SMED30029356

Overview
NameSMED30029356
Smed IDSMED30029356
Length (bp)591
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30029356 (SMED30029356) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30029356 (SMED30029356) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30029356 (SMED30029356) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30029356 (SMED30029356) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029356

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30029356h1SMcG0006698 SmedASXL_016048SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30029356h1SMcG0006698 SmedASXL_016047SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30029356h1SMcG0006698 dd_Smed_v4_14782_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30029356h1SMcG0006698 dd_Smed_v4_14782_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30029356h1SMcG0006698 dd_Smed_v6_14782_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30029356 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.006495:2298..7782 +2916
Homology
BLAST of SMED30029356 vs. Ensembl Human
Match: TRIM71 (tripartite motif containing 71 [Source:HGNC Symbol;Acc:HGNC:32669])

HSP 1 Score: 105.531 bits (262), Expect = 7.737e-26
Identity = 52/149 (34.90%), Postives = 84/149 (56.38%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            G+++DK   II +DR ++R+ +    G    + G   +   +   P G+A D+ + I + DKDNHRIQ+F+  G+++ + G  G + G F+ P  +AV  + K I VSDT NHRIQ+F   G +L  +  +G    H   PRG+  ++E
Sbjct:  611 GVSVDKEGYIIVADRSNNRIQVFKPCGAFHHKFGTLGSRPGQFDRPAGVACDASRRIVVADKDNHRIQIFTFEGQFLLKFGEKGTKNGQFNYPWDVAVNSEGK-ILVSDTRNHRIQLFGPDGVFLNKYGFEGALWKHFDSPRGVAFNHE 758          

HSP 2 Score: 93.9745 bits (232), Expect = 6.980e-22
Identity = 45/155 (29.03%), Postives = 80/155 (51.61%), Query Frame = 3
Query:  126 KFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            +FD  +G+A D ++RI+ +D+ +HR+ I   +G+ + + G+      + +YPW +A +S   I + D  NHRIQ+F  +G ++ + G  G     FD+P  +A      ++ V+D +NHR+ V             +G        P+G+ VD E
Sbjct:  652 QFDRPAGVACDASRRIVVADKDNHRIQIFTFEGQFLLKFGEKGTKNGQFNYPWDVAVNSEGKILVSDTRNHRIQLFGPDGVFLNKYGFEGALWKHFDSPRGVAF-NHEGHLVVTDFNNHRLLVIHPDCQSARFLGSEGTGNGQFLRPQGVAVDQE 805          

HSP 3 Score: 86.6557 bits (213), Expect = 2.761e-19
Identity = 41/116 (35.34%), Postives = 60/116 (51.72%), Query Frame = 3
Query:  243 GKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            G   ++  KL  PWG++ D    I + D+ N+RIQVF   G +  + G  G + G FD P  +A C  ++ I V+D  NHRIQ+F   G +L  F   G       YP  + V++E
Sbjct:  597 GSEGDSDGKLCRPWGVSVDKEGYIIVADRSNNRIQVFKPCGAFHHKFGTLGSRPGQFDRPAGVA-CDASRRIVVADKDNHRIQIFTFEGQFLLKFGEKGTKNGQFNYPWDVAVNSE 711          

HSP 4 Score: 74.7146 bits (182), Expect = 2.864e-15
Identity = 38/123 (30.89%), Postives = 61/123 (49.59%), Query Frame = 3
Query:  129 FDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVF 497
            FD   G+A +    ++ +D  +HR+ ++  D +    +G       +   P G+A D    I + D  NHR+Q+F +NG ++ + GA G   G  D P  +A+ P    I V D  N+RI VF
Sbjct:  747 FDSPRGVAFNHEGHLVVTDFNNHRLLVIHPDCQSARFLGSEGTGNGQFLRPQGVAVDQEGRIIVADSRNHRVQMFESNGSFLCKFGAQGSGFGQMDRPSGIAITPDGM-IVVVDFGNNRILVF 868          
BLAST of SMED30029356 vs. Ensembl Human
Match: TRIM3 (tripartite motif containing 3 [Source:HGNC Symbol;Acc:HGNC:10064])

HSP 1 Score: 83.5741 bits (205), Expect = 2.826e-18
Identity = 44/129 (34.11%), Postives = 69/129 (53.49%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFN 530
            G+A+D+N  II  D     V     +GKL+   G         + P  +A +++  I + D  NH ++V+S +GE++ + G+HG+  G F+ P  +AV     NI V+D  N RIQVFD  G++L   N
Sbjct:  461 GVAVDRNGHIIVVDNKSCCVFTFQPNGKLVGRFGGRGATDRHFAGPHFVAVNNKNEIVVTDFHNHSVKVYSADGEFLFKFGSHGEGNGQFNAPTGVAV-DSNGNIIVADWGNSRIQVFDSSGSFLSYIN 588          

HSP 2 Score: 78.5666 bits (192), Expect = 1.341e-16
Identity = 45/149 (30.20%), Postives = 72/149 (48.32%), Query Frame = 3
Query:  141 SGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDN 587
            +G+A+D N  II +D  +  V+I   +GK   +IG       +L  P G+A D   +I + D  +  +  F  NG+ +   G  G     F  PH++AV  K + I V+D  NH ++V+   G +L+ F   G        P G+ VD+
Sbjct:  418 TGVAVDTNGDIIVADYDNRWVSIFSPEGKFKTKIGA-----GRLMGPKGVAVDRNGHIIVVDNKSCCVFTFQPNGKLVGRFGGRGATDRHFAGPHFVAVNNKNE-IVVTDFHNHSVKVYSADGEFLFKFGSHGEGNGQFNAPTGVAVDS 560          

HSP 3 Score: 61.6178 bits (148), Expect = 8.760e-11
Identity = 31/117 (26.50%), Postives = 57/117 (48.72%), Query Frame = 3
Query:  147 IAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVF 497
            +A++    I+ +D ++H V +   DG+ + + G       + + P G+A DS  NI + D  N RIQVF ++G ++  I    +       P  LA+     ++ V+D  NH  + +
Sbjct:  509 VAVNNKNEIVVTDFHNHSVKVYSADGEFLFKFGSHGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDSSGSFLSYINTSAEP---LYGPQGLALT-SDGHVVVADAGNHCFKAY 621          

