLIPAQ+ +PI N LHH+IL++NFLAQTEA+M+GK  E+ ++ELEA G+SG  L+ +  HK F GN+PTNS +F K+ P+ LGVLIAMYEHKIF+QG +WEINS+DQWGVELGK LAKKI+PEL     + SHDSSTNGLI+FIK
Sbjct:  265 WVGGRYSLWSAIGLSIALHIGFENFEKLLAGAHWMDTHFRTAPLDQNAPVLLAMLGIWYINFFQMETHCLLPYDQYMHRFAAYFQQGDMESNGKYITNHGTRVNYHTGPIVWGEPGTNGQHAFYQLIHQGTRTVPSDFLIPAQSQHPIRNNLHHKILIANFLAQTEAMMKGKTTEEAKKELEAGGLSGEKLDKILPHKVFLGNKPTNSIIFKKLTPYTLGVLIAMYEHKIFIQGVMWEINSFDQWGVELGKQLAKKIEPELQDKTEVSSHDSSTNGLINFIK 546          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Cavefish
Match: gpib (glucose-6-phosphate isomerase [Source:NCBI gene;Acc:103043831])

HSP 1 Score: 440.654 bits (1132), Expect = 3.347e-150
Identity = 200/282 (70.92%), Postives = 240/282 (85.11%), Query Frame = 1
Query:  484 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIK 1329
            WVGGRYSLWSAIGLSIAL+IG +NFE+LL+G H MD HF+  PL+QN PV++AMLGI YI+ ++ ETH +LPYDQYMHRFAAYFQQGDMESNGK+I + G RV YHTGPI+WGEPGTNGQHAFYQLIHQGTR +P+DFLIPAQ+ +PI N LHH+IL++NFLAQTEA+M+GK  E+ ++ELEA G+SG  L+ +  HK F GN+PTNS +F K+ P+ LGVLIAMYEHKIF+QG +WEINS+DQWGVELGK LAKKI+PEL     + SHDSSTNGLI+FIK
Sbjct:  268 WVGGRYSLWSAIGLSIALHIGFENFEKLLAGAHWMDTHFRTAPLDQNAPVLLAMLGIWYINFFQMETHCLLPYDQYMHRFAAYFQQGDMESNGKYITNHGTRVNYHTGPIVWGEPGTNGQHAFYQLIHQGTRTVPSDFLIPAQSQHPIRNNLHHKILIANFLAQTEAMMKGKTTEEAKKELEAGGLSGEKLDKILPHKVFLGNKPTNSIIFKKLTPYTLGVLIAMYEHKIFIQGVMWEINSFDQWGVELGKQLAKKIEPELQDKTEVSSHDSSTNGLINFIK 549          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Cavefish
Match: gpia (glucose-6-phosphate isomerase-like [Source:NCBI gene;Acc:103031298])

HSP 1 Score: 429.483 bits (1103), Expect = 8.503e-146
Identity = 202/287 (70.38%), Postives = 238/287 (82.93%), Query Frame = 1
Query:  484 WVGGRYSLWSAIGLSIALYIGMDNFEEL--LSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIKSQK 1338
            WVGGRYSLWSAIGLSIAL++G + F +L  LS  H+ DNHF   PLEQN PV++A+LGI Y++ ++AETHA+LPYDQYMHRFAAYFQQGDMESNGK+I   G RV YHTGPI+WGEPGTNGQHAFYQLIHQGTR+IPADFLIPAQT +PI + LHH+IL++NFLAQTEALM+GK +++ R+ELEA G SG  LE L  HK F GN+P+NS +F K++PFMLG L+AMYEHKIFVQG +W INSYDQWGVELGK LAKKI+PEL     + SHDSSTNGLI F K  +
Sbjct:  271 WVGGRYSLWSAIGLSIALHVG-NIFTDLFDLSPSHSQDNHFCSAPLEQNAPVLLALLGIWYVNFFQAETHALLPYDQYMHRFAAYFQQGDMESNGKYITKNGTRVNYHTGPIVWGEPGTNGQHAFYQLIHQGTRMIPADFLIPAQTQHPIRDNLHHKILMANFLAQTEALMKGKTSDEARKELEAAGKSGEALEKLLPHKVFEGNKPSNSIIFKKLSPFMLGALVAMYEHKIFVQGVMWNINSYDQWGVELGKQLAKKIEPELQDDSEVHSHDSSTNGLISFFKKNR 556          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Sea Lamprey
Match: gpib (glucose-6-phosphate isomerase b [Source:ZFIN;Acc:ZDB-GENE-020513-3])