HSP 4 Score: 55.8398 bits (133), Expect = 9.110e-9
Identity = 35/123 (28.46%), Postives = 56/123 (45.53%), Query Frame = 3
Query:  216 IDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVD 584
            I+ +L+  +G     K + +   G++  S   I + D +N  IQVFSN G++    G  G+  G    P  +AV     +I V+D  N  + +F   G +     G G     L  P+G+ VD
Sbjct:  349 IEDELVFRVGSRGREKGEFTNLQGVSAASSGRIVVADSNNQCIQVFSNEGQFKFRFGVRGRSPGQLQRPTGVAV-DTNGDIIVADYDNRWVSIFSPEGKFKTKI-GAG----RLMGPKGVAVD 465          
BLAST of SMED30029356 vs. Ensembl Human
Match: TRIM3 (tripartite motif containing 3 [Source:HGNC Symbol;Acc:HGNC:10064])

HSP 1 Score: 83.5741 bits (205), Expect = 2.909e-18
Identity = 44/129 (34.11%), Postives = 69/129 (53.49%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFN 530
            G+A+D+N  II  D     V     +GKL+   G         + P  +A +++  I + D  NH ++V+S +GE++ + G+HG+  G F+ P  +AV     NI V+D  N RIQVFD  G++L   N
Sbjct:  539 GVAVDRNGHIIVVDNKSCCVFTFQPNGKLVGRFGGRGATDRHFAGPHFVAVNNKNEIVVTDFHNHSVKVYSADGEFLFKFGSHGEGNGQFNAPTGVAV-DSNGNIIVADWGNSRIQVFDSSGSFLSYIN 666          

HSP 2 Score: 78.5666 bits (192), Expect = 1.379e-16
Identity = 45/149 (30.20%), Postives = 72/149 (48.32%), Query Frame = 3
Query:  141 SGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDN 587
            +G+A+D N  II +D  +  V+I   +GK   +IG       +L  P G+A D   +I + D  +  +  F  NG+ +   G  G     F  PH++AV  K + I V+D  NH ++V+   G +L+ F   G        P G+ VD+
Sbjct:  496 TGVAVDTNGDIIVADYDNRWVSIFSPEGKFKTKIGA-----GRLMGPKGVAVDRNGHIIVVDNKSCCVFTFQPNGKLVGRFGGRGATDRHFAGPHFVAVNNKNE-IVVTDFHNHSVKVYSADGEFLFKFGSHGEGNGQFNAPTGVAVDS 638          

HSP 3 Score: 61.6178 bits (148), Expect = 8.997e-11
Identity = 31/117 (26.50%), Postives = 57/117 (48.72%), Query Frame = 3
Query:  147 IAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVF 497
            +A++    I+ +D ++H V +   DG+ + + G       + + P G+A DS  NI + D  N RIQVF ++G ++  I    +       P  LA+     ++ V+D  NH  + +
Sbjct:  587 VAVNNKNEIVVTDFHNHSVKVYSADGEFLFKFGSHGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDSSGSFLSYINTSAEP---LYGPQGLALT-SDGHVVVADAGNHCFKAY 699          

HSP 4 Score: 55.8398 bits (133), Expect = 9.347e-9
Identity = 35/123 (28.46%), Postives = 56/123 (45.53%), Query Frame = 3
Query:  216 IDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVD 584
            I+ +L+  +G     K + +   G++  S   I + D +N  IQVFSN G++    G  G+  G    P  +AV     +I V+D  N  + +F   G +     G G     L  P+G+ VD
Sbjct:  427 IEDELVFRVGSRGREKGEFTNLQGVSAASSGRIVVADSNNQCIQVFSNEGQFKFRFGVRGRSPGQLQRPTGVAV-DTNGDIIVADYDNRWVSIFSPEGKFKTKI-GAG----RLMGPKGVAVD 543          
BLAST of SMED30029356 vs. Ensembl Human
Match: TRIM3 (tripartite motif containing 3 [Source:HGNC Symbol;Acc:HGNC:10064])

HSP 1 Score: 83.5741 bits (205), Expect = 2.945e-18
Identity = 44/129 (34.11%), Postives = 69/129 (53.49%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFN 530
            G+A+D+N  II  D     V     +GKL+   G         + P  +A +++  I + D  NH ++V+S +GE++ + G+HG+  G F+ P  +AV     NI V+D  N RIQVFD  G++L   N
Sbjct:  580 GVAVDRNGHIIVVDNKSCCVFTFQPNGKLVGRFGGRGATDRHFAGPHFVAVNNKNEIVVTDFHNHSVKVYSADGEFLFKFGSHGEGNGQFNAPTGVAV-DSNGNIIVADWGNSRIQVFDSSGSFLSYIN 707          

HSP 2 Score: 78.5666 bits (192), Expect = 1.396e-16
Identity = 45/149 (30.20%), Postives = 72/149 (48.32%), Query Frame = 3
Query:  141 SGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDN 587
            +G+A+D N  II +D  +  V+I   +GK   +IG       +L  P G+A D   +I + D  +  +  F  NG+ +   G  G     F  PH++AV  K + I V+D  NH ++V+   G +L+ F   G        P G+ VD+
Sbjct:  537 TGVAVDTNGDIIVADYDNRWVSIFSPEGKFKTKIGA-----GRLMGPKGVAVDRNGHIIVVDNKSCCVFTFQPNGKLVGRFGGRGATDRHFAGPHFVAVNNKNE-IVVTDFHNHSVKVYSADGEFLFKFGSHGEGNGQFNAPTGVAVDS 679          

HSP 3 Score: 61.6178 bits (148), Expect = 9.101e-11
Identity = 31/117 (26.50%), Postives = 57/117 (48.72%), Query Frame = 3
Query:  147 IAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVF 497
            +A++    I+ +D ++H V +   DG+ + + G       + + P G+A DS  NI + D  N RIQVF ++G ++  I    +       P  LA+     ++ V+D  NH  + +
Sbjct:  628 VAVNNKNEIVVTDFHNHSVKVYSADGEFLFKFGSHGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDSSGSFLSYINTSAEP---LYGPQGLALT-SDGHVVVADAGNHCFKAY 740          

HSP 4 Score: 55.8398 bits (133), Expect = 9.452e-9
Identity = 35/123 (28.46%), Postives = 56/123 (45.53%), Query Frame = 3
Query:  216 IDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVD 584
            I+ +L+  +G     K + +   G++  S   I + D +N  IQVFSN G++    G  G+  G    P  +AV     +I V+D  N  + +F   G +     G G     L  P+G+ VD
Sbjct:  468 IEDELVFRVGSRGREKGEFTNLQGVSAASSGRIVVADSNNQCIQVFSNEGQFKFRFGVRGRSPGQLQRPTGVAV-DTNGDIIVADYDNRWVSIFSPEGKFKTKI-GAG----RLMGPKGVAVD 584          
BLAST of SMED30029356 vs. Ensembl Human
Match: TRIM3 (tripartite motif containing 3 [Source:HGNC Symbol;Acc:HGNC:10064])

HSP 1 Score: 83.5741 bits (205), Expect = 2.945e-18
Identity = 44/129 (34.11%), Postives = 69/129 (53.49%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFN 530
            G+A+D+N  II  D     V     +GKL+   G         + P  +A +++  I + D  NH ++V+S +GE++ + G+HG+  G F+ P  +AV     NI V+D  N RIQVFD  G++L   N
Sbjct:  580 GVAVDRNGHIIVVDNKSCCVFTFQPNGKLVGRFGGRGATDRHFAGPHFVAVNNKNEIVVTDFHNHSVKVYSADGEFLFKFGSHGEGNGQFNAPTGVAV-DSNGNIIVADWGNSRIQVFDSSGSFLSYIN 707          

HSP 2 Score: 78.5666 bits (192), Expect = 1.396e-16
Identity = 45/149 (30.20%), Postives = 72/149 (48.32%), Query Frame = 3
Query:  141 SGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDN 587
            +G+A+D N  II +D  +  V+I   +GK   +IG       +L  P G+A D   +I + D  +  +  F  NG+ +   G  G     F  PH++AV  K + I V+D  NH ++V+   G +L+ F   G        P G+ VD+
Sbjct:  537 TGVAVDTNGDIIVADYDNRWVSIFSPEGKFKTKIGA-----GRLMGPKGVAVDRNGHIIVVDNKSCCVFTFQPNGKLVGRFGGRGATDRHFAGPHFVAVNNKNE-IVVTDFHNHSVKVYSADGEFLFKFGSHGEGNGQFNAPTGVAVDS 679          

HSP 3 Score: 61.6178 bits (148), Expect = 9.101e-11
Identity = 31/117 (26.50%), Postives = 57/117 (48.72%), Query Frame = 3
Query:  147 IAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVF 497
            +A++    I+ +D ++H V +   DG+ + + G       + + P G+A DS  NI + D  N RIQVF ++G ++  I    +       P  LA+     ++ V+D  NH  + +
Sbjct:  628 VAVNNKNEIVVTDFHNHSVKVYSADGEFLFKFGSHGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDSSGSFLSYINTSAEP---LYGPQGLALT-SDGHVVVADAGNHCFKAY 740          

HSP 4 Score: 55.8398 bits (133), Expect = 9.452e-9
Identity = 35/123 (28.46%), Postives = 56/123 (45.53%), Query Frame = 3
Query:  216 IDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVD 584
            I+ +L+  +G     K + +   G++  S   I + D +N  IQVFSN G++    G  G+  G    P  +AV     +I V+D  N  + +F   G +     G G     L  P+G+ VD
Sbjct:  468 IEDELVFRVGSRGREKGEFTNLQGVSAASSGRIVVADSNNQCIQVFSNEGQFKFRFGVRGRSPGQLQRPTGVAV-DTNGDIIVADYDNRWVSIFSPEGKFKTKI-GAG----RLMGPKGVAVD 584          
BLAST of SMED30029356 vs. Ensembl Celegans
Match: nhl-1 (RING finger protein nhl-1 [Source:UniProtKB/Swiss-Prot;Acc:Q03601])

HSP 1 Score: 146.362 bits (368), Expect = 1.457e-40
Identity = 64/155 (41.29%), Postives = 100/155 (64.52%), Query Frame = 3
Query:  126 KFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            + D  +G+A  K  R+I SDRY+HR+++  ++G  +   G      AK + PWG+A D   +I++ DKDNHR+QVF  NG++I + G+ G   G  ++P ++AV   T +++VSD+SNHRI VFD HG +L+SF  +G      K+PRGI +D++
Sbjct:  758 QLDSAAGLASSK-LRVIVSDRYNHRISVFGLEGDHLFSFGGHGQGNAKFNNPWGVAVDDLGSIYVADKDNHRVQVFDKNGQFIAKFGSFGHLPGQLNSPLFIAVSRVTHHVYVSDSSNHRISVFDPHGVHLFSFGEEGFHGGQFKFPRGIAIDSQ 911          

HSP 2 Score: 83.5741 bits (205), Expect = 9.540e-19
Identity = 47/146 (32.19%), Postives = 77/146 (52.74%), Query Frame = 3
Query:  126 KFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDS-RQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLK 560
            KF+   G+A+D    I  +D+ +HRV + D +G+ I + G   +   +L+ P  IA      ++++ D  NHRI VF  +G ++   G  G   G F  P  +A+    +N+ ++D+ N+RIQVFD  G ++ SF   G     LK
Sbjct:  804 KFNNPWGVAVDDLGSIYVADKDNHRVQVFDKNGQFIAKFGSFGHLPGQLNSPLFIAVSRVTHHVYVSDSSNHRISVFDPHGVHLFSFGEEGFHGGQFKFPRGIAI-DSQENLIIADSGNNRIQVFDAQGQFVSSFGTWGGGAGQLK 948          

HSP 3 Score: 77.0258 bits (188), Expect = 2.049e-16
Identity = 39/115 (33.91%), Postives = 58/115 (50.43%), Query Frame = 3
Query:  243 GKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDN 587
            G+      +L++P GI   S   +  CD  NHR+ VF  +G+++++ G +G   G  D+   LA       + VSD  NHRI VF   G +L+SF G G        P G+ VD+
Sbjct:  703 GRKGAKDGELNWPRGICALSGGLVATCDSSNHRVCVFDKDGKFVRQFGGYGAGAGQLDSAAGLA--SSKLRVIVSDRYNHRISVFGLEGDHLFSFGGHGQGNAKFNNPWGVAVDD 815          