HSP 1 Score: 63.929 bits (154), Expect = 2.535e-12
Identity = 29/35 (82.86%), Postives = 32/35 (91.43%), Query Frame = 1
Query:  484 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAM 588
            WVGGRYSLWSAIGLSIAL+IG +NFE+LLSG H M
Sbjct:  141 WVGGRYSLWSAIGLSIALHIGFENFEQLLSGAHWM 175          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Yeast
Match: PGI1 (Glycolytic enzyme phosphoglucose isomerase; catalyzes the interconversion of glucose-6-phosphate and fructose-6-phosphate; required for cell cycle progression and completion of the gluconeogenic events of sporulation [Source:SGD;Acc:S000000400])

HSP 1 Score: 342.043 bits (876), Expect = 1.574e-112
Identity = 163/282 (57.80%), Postives = 200/282 (70.92%), Query Frame = 1
Query:  484 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIK 1329
            WVGGRYS+WSAIGLS+ALYIG DNFE  L G  A+DNHF +TPLE NIP++  +L + Y + + A+TH + P+DQY+HRF AY QQ  MESNGK +        Y TG I++GEP TN QH+F+QL+HQGT+LIP+DF++ AQ+HNPI N LH ++L SNF AQ EALM GK  E+V+    AEG +G     L  HK F GNRPT S +  K+ P  LG LIA YEH  F +GAIW INS+DQWGVELGKVLAK I  EL     I +HD+STNGLI+  K
Sbjct:  278 WVGGRYSVWSAIGLSVALYIGYDNFEAFLKGAEAVDNHFTQTPLEDNIPLLGGLLSVWYNNFFGAQTHLVAPFDQYLHRFPAYLQQLSMESNGKSVTRGNVFTDYSTGSILFGEPATNAQHSFFQLVHQGTKLIPSDFILAAQSHNPIENKLHQKMLASNFFAQAEALMVGKDEEQVK----AEGATGG----LVPHKVFSGNRPTTSILAQKITPATLGALIAYYEHVTFTEGAIWNINSFDQWGVELGKVLAKVIGKELDNSSTISTHDASTNGLINQFK 551          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Nematostella
Match: EDO37039 (Glucose-6-phosphate isomerase [Source:UniProtKB/TrEMBL;Acc:A7SGU1])

HSP 1 Score: 438.343 bits (1126), Expect = 1.116e-149
Identity = 206/288 (71.53%), Postives = 237/288 (82.29%), Query Frame = 1
Query:  484 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQN--IPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIKSQKK 1341
            WVGGRYSLWSAIGLSIA+YIGMDNFE LLSG HAMDNHFK+ PLE N  IPVI+A+LGI Y + + A++H +  YDQYMHRFAAYFQQGDMESNGKF+   G+ V Y TGPI+WGEPGTNGQHAFYQLIHQGT++IPADFL P +THNPI+NGLHH+ILLSNFLAQ EALM+GK  E+ R EL AEG +G  L+ ++  K F GN+PTNS VF K+ PF LG+LIAMYEHKIF QG IW INS+DQWGVELGK LAK IQPEL+    + SHDSSTNGLI+FIK + K
Sbjct:  269 WVGGRYSLWSAIGLSIAIYIGMDNFEALLSGAHAMDNHFKDAPLENNLMIPVILALLGIWYNNFFGAQSHGMFAYDQYMHRFAAYFQQGDMESNGKFMTRFGEEVDYSTGPIVWGEPGTNGQHAFYQLIHQGTKMIPADFLAPIETHNPISNGLHHQILLSNFLAQPEALMKGKTLEEARTELAAEGKTGEKLDKIAPQKVFKGNKPTNSIVFKKLTPFTLGLLIAMYEHKIFTQGVIWGINSFDQWGVELGKQLAKVIQPELASPGRVTSHDSSTNGLINFIKGEAK 556          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Nematostella
Match: EDO27774 (Glucose-6-phosphate isomerase [Source:UniProtKB/TrEMBL;Acc:A7T8B5])

HSP 1 Score: 83.1889 bits (204), Expect = 1.482e-17
Identity = 33/59 (55.93%), Postives = 46/59 (77.97%), Query Frame = 1
Query:  484 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMY 660
            WVGGR+SLWSA+GLSI+L +G  NF+++L G   MD HFKE   ++NIPV++A++ I Y
Sbjct:  266 WVGGRFSLWSAVGLSISLSVGFANFKQILLGASXMDTHFKEATFDKNIPVVLALISIWY 324          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Medaka
Match: gpia (glucose-6-phosphate isomerase [Source:NCBI gene;Acc:101173933])

HSP 1 Score: 447.973 bits (1151), Expect = 2.088e-155
Identity = 205/282 (72.70%), Postives = 241/282 (85.46%), Query Frame = 1
Query:  484 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIK 1329
            WVGGRYSLWSAIGLSIAL+IG +NFE+LL+G H MDNHF   PL+QN+PV++A+LG+ YI+ ++AETHA+LPYDQYMHRFAAYFQQGDMESNGK+I+  G RV Y TGPI+WGEPGTNGQHAFYQLIHQGTR+IPADFLIPAQ+ +PI N LHH+IL++NFLAQTEALM+GK A++ R ELEA G+ G  LE L  HK F GN+P+NS VF K+ PFMLG L+AMYEHKIFVQG IW INSYDQWGVELGK LAK+I+PEL     + SHDSSTNGLI+F+K
Sbjct:  100 WVGGRYSLWSAIGLSIALHIGFNNFEQLLAGAHWMDNHFCNAPLDQNVPVLLALLGVWYINFFQAETHAMLPYDQYMHRFAAYFQQGDMESNGKYISKDGSRVKYQTGPIVWGEPGTNGQHAFYQLIHQGTRMIPADFLIPAQSQHPIRNNLHHKILMANFLAQTEALMKGKTADEARRELEAAGLKGEALEKLLPHKVFQGNKPSNSIVFKKLTPFMLGALVAMYEHKIFVQGVIWNINSYDQWGVELGKQLAKQIEPELQDAAEVTSHDSSTNGLINFLK 381          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Medaka
Match: gpia (glucose-6-phosphate isomerase [Source:NCBI gene;Acc:101173933])

HSP 1 Score: 449.899 bits (1156), Expect = 7.782e-154
Identity = 205/282 (72.70%), Postives = 241/282 (85.46%), Query Frame = 1
Query:  484 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIK 1329
            WVGGRYSLWSAIGLSIAL+IG +NFE+LL+G H MDNHF   PL+QN+PV++A+LG+ YI+ ++AETHA+LPYDQYMHRFAAYFQQGDMESNGK+I+  G RV Y TGPI+WGEPGTNGQHAFYQLIHQGTR+IPADFLIPAQ+ +PI N LHH+IL++NFLAQTEALM+GK A++ R ELEA G+ G  LE L  HK F GN+P+NS VF K+ PFMLG L+AMYEHKIFVQG IW INSYDQWGVELGK LAK+I+PEL     + SHDSSTNGLI+F+K
Sbjct:  268 WVGGRYSLWSAIGLSIALHIGFNNFEQLLAGAHWMDNHFCNAPLDQNVPVLLALLGVWYINFFQAETHAMLPYDQYMHRFAAYFQQGDMESNGKYISKDGSRVKYQTGPIVWGEPGTNGQHAFYQLIHQGTRMIPADFLIPAQSQHPIRNNLHHKILMANFLAQTEALMKGKTADEARRELEAAGLKGEALEKLLPHKVFQGNKPSNSIVFKKLTPFMLGALVAMYEHKIFVQGVIWNINSYDQWGVELGKQLAKQIEPELQDAAEVTSHDSSTNGLINFLK 549          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Medaka
Match: gpib (glucose-6-phosphate isomerase [Source:NCBI gene;Acc:101165966])