HSP 4 Score: 72.7886 bits (177), Expect = 5.967e-15
Identity = 38/118 (32.20%), Postives = 61/118 (51.69%), Query Frame = 3
Query:  147 IAIDK-NKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVF 497
            IA+ +    +  SD  +HR+++ D  G  +   G+   +  +  +P GIA DS++N+ I D  N+RIQVF   G+++   G  G   G       + V     +I V+D  NHRIQ+F
Sbjct:  858 IAVSRVTHHVYVSDSSNHRISVFDPHGVHLFSFGEEGFHGGQFKFPRGIAIDSQENLIIADSGNNRIQVFDAQGQFVSSFGTWGGGAGQLKGVEDVCVTAD-GSIVVTDRENHRIQIF 974          

HSP 5 Score: 46.9802 bits (110), Expect = 3.406e-6
Identity = 23/78 (29.49%), Postives = 40/78 (51.28%), Query Frame = 3
Query:  120 QLKFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVF 353
            Q KF    GIAID  + +I +D  ++R+ + D  G+ +   G       +L     +   +  +I + D++NHRIQ+F
Sbjct:  899 QFKFP--RGIAIDSQENLIIADSGNNRIQVFDAQGQFVSSFGTWGGGAGQLKGVEDVCVTADGSIVVTDRENHRIQIF 974          
BLAST of SMED30029356 vs. Ensembl Celegans
Match: nhl-1 (RING finger protein nhl-1 [Source:UniProtKB/Swiss-Prot;Acc:Q03601])

HSP 1 Score: 145.976 bits (367), Expect = 2.370e-40
Identity = 64/155 (41.29%), Postives = 100/155 (64.52%), Query Frame = 3
Query:  126 KFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            + D  +G+A  K  R+I SDRY+HR+++  ++G  +   G      AK + PWG+A D   +I++ DKDNHR+QVF  NG++I + G+ G   G  ++P ++AV   T +++VSD+SNHRI VFD HG +L+SF  +G      K+PRGI +D++
Sbjct:  708 QLDSAAGLASSK-LRVIVSDRYNHRISVFGLEGDHLFSFGGHGQGNAKFNNPWGVAVDDLGSIYVADKDNHRVQVFDKNGQFIAKFGSFGHLPGQLNSPLFIAVSRVTHHVYVSDSSNHRISVFDPHGVHLFSFGEEGFHGGQFKFPRGIAIDSQ 861          

HSP 2 Score: 83.1889 bits (204), Expect = 1.349e-18
Identity = 47/146 (32.19%), Postives = 77/146 (52.74%), Query Frame = 3
Query:  126 KFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDS-RQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLK 560
            KF+   G+A+D    I  +D+ +HRV + D +G+ I + G   +   +L+ P  IA      ++++ D  NHRI VF  +G ++   G  G   G F  P  +A+    +N+ ++D+ N+RIQVFD  G ++ SF   G     LK
Sbjct:  754 KFNNPWGVAVDDLGSIYVADKDNHRVQVFDKNGQFIAKFGSFGHLPGQLNSPLFIAVSRVTHHVYVSDSSNHRISVFDPHGVHLFSFGEEGFHGGQFKFPRGIAI-DSQENLIIADSGNNRIQVFDAQGQFVSSFGTWGGGAGQLK 898          

HSP 3 Score: 76.6406 bits (187), Expect = 2.894e-16
Identity = 39/115 (33.91%), Postives = 58/115 (50.43%), Query Frame = 3
Query:  243 GKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDN 587
            G+      +L++P GI   S   +  CD  NHR+ VF  +G+++++ G +G   G  D+   LA       + VSD  NHRI VF   G +L+SF G G        P G+ VD+
Sbjct:  653 GRKGAKDGELNWPRGICALSGGLVATCDSSNHRVCVFDKDGKFVRQFGGYGAGAGQLDSAAGLA--SSKLRVIVSDRYNHRISVFGLEGDHLFSFGGHGQGNAKFNNPWGVAVDD 765          

HSP 4 Score: 72.4034 bits (176), Expect = 8.032e-15
Identity = 38/118 (32.20%), Postives = 61/118 (51.69%), Query Frame = 3
Query:  147 IAIDK-NKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVF 497
            IA+ +    +  SD  +HR+++ D  G  +   G+   +  +  +P GIA DS++N+ I D  N+RIQVF   G+++   G  G   G       + V     +I V+D  NHRIQ+F
Sbjct:  808 IAVSRVTHHVYVSDSSNHRISVFDPHGVHLFSFGEEGFHGGQFKFPRGIAIDSQENLIIADSGNNRIQVFDAQGQFVSSFGTWGGGAGQLKGVEDVCVTAD-GSIVVTDRENHRIQIF 924          

HSP 5 Score: 46.9802 bits (110), Expect = 4.038e-6
Identity = 23/78 (29.49%), Postives = 40/78 (51.28%), Query Frame = 3
Query:  120 QLKFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVF 353
            Q KF    GIAID  + +I +D  ++R+ + D  G+ +   G       +L     +   +  +I + D++NHRIQ+F
Sbjct:  849 QFKFP--RGIAIDSQENLIIADSGNNRIQVFDAQGQFVSSFGTWGGGAGQLKGVEDVCVTADGSIVVTDRENHRIQIF 924          
BLAST of SMED30029356 vs. Ensembl Celegans
Match: lin-41 (pep chromosome:WBcel235:I:9335965:9342443:-1 gene:WBGene00003026.1 transcript:C12C8.3b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-41)

HSP 1 Score: 112.464 bits (280), Expect = 1.234e-28
Identity = 59/146 (40.41%), Postives = 82/146 (56.16%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKN-IFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKF-HLKYPRGI 575
            GI +D+  R+I +DR ++RV I D DG  I + G S N   +   P GI T+S  NI + DKDNHR+QVF  NG ++ + G  G+  G F+ P    V   + N I VSDT NHR+Q+F   G ++     D    F +L  PRG+
Sbjct:  846 GICVDQRGRVIVADRSNNRVQIFDKDGNFISKFGTSGNRPGQFDRPAGITTNSLNNIVVADKDNHRVQVFDENGMFLLKFGDRGRAVGYFNYP--WGVATNSHNAIAVSDTRNHRVQIFTPQGQFVRKCGFDSAYFFKNLDSPRGL 989          