HSP 1 Score: 440.269 bits (1131), Expect = 4.869e-150
Identity = 203/291 (69.76%), Postives = 245/291 (84.19%), Query Frame = 1
Query:  457 IIQWKLFV*WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIK 1329
            II+ KL + WVGGR+SLWSAIG+SIAL++G DNFE+LLSG H MD HF+  PLE+N PV++A+LGI YI+ + AETHA+LPYDQYMHRF AYFQQGDMESNGK+I + G RV YHTGPI+WGEPGTNGQHAFYQLIHQGTR++P+DFLIPAQ+ +PI + LHH+IL +NFLAQTEALM+GK  E+ R+ELEA G+SG  LE +  HK F GNRPTNS +F K+ P+ LG LIAMYEHKIFVQG +WEINS+DQWGVELGK LAK I+PEL+    + SHD+STNGLI+F+K
Sbjct:  258 IIRRKLHL-WVGGRFSLWSAIGMSIALHVGFDNFEKLLSGAHWMDKHFRTAPLEKNAPVLLALLGIWYINFFHAETHAVLPYDQYMHRFTAYFQQGDMESNGKYITNHGARVNYHTGPIVWGEPGTNGQHAFYQLIHQGTRMVPSDFLIPAQSQHPIRDNLHHKILSANFLAQTEALMKGKTTEEARKELEASGLSGEALEKILPHKVFQGNRPTNSIIFKKLTPYTLGALIAMYEHKIFVQGVMWEINSFDQWGVELGKQLAKNIEPELNNTAEVHSHDASTNGLINFLK 547          
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Medaka
Match: gpib (glucose-6-phosphate isomerase [Source:NCBI gene;Acc:101165966])

HSP 1 Score: 438.728 bits (1127), Expect = 2.016e-149
Identity = 199/282 (70.57%), Postives = 239/282 (84.75%), Query Frame = 1
Query:  484 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIK 1329
            WVGGR+SLWSAIG+SIAL++G DNFE+LLSG H MD HF+  PLE+N PV++A+LGI YI+ + AETHA+LPYDQYMHRF AYFQQGDMESNGK+I + G RV YHTGPI+WGEPGTNGQHAFYQLIHQGTR++P+DFLIPAQ+ +PI + LHH+IL +NFLAQTEALM+GK  E+ R+ELEA G+SG  LE +  HK F GNRPTNS +F K+ P+ LG LIAMYEHKIFVQG +WEINS+DQWGVELGK LAK I+PEL+    + SHD+STNGLI+F+K
Sbjct:  268 WVGGRFSLWSAIGMSIALHVGFDNFEKLLSGAHWMDKHFRTAPLEKNAPVLLALLGIWYINFFHAETHAVLPYDQYMHRFTAYFQQGDMESNGKYITNHGARVNYHTGPIVWGEPGTNGQHAFYQLIHQGTRMVPSDFLIPAQSQHPIRDNLHHKILSANFLAQTEALMKGKTTEEARKELEASGLSGEALEKILPHKVFQGNRPTNSIIFKKLTPYTLGALIAMYEHKIFVQGVMWEINSFDQWGVELGKQLAKNIEPELNNTAEVHSHDASTNGLINFLK 549          
BLAST of Glucose-6-phosphate isomerase vs. Planmine SMEST
Match: SMESG000067583.1 (SMESG000067583.1)