HSP 2 Score: 93.2041 bits (230), Expect = 5.538e-22
Identity = 41/119 (34.45%), Postives = 63/119 (52.94%), Query Frame = 3
Query:  231 ICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDN 587
            I   GK  +   +L  PWGI  D R  + + D+ N+R+Q+F  +G +I + G  G + G FD P  +       NI V+D  NHR+QVFD++G +L  F   G    +  YP G+  ++
Sbjct:  828 ILTFGKEGSGDGELCRPWGICVDQRGRVIVADRSNNRVQIFDKDGNFISKFGTSGNRPGQFDRPAGITT-NSLNNIVVADKDNHRVQVFDENGMFLLKFGDRGRAVGYFNYPWGVATNS 945          

HSP 3 Score: 87.8113 bits (216), Expect = 3.710e-20
Identity = 49/167 (29.34%), Postives = 83/167 (49.70%), Query Frame = 3
Query:  102 GTDDNVQLKFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQ-CGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTY---LYSFNGDGPTKFHLKYPRGITVDNE 590
            GT  N   +FD  +GI  +    I+ +D+ +HRV + D +G  + + G         +YPWG+AT+S   I + D  NHR+Q+F+  G+++++ G          D+P  L   P  + + ++D +NHR+ V          +Y   GDG   F    P+G+ +D E
Sbjct:  879 GTSGNRPGQFDRPAGITTNSLNNIVVADKDNHRVQVFDENGMFLLKFGDRGRAVGYFNYPWGVATNSHNAIAVSDTRNHRVQIFTPQGQFVRKCGFDSAYFFKNLDSPRGLCYLPDGQ-LLITDFNNHRLAVLSPRNMSEMKVYGSEGDGDGMF--VRPQGVVIDPE 1042          
BLAST of SMED30029356 vs. Ensembl Celegans
Match: lin-41 (pep chromosome:WBcel235:I:9334812:9342496:-1 gene:WBGene00003026.1 transcript:C12C8.3b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-41)

HSP 1 Score: 112.464 bits (280), Expect = 1.234e-28
Identity = 59/146 (40.41%), Postives = 82/146 (56.16%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKN-IFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKF-HLKYPRGI 575
            GI +D+  R+I +DR ++RV I D DG  I + G S N   +   P GI T+S  NI + DKDNHR+QVF  NG ++ + G  G+  G F+ P    V   + N I VSDT NHR+Q+F   G ++     D    F +L  PRG+
Sbjct:  846 GICVDQRGRVIVADRSNNRVQIFDKDGNFISKFGTSGNRPGQFDRPAGITTNSLNNIVVADKDNHRVQVFDENGMFLLKFGDRGRAVGYFNYP--WGVATNSHNAIAVSDTRNHRVQIFTPQGQFVRKCGFDSAYFFKNLDSPRGL 989          

HSP 2 Score: 93.2041 bits (230), Expect = 5.538e-22
Identity = 41/119 (34.45%), Postives = 63/119 (52.94%), Query Frame = 3
Query:  231 ICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDN 587
            I   GK  +   +L  PWGI  D R  + + D+ N+R+Q+F  +G +I + G  G + G FD P  +       NI V+D  NHR+QVFD++G +L  F   G    +  YP G+  ++
Sbjct:  828 ILTFGKEGSGDGELCRPWGICVDQRGRVIVADRSNNRVQIFDKDGNFISKFGTSGNRPGQFDRPAGITT-NSLNNIVVADKDNHRVQVFDENGMFLLKFGDRGRAVGYFNYPWGVATNS 945          

HSP 3 Score: 87.8113 bits (216), Expect = 3.710e-20
Identity = 49/167 (29.34%), Postives = 83/167 (49.70%), Query Frame = 3
Query:  102 GTDDNVQLKFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQ-CGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTY---LYSFNGDGPTKFHLKYPRGITVDNE 590
            GT  N   +FD  +GI  +    I+ +D+ +HRV + D +G  + + G         +YPWG+AT+S   I + D  NHR+Q+F+  G+++++ G          D+P  L   P  + + ++D +NHR+ V          +Y   GDG   F    P+G+ +D E
Sbjct:  879 GTSGNRPGQFDRPAGITTNSLNNIVVADKDNHRVQVFDENGMFLLKFGDRGRAVGYFNYPWGVATNSHNAIAVSDTRNHRVQIFTPQGQFVRKCGFDSAYFFKNLDSPRGLCYLPDGQ-LLITDFNNHRLAVLSPRNMSEMKVYGSEGDGDGMF--VRPQGVVIDPE 1042          
BLAST of SMED30029356 vs. Ensembl Celegans
Match: lin-41 (pep chromosome:WBcel235:I:9335965:9342443:-1 gene:WBGene00003026.1 transcript:C12C8.3a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-41)

HSP 1 Score: 112.464 bits (280), Expect = 1.235e-28
Identity = 59/146 (40.41%), Postives = 82/146 (56.16%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKN-IFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKF-HLKYPRGI 575
            GI +D+  R+I +DR ++RV I D DG  I + G S N   +   P GI T+S  NI + DKDNHR+QVF  NG ++ + G  G+  G F+ P    V   + N I VSDT NHR+Q+F   G ++     D    F +L  PRG+
Sbjct:  850 GICVDQRGRVIVADRSNNRVQIFDKDGNFISKFGTSGNRPGQFDRPAGITTNSLNNIVVADKDNHRVQVFDENGMFLLKFGDRGRAVGYFNYP--WGVATNSHNAIAVSDTRNHRVQIFTPQGQFVRKCGFDSAYFFKNLDSPRGL 993          

HSP 2 Score: 93.2041 bits (230), Expect = 5.594e-22
Identity = 41/119 (34.45%), Postives = 63/119 (52.94%), Query Frame = 3
Query:  231 ICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDN 587
            I   GK  +   +L  PWGI  D R  + + D+ N+R+Q+F  +G +I + G  G + G FD P  +       NI V+D  NHR+QVFD++G +L  F   G    +  YP G+  ++
Sbjct:  832 ILTFGKEGSGDGELCRPWGICVDQRGRVIVADRSNNRVQIFDKDGNFISKFGTSGNRPGQFDRPAGITT-NSLNNIVVADKDNHRVQVFDENGMFLLKFGDRGRAVGYFNYPWGVATNS 949          