HSP 1 Score: 603.594 bits (1555), Expect = 0.000e+0
Identity = 286/286 (100.00%), Postives = 286/286 (100.00%), Query Frame = 1
Query:  484 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIKSQKK 1341
            WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIKSQKK
Sbjct:  260 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIKSQKK 545          
BLAST of Glucose-6-phosphate isomerase vs. Planmine SMEST
Match: SMESG000067583.1 (SMESG000067583.1)

HSP 1 Score: 602.823 bits (1553), Expect = 0.000e+0
Identity = 286/286 (100.00%), Postives = 286/286 (100.00%), Query Frame = 1
Query:  484 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIKSQKK 1341
            WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIKSQKK
Sbjct:  245 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHDSSTNGLIDFIKSQKK 530          
BLAST of Glucose-6-phosphate isomerase vs. Planmine SMEST
Match: SMESG000067534.1 (SMESG000067534.1)

HSP 1 Score: 544.273 bits (1401), Expect = 0.000e+0
Identity = 258/287 (89.90%), Postives = 267/287 (93.03%), Query Frame = 1
Query:  484 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPEL--SGGEVIKSHDSSTNGLIDFIKSQK 1338
            WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAY QQ DMESNGKFIN  GKR+ Y TGP+IWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHH+ILLSNFLAQTEALMRGK  +KV++EL AEG  G ++ELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQ EL  S   +I SHDSSTNGLI FIKSQK
Sbjct:  260 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYLQQSDMESNGKFINQAGKRIAYSTGPVIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHDILLSNFLAQTEALMRGKSVDKVKKELIAEGKKGPEMELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIKSQK 546          
BLAST of Glucose-6-phosphate isomerase vs. Planmine SMEST
Match: SMESG000067534.1 (SMESG000067534.1)

HSP 1 Score: 543.502 bits (1399), Expect = 0.000e+0
Identity = 258/287 (89.90%), Postives = 267/287 (93.03%), Query Frame = 1
Query:  484 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRGKGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPEL--SGGEVIKSHDSSTNGLIDFIKSQK 1338
            WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAY QQ DMESNGKFIN  GKR+ Y TGP+IWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHH+ILLSNFLAQTEALMRGK  +KV++EL AEG  G ++ELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQ EL  S   +I SHDSSTNGLI FIKSQK
Sbjct:  245 WVGGRYSLWSAIGLSIALYIGMDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAILPYDQYMHRFAAYLQQSDMESNGKFINQAGKRIAYSTGPVIWGEPGTNGQHAFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHDILLSNFLAQTEALMRGKSVDKVKKELIAEGKKGPEMELLSQHKSFPGNRPTNSFVFTKMNPFMLGVLIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQQELRTSSNTLITSHDSSTNGLIQFIKSQK 531          
The following BLAST results are available for this feature:
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GPI4.324e-15873.43glucose-6-phosphate isomerase [Source:HGNC Symbol;... [more]
GPI1.141e-15773.43glucose-6-phosphate isomerase [Source:HGNC Symbol;... [more]
GPI1.905e-15773.43glucose-6-phosphate isomerase [Source:HGNC Symbol;... [more]
GPI2.379e-8464.40glucose-6-phosphate isomerase [Source:HGNC Symbol;... [more]
AC092073.18.740e-2862.03novel protein, readthrough between GPI and PDCD2[more]
back to top
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
gpi-11.068e-14369.26Glucose-6-phosphate isomerase [Source:UniProtKB/T... [more]
gpi-11.068e-14369.26Glucose-6-phosphate isomerase [Source:UniProtKB/T... [more]
gpi-11.068e-14369.26Glucose-6-phosphate isomerase [Source:UniProtKB/T... [more]
gpi-13.194e-14369.26Glucose-6-phosphate isomerase [Source:UniProtKB/T... [more]
back to top
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Pgi7.675e-14870.98gene:FBgn0003074 transcript:FBtr0088680[more]
Pgi7.675e-14870.98gene:FBgn0003074 transcript:FBtr0088681[more]
Pgi7.675e-14870.98gene:FBgn0003074 transcript:FBtr0088679[more]
back to top
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
gpia2.482e-15572.63glucose-6-phosphate isomerase a [Source:ZFIN;Acc:Z... [more]
gpib4.920e-15372.08glucose-6-phosphate isomerase b [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gpi2.030e-15773.78glucose-6-phosphate isomerase [Source:NCBI gene;Ac... [more]
gpi2.339e-15774.04glucose-6-phosphate isomerase [Source:NCBI gene;Ac... [more]
gpi2.522e-15774.04glucose-6-phosphate isomerase [Source:NCBI gene;Ac... [more]
gpi2.998e-15774.04glucose-6-phosphate isomerase [Source:NCBI gene;Ac... [more]
gpi5.623e-15774.04glucose-6-phosphate isomerase [Source:NCBI gene;Ac... [more]
back to top
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Gpi11.521e-15573.68glucose phosphate isomerase 1 [Source:MGI Symbol;A... [more]
Gpi18.312e-8672.94glucose phosphate isomerase 1 [Source:MGI Symbol;A... [more]
Gpi14.561e-2157.69glucose phosphate isomerase 1 [Source:MGI Symbol;A... [more]
Gpi13.642e-965.71glucose phosphate isomerase 1 [Source:MGI Symbol;A... [more]
back to top
BLAST of Glucose-6-phosphate isomerase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P06744|G6PI_HUMAN5.477e-15773.43Glucose-6-phosphate isomerase OS=Homo sapiens OX=9... [more]
sp|Q3ZBD7|G6PI_BOVIN6.518e-15773.43Glucose-6-phosphate isomerase OS=Bos taurus OX=991... [more]
sp|Q5R4E3|G6PI_PONAB9.227e-15773.08Glucose-6-phosphate isomerase OS=Pongo abelii OX=9... [more]
sp|Q4R591|G6PI_MACFA1.752e-15673.08Glucose-6-phosphate isomerase OS=Macaca fascicular... [more]
sp|Q9N1E2|G6PI_RABIT5.307e-15572.73Glucose-6-phosphate isomerase OS=Oryctolagus cunic... [more]
back to top
BLAST of Glucose-6-phosphate isomerase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H9G5328.873e-15975.79Glucose-6-phosphate isomerase OS=Anolis carolinens... [more]