HSP 3 Score: 87.8113 bits (216), Expect = 3.711e-20
Identity = 49/167 (29.34%), Postives = 83/167 (49.70%), Query Frame = 3
Query:  102 GTDDNVQLKFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQ-CGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTY---LYSFNGDGPTKFHLKYPRGITVDNE 590
            GT  N   +FD  +GI  +    I+ +D+ +HRV + D +G  + + G         +YPWG+AT+S   I + D  NHR+Q+F+  G+++++ G          D+P  L   P  + + ++D +NHR+ V          +Y   GDG   F    P+G+ +D E
Sbjct:  883 GTSGNRPGQFDRPAGITTNSLNNIVVADKDNHRVQVFDENGMFLLKFGDRGRAVGYFNYPWGVATNSHNAIAVSDTRNHRVQIFTPQGQFVRKCGFDSAYFFKNLDSPRGLCYLPDGQ-LLITDFNNHRLAVLSPRNMSEMKVYGSEGDGDGMF--VRPQGVVIDPE 1046          
BLAST of SMED30029356 vs. Ensembl Fly
Match: tn (gene:FBgn0265356 transcript:FBtr0114622)

HSP 1 Score: 150.984 bits (380), Expect = 4.662e-42
Identity = 64/163 (39.26%), Postives = 107/163 (65.64%), Query Frame = 3
Query:  102 GTDDNVQLKFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            G   N + +FDCL+G+A+++  + I +DRY+HR+ ++D  G+ +   G       K +YPWG+ TD+   I++CDK+NHR+QVF ++G ++ + G+ G+  G  ++PHY+AV   T  + VSD++NHRIQ+FD +G  L +  G+G      K+PRG+ VD++
Sbjct: 1293 GEYGNGEGEFDCLAGVAVNRIGQYIIADRYNHRIQVLDPQGRFLRAFGSQGTADGKFNYPWGVTTDALGFIYVCDKENHRVQVFQSDGSFVGKFGSCGRGEGQLEHPHYIAV-SNTNRVIVSDSNNHRIQIFDVNGKVLSTVGGEGSDDGQFKFPRGVAVDDQ 1454          

HSP 2 Score: 88.1965 bits (217), Expect = 4.046e-20
Identity = 41/117 (35.04%), Postives = 67/117 (57.26%), Query Frame = 3
Query:  147 IAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVF 497
            IA+    R+I SD  +HR+ I D++GK++  +G   ++  +  +P G+A D +  IF+ D  N+RIQ+F+ +G ++K  G+ G     F     +A+     NI V D  NHR+QVF
Sbjct: 1402 IAVSNTNRVIVSDSNNHRIQIFDVNGKVLSTVGGEGSDDGQFKFPRGVAVDDQGYIFVADSGNNRIQIFNPDGSFLKTFGSWGSGDSEFKGLEGVAIM-SNGNILVCDRENHRVQVF 1517          

HSP 3 Score: 80.4925 bits (197), Expect = 1.727e-17
Identity = 40/116 (34.48%), Postives = 60/116 (51.72%), Query Frame = 3
Query:  237 EIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVD 584
            ++G   +     ++P G+A     +I + D  NHR+QVF +NG ++KE G +G   G FD    +AV  +     ++D  NHRIQV D  G +L +F   G       YP G+T D
Sbjct: 1244 QLGGRGSEPGSFTWPRGLAVGPDNSIVVADSSNHRVQVFDSNGIFVKEFGEYGNGEGEFDCLAGVAV-NRIGQYIIADRYNHRIQVLDPQGRFLRAFGSQGTADGKFNYPWGVTTD 1358          

HSP 4 Score: 55.4546 bits (132), Expect = 7.447e-9
Identity = 29/85 (34.12%), Postives = 47/85 (55.29%), Query Frame = 3
Query:   99 QGTDDNVQLKFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVF 353
            +G+DD  Q KF    G+A+D    I  +D  ++R+ I + DG  +   G   +  ++     G+A  S  NI +CD++NHR+QVF
Sbjct: 1436 EGSDDG-QFKFP--RGVAVDDQGYIFVADSGNNRIQIFNPDGSFLKTFGSWGSGDSEFKGLEGVAIMSNGNILVCDRENHRVQVF 1517          

HSP 5 Score: 50.0618 bits (118), Expect = 4.948e-7
Identity = 27/69 (39.13%), Postives = 41/69 (59.42%), Query Frame = 3
Query:  345 QVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSF----NGDG 539
            QV+    + + ++G  G + G F  P  LAV P   +I V+D+SNHR+QVFD +G ++  F    NG+G
Sbjct: 1233 QVYLRKRQQLFQLGGRGSEPGSFTWPRGLAVGPDN-SIVVADSSNHRVQVFDSNGIFVKEFGEYGNGEG 1300          
BLAST of SMED30029356 vs. Ensembl Fly
Match: tn (gene:FBgn0265356 transcript:FBtr0086573)

HSP 1 Score: 150.599 bits (379), Expect = 7.691e-42
Identity = 64/163 (39.26%), Postives = 107/163 (65.64%), Query Frame = 3
Query:  102 GTDDNVQLKFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            G   N + +FDCL+G+A+++  + I +DRY+HR+ ++D  G+ +   G       K +YPWG+ TD+   I++CDK+NHR+QVF ++G ++ + G+ G+  G  ++PHY+AV   T  + VSD++NHRIQ+FD +G  L +  G+G      K+PRG+ VD++
Sbjct: 1129 GEYGNGEGEFDCLAGVAVNRIGQYIIADRYNHRIQVLDPQGRFLRAFGSQGTADGKFNYPWGVTTDALGFIYVCDKENHRVQVFQSDGSFVGKFGSCGRGEGQLEHPHYIAV-SNTNRVIVSDSNNHRIQIFDVNGKVLSTVGGEGSDDGQFKFPRGVAVDDQ 1290          