A0A0R3TC041.165e-15876.14Glucose-6-phosphate isomerase OS=Rodentolepis nana... [more]
A0A0R3X1971.684e-15874.83Glucose-6-phosphate isomerase OS=Hydatigena taenia... [more]
A0A3Q0H0I96.133e-15875.09Glucose-6-phosphate isomerase OS=Alligator sinensi... [more]
A0A402ENM91.180e-15775.09Glucose-6-phosphate isomerase OS=Paroedura picta O... [more]
back to top
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gpia7.579e-15472.28glucose-6-phosphate isomerase-like [Source:NCBI ge... [more]
gpib2.070e-15070.92glucose-6-phosphate isomerase [Source:NCBI gene;Ac... [more]
gpib3.316e-15070.92glucose-6-phosphate isomerase [Source:NCBI gene;Ac... [more]
gpib3.347e-15070.92glucose-6-phosphate isomerase [Source:NCBI gene;Ac... [more]
gpia8.503e-14670.38glucose-6-phosphate isomerase-like [Source:NCBI ge... [more]
back to top
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gpib2.535e-1282.86glucose-6-phosphate isomerase b [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PGI11.574e-11257.80Glycolytic enzyme phosphoglucose isomerase; cataly... [more]
back to top
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO370391.116e-14971.53Glucose-6-phosphate isomerase [Source:UniProtKB/T... [more]
EDO277741.482e-1755.93Glucose-6-phosphate isomerase [Source:UniProtKB/T... [more]
back to top
BLAST of Glucose-6-phosphate isomerase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
gpia2.088e-15572.70glucose-6-phosphate isomerase [Source:NCBI gene;Ac... [more]
gpia7.782e-15472.70glucose-6-phosphate isomerase [Source:NCBI gene;Ac... [more]
gpib4.869e-15069.76glucose-6-phosphate isomerase [Source:NCBI gene;Ac... [more]
gpib2.016e-14970.57glucose-6-phosphate isomerase [Source:NCBI gene;Ac... [more]
back to top
BLAST of Glucose-6-phosphate isomerase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000067583.10.000e+0100.00SMESG000067583.1[more]
SMESG000067583.10.000e+0100.00SMESG000067583.1[more]
SMESG000067534.10.000e+089.90SMESG000067534.1[more]
SMESG000067534.10.000e+089.90SMESG000067534.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029370 ID=SMED30029370|Name=Glucose-6-phosphate isomerase|organism=Schmidtea mediterranea sexual|type=transcript|length=1471bp
GATTTTAAATTGATTCATTGATTATGTTTAAAAAATAATCGATAAATCAA
TGAAAAGGTAAACTGATATTCAAAATATCGATTTGAGTGATTAGAACATT
GATTTTTGAAATTCAATATAGACAGCTTATATTTTCTATCATGAAATCAA
TGAATCGATAGAAGAATATTGTTTAGGTGGTTTGCTCAAATTGAAAGTTT
TCAAAATATTTTGTTGTGCTTTCATATCAATATTTACTAAATATTGATGT
GCTAAATCATTTAAAATATATAGTATTTTATTTTATCGAACTTTGAGATT
CTGGAAAAAATACAACAGTAAACAGGTGTGAAAATTATGCAGTTAGAACA
ATTAGTTTTAAATTAAACTGCTAAACGGAGTTTTAAAAATCGATTTTAGA
CACCACCTAAATGTGGACTAATGTTAATTTATTGAATATAATTCTAAATT
GGCAAAATTATTCAATGGAAATTATTTGTTTAGTGGGTTGGTGGAAGATA
TTCACTCTGGTCTGCAATTGGACTTTCTATTGCTTTGTACATTGGAATGG
ACAATTTTGAAGAATTATTATCTGGTGGGCATGCAATGGATAACCATTTC
AAAGAAACTCCATTAGAACAAAACATTCCAGTAATAATGGCAATGTTGGG
CATCATGTACATTCATTGTTACAAAGCCGAAACGCATGCAATTCTACCAT
ACGATCAATATATGCATCGTTTCGCTGCCTATTTCCAACAAGGTGACATG
GAATCCAATGGGAAATTTATTAATCATGTGGGCAAACGCGTTCCATATCA
CACTGGACCAATCATTTGGGGTGAACCGGGAACTAATGGTCAACATGCCT
TCTATCAATTGATACACCAGGGAACGAGACTCATTCCTGCTGATTTCTTG
ATTCCTGCACAAACTCATAATCCTATCAATAATGGCTTGCATCACGAAAT
CTTGTTGTCGAATTTCTTAGCACAAACTGAGGCACTGATGCGTGGTAAAG
GTGCAGAGAAAGTTCGAGAAGAACTAGAAGCTGAAGGAATGAGTGGTGCA
GATTTAGAATTATTGTCACAGCATAAGTCATTTCCTGGAAATCGTCCTAC
GAATTCTTTCGTCTTTACAAAGATGAATCCATTTATGTTGGGCGTGTTGA
TTGCAATGTACGAGCACAAGATATTTGTACAAGGCGCTATATGGGAAATC
AATTCTTACGATCAATGGGGCGTGGAATTGGGAAAGGTTTTGGCCAAAAA
GATTCAACCTGAATTGAGTGGTGGCGAAGTGATTAAATCGCATGATTCGT
CGACCAATGGACTTATTGATTTCATCAAATCTCAAAAAAAATAACTCTTT
GATTAGAATCAATTTTCAGTTTTATTTATTGCCCTGTTAACATGAGGTAT
TTAACACAACTTTGTCTTTATTGGTTACAATTTAGTACAATTTATTTCTA
TTTATTAATAAATTTTTCCTG
back to top