HSP 2 Score: 87.8113 bits (216), Expect = 5.543e-20
Identity = 41/117 (35.04%), Postives = 67/117 (57.26%), Query Frame = 3
Query:  147 IAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVF 497
            IA+    R+I SD  +HR+ I D++GK++  +G   ++  +  +P G+A D +  IF+ D  N+RIQ+F+ +G ++K  G+ G     F     +A+     NI V D  NHR+QVF
Sbjct: 1238 IAVSNTNRVIVSDSNNHRIQIFDVNGKVLSTVGGEGSDDGQFKFPRGVAVDDQGYIFVADSGNNRIQIFNPDGSFLKTFGSWGSGDSEFKGLEGVAIM-SNGNILVCDRENHRVQVF 1353          

HSP 3 Score: 80.1073 bits (196), Expect = 2.275e-17
Identity = 40/116 (34.48%), Postives = 60/116 (51.72%), Query Frame = 3
Query:  237 EIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVD 584
            ++G   +     ++P G+A     +I + D  NHR+QVF +NG ++KE G +G   G FD    +AV  +     ++D  NHRIQV D  G +L +F   G       YP G+T D
Sbjct: 1080 QLGGRGSEPGSFTWPRGLAVGPDNSIVVADSSNHRVQVFDSNGIFVKEFGEYGNGEGEFDCLAGVAV-NRIGQYIIADRYNHRIQVLDPQGRFLRAFGSQGTADGKFNYPWGVTTD 1194          

HSP 4 Score: 55.0694 bits (131), Expect = 9.505e-9
Identity = 29/85 (34.12%), Postives = 47/85 (55.29%), Query Frame = 3
Query:   99 QGTDDNVQLKFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVF 353
            +G+DD  Q KF    G+A+D    I  +D  ++R+ I + DG  +   G   +  ++     G+A  S  NI +CD++NHR+QVF
Sbjct: 1272 EGSDDG-QFKFP--RGVAVDDQGYIFVADSGNNRIQIFNPDGSFLKTFGSWGSGDSEFKGLEGVAIMSNGNILVCDRENHRVQVF 1353          

HSP 5 Score: 49.6766 bits (117), Expect = 6.133e-7
Identity = 27/69 (39.13%), Postives = 41/69 (59.42%), Query Frame = 3
Query:  345 QVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSF----NGDG 539
            QV+    + + ++G  G + G F  P  LAV P   +I V+D+SNHR+QVFD +G ++  F    NG+G
Sbjct: 1069 QVYLRKRQQLFQLGGRGSEPGSFTWPRGLAVGPDN-SIVVADSSNHRVQVFDSNGIFVKEFGEYGNGEG 1136          
BLAST of SMED30029356 vs. Ensembl Fly
Match: tn (gene:FBgn0265356 transcript:FBtr0086572)

HSP 1 Score: 150.599 bits (379), Expect = 7.691e-42
Identity = 64/163 (39.26%), Postives = 107/163 (65.64%), Query Frame = 3
Query:  102 GTDDNVQLKFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            G   N + +FDCL+G+A+++  + I +DRY+HR+ ++D  G+ +   G       K +YPWG+ TD+   I++CDK+NHR+QVF ++G ++ + G+ G+  G  ++PHY+AV   T  + VSD++NHRIQ+FD +G  L +  G+G      K+PRG+ VD++
Sbjct: 1129 GEYGNGEGEFDCLAGVAVNRIGQYIIADRYNHRIQVLDPQGRFLRAFGSQGTADGKFNYPWGVTTDALGFIYVCDKENHRVQVFQSDGSFVGKFGSCGRGEGQLEHPHYIAV-SNTNRVIVSDSNNHRIQIFDVNGKVLSTVGGEGSDDGQFKFPRGVAVDDQ 1290          

HSP 2 Score: 87.8113 bits (216), Expect = 5.543e-20
Identity = 41/117 (35.04%), Postives = 67/117 (57.26%), Query Frame = 3
Query:  147 IAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVF 497
            IA+    R+I SD  +HR+ I D++GK++  +G   ++  +  +P G+A D +  IF+ D  N+RIQ+F+ +G ++K  G+ G     F     +A+     NI V D  NHR+QVF
Sbjct: 1238 IAVSNTNRVIVSDSNNHRIQIFDVNGKVLSTVGGEGSDDGQFKFPRGVAVDDQGYIFVADSGNNRIQIFNPDGSFLKTFGSWGSGDSEFKGLEGVAIM-SNGNILVCDRENHRVQVF 1353          

HSP 3 Score: 80.1073 bits (196), Expect = 2.275e-17
Identity = 40/116 (34.48%), Postives = 60/116 (51.72%), Query Frame = 3
Query:  237 EIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVD 584
            ++G   +     ++P G+A     +I + D  NHR+QVF +NG ++KE G +G   G FD    +AV  +     ++D  NHRIQV D  G +L +F   G       YP G+T D
Sbjct: 1080 QLGGRGSEPGSFTWPRGLAVGPDNSIVVADSSNHRVQVFDSNGIFVKEFGEYGNGEGEFDCLAGVAV-NRIGQYIIADRYNHRIQVLDPQGRFLRAFGSQGTADGKFNYPWGVTTD 1194          

HSP 4 Score: 55.0694 bits (131), Expect = 9.505e-9
Identity = 29/85 (34.12%), Postives = 47/85 (55.29%), Query Frame = 3
Query:   99 QGTDDNVQLKFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVF 353
            +G+DD  Q KF    G+A+D    I  +D  ++R+ I + DG  +   G   +  ++     G+A  S  NI +CD++NHR+QVF
Sbjct: 1272 EGSDDG-QFKFP--RGVAVDDQGYIFVADSGNNRIQIFNPDGSFLKTFGSWGSGDSEFKGLEGVAIMSNGNILVCDRENHRVQVF 1353          

HSP 5 Score: 49.6766 bits (117), Expect = 6.133e-7
Identity = 27/69 (39.13%), Postives = 41/69 (59.42%), Query Frame = 3
Query:  345 QVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSF----NGDG 539
            QV+    + + ++G  G + G F  P  LAV P   +I V+D+SNHR+QVFD +G ++  F    NG+G
Sbjct: 1069 QVYLRKRQQLFQLGGRGSEPGSFTWPRGLAVGPDN-SIVVADSSNHRVQVFDSNGIFVKEFGEYGNGEG 1136          
BLAST of SMED30029356 vs. Ensembl Fly
Match: tn (gene:FBgn0265356 transcript:FBtr0340448)