protein sequence of SMED30029370-orf-1

>SMED30029370-orf-1 ID=SMED30029370-orf-1|Name=SMED30029370-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=266bp
MDNFEELLSGGHAMDNHFKETPLEQNIPVIMAMLGIMYIHCYKAETHAIL
PYDQYMHRFAAYFQQGDMESNGKFINHVGKRVPYHTGPIIWGEPGTNGQH
AFYQLIHQGTRLIPADFLIPAQTHNPINNGLHHEILLSNFLAQTEALMRG
KGAEKVREELEAEGMSGADLELLSQHKSFPGNRPTNSFVFTKMNPFMLGV
LIAMYEHKIFVQGAIWEINSYDQWGVELGKVLAKKIQPELSGGEVIKSHD
SSTNGLIDFIKSQKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0006096glycolytic process
GO:0006094gluconeogenesis
GO:0001525angiogenesis
GO:0001701in utero embryonic development
GO:0001707mesoderm formation
GO:0005975carbohydrate metabolic process
GO:0006959humoral immune response
GO:0007599hemostasis
GO:0007611learning or memory
GO:0019242methylglyoxal biosynthetic process
GO:0032355response to estradiol
GO:0032570response to progesterone
GO:0033574response to testosterone
GO:0034101erythrocyte homeostasis
GO:0035902response to immobilization stress
GO:0035994response to muscle stretch
GO:0042593glucose homeostasis
GO:0043154negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0043278response to morphine
GO:0043312neutrophil degranulation
GO:0043524negative regulation of neuron apoptotic process
GO:0046185aldehyde catabolic process
GO:0046686response to cadmium ion
GO:0051156glucose 6-phosphate metabolic process
GO:0061621canonical glycolysis
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR035482SIS_PGI_2
IPR001672G6P_Isomerase
IPR023096G6P_Isomerase_C
IPR018189Phosphoglucose_isomerase_CS
Vocabulary: molecular function
TermDefinition
GO:0004347glucose-6-phosphate isomerase activity
GO:0005125cytokine activity
GO:0008083growth factor activity
GO:0016853isomerase activity
GO:0016866intramolecular transferase activity
GO:0031625ubiquitin protein ligase binding
GO:0048029monosaccharide binding
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005615extracellular space
GO:0005654nucleoplasm
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005886plasma membrane
GO:0016020membrane
GO:0034774secretory granule lumen
GO:0043005neuron projection
GO:0043209myelin sheath
GO:0060170ciliary membrane
GO:0070062extracellular exosome
GO:1904813ficolin-1-rich granule lumen
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001672Phosphoglucose isomerase (PGI)PRINTSPR00662G6PISOMERASEcoord: 52..73
score: 61.36
coord: 213..226
score: 68.97
coord: 181..199
score: 40.02
coord: 199..213
score: 62.07
IPR001672Phosphoglucose isomerase (PGI)PFAMPF00342PGIcoord: 2..257
e-value: 1.2E-119
score: 400.1
IPR001672Phosphoglucose isomerase (PGI)PANTHERPTHR11469GLUCOSE-6-PHOSPHATE ISOMERASEcoord: 1..264
IPR001672Phosphoglucose isomerase (PGI)PROSITEPS51463P_GLUCOSE_ISOMERASE_3coord: 1..263
score: 72.296
NoneNo IPR availableGENE3DG3DSA:3.40.50.10490coord: 2..222
e-value: 1.6E-109
score: 367.8
NoneNo IPR availablePANTHERPTHR11469:SF4GLUCOSE-6-PHOSPHATE ISOMERASEcoord: 1..264
NoneNo IPR availableSUPERFAMILYSSF53697SIS domaincoord: 1..263
IPR023096Phosphoglucose isomerase, C-terminalGENE3DG3DSA:1.10.1390.10coord: 223..265
e-value: 1.1E-20
score: 75.6
IPR018189Phosphoglucose isomerase, conserved sitePROSITEPS00174P_GLUCOSE_ISOMERASE_2coord: 213..230
IPR035482Phosphoglucose isomerase, SIS domain 2CDDcd05016SIS_PGI_2coord: 45..236
e-value: 7.21693E-88
score: 256.372