HSP 1 Score: 150.599 bits (379), Expect = 8.021e-42
Identity = 64/163 (39.26%), Postives = 107/163 (65.64%), Query Frame = 3
Query:  102 GTDDNVQLKFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            G   N + +FDCL+G+A+++  + I +DRY+HR+ ++D  G+ +   G       K +YPWG+ TD+   I++CDK+NHR+QVF ++G ++ + G+ G+  G  ++PHY+AV   T  + VSD++NHRIQ+FD +G  L +  G+G      K+PRG+ VD++
Sbjct: 1053 GEYGNGEGEFDCLAGVAVNRIGQYIIADRYNHRIQVLDPQGRFLRAFGSQGTADGKFNYPWGVTTDALGFIYVCDKENHRVQVFQSDGSFVGKFGSCGRGEGQLEHPHYIAV-SNTNRVIVSDSNNHRIQIFDVNGKVLSTVGGEGSDDGQFKFPRGVAVDDQ 1214          

HSP 2 Score: 87.8113 bits (216), Expect = 5.615e-20
Identity = 41/117 (35.04%), Postives = 67/117 (57.26%), Query Frame = 3
Query:  147 IAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVF 497
            IA+    R+I SD  +HR+ I D++GK++  +G   ++  +  +P G+A D +  IF+ D  N+RIQ+F+ +G ++K  G+ G     F     +A+     NI V D  NHR+QVF
Sbjct: 1162 IAVSNTNRVIVSDSNNHRIQIFDVNGKVLSTVGGEGSDDGQFKFPRGVAVDDQGYIFVADSGNNRIQIFNPDGSFLKTFGSWGSGDSEFKGLEGVAIM-SNGNILVCDRENHRVQVF 1277          

HSP 3 Score: 80.1073 bits (196), Expect = 2.327e-17
Identity = 40/116 (34.48%), Postives = 60/116 (51.72%), Query Frame = 3
Query:  237 EIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVD 584
            ++G   +     ++P G+A     +I + D  NHR+QVF +NG ++KE G +G   G FD    +AV  +     ++D  NHRIQV D  G +L +F   G       YP G+T D
Sbjct: 1004 QLGGRGSEPGSFTWPRGLAVGPDNSIVVADSSNHRVQVFDSNGIFVKEFGEYGNGEGEFDCLAGVAV-NRIGQYIIADRYNHRIQVLDPQGRFLRAFGSQGTADGKFNYPWGVTTD 1118          

HSP 4 Score: 55.0694 bits (131), Expect = 9.630e-9
Identity = 29/85 (34.12%), Postives = 47/85 (55.29%), Query Frame = 3
Query:   99 QGTDDNVQLKFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVF 353
            +G+DD  Q KF    G+A+D    I  +D  ++R+ I + DG  +   G   +  ++     G+A  S  NI +CD++NHR+QVF
Sbjct: 1196 EGSDDG-QFKFP--RGVAVDDQGYIFVADSGNNRIQIFNPDGSFLKTFGSWGSGDSEFKGLEGVAIMSNGNILVCDRENHRVQVF 1277          

HSP 5 Score: 49.6766 bits (117), Expect = 6.214e-7
Identity = 27/69 (39.13%), Postives = 41/69 (59.42%), Query Frame = 3
Query:  345 QVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSF----NGDG 539
            QV+    + + ++G  G + G F  P  LAV P   +I V+D+SNHR+QVFD +G ++  F    NG+G
Sbjct:  993 QVYLRKRQQLFQLGGRGSEPGSFTWPRGLAVGPDN-SIVVADSSNHRVQVFDSNGIFVKEFGEYGNGEG 1060          
BLAST of SMED30029356 vs. Ensembl Fly
Match: tn (gene:FBgn0265356 transcript:FBtr0340447)

HSP 1 Score: 150.214 bits (378), Expect = 1.111e-41
Identity = 64/163 (39.26%), Postives = 107/163 (65.64%), Query Frame = 3
Query:  102 GTDDNVQLKFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            G   N + +FDCL+G+A+++  + I +DRY+HR+ ++D  G+ +   G       K +YPWG+ TD+   I++CDK+NHR+QVF ++G ++ + G+ G+  G  ++PHY+AV   T  + VSD++NHRIQ+FD +G  L +  G+G      K+PRG+ VD++
Sbjct: 1024 GEYGNGEGEFDCLAGVAVNRIGQYIIADRYNHRIQVLDPQGRFLRAFGSQGTADGKFNYPWGVTTDALGFIYVCDKENHRVQVFQSDGSFVGKFGSCGRGEGQLEHPHYIAV-SNTNRVIVSDSNNHRIQIFDVNGKVLSTVGGEGSDDGQFKFPRGVAVDDQ 1185          

HSP 2 Score: 87.4261 bits (215), Expect = 7.050e-20
Identity = 41/117 (35.04%), Postives = 67/117 (57.26%), Query Frame = 3
Query:  147 IAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVF 497
            IA+    R+I SD  +HR+ I D++GK++  +G   ++  +  +P G+A D +  IF+ D  N+RIQ+F+ +G ++K  G+ G     F     +A+     NI V D  NHR+QVF
Sbjct: 1133 IAVSNTNRVIVSDSNNHRIQIFDVNGKVLSTVGGEGSDDGQFKFPRGVAVDDQGYIFVADSGNNRIQIFNPDGSFLKTFGSWGSGDSEFKGLEGVAIM-SNGNILVCDRENHRVQVF 1248          

HSP 3 Score: 79.7221 bits (195), Expect = 2.838e-17
Identity = 40/116 (34.48%), Postives = 60/116 (51.72%), Query Frame = 3
Query:  237 EIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVD 584
            ++G   +     ++P G+A     +I + D  NHR+QVF +NG ++KE G +G   G FD    +AV  +     ++D  NHRIQV D  G +L +F   G       YP G+T D
Sbjct:  975 QLGGRGSEPGSFTWPRGLAVGPDNSIVVADSSNHRVQVFDSNGIFVKEFGEYGNGEGEFDCLAGVAV-NRIGQYIIADRYNHRIQVLDPQGRFLRAFGSQGTADGKFNYPWGVTTD 1089          

HSP 4 Score: 54.6842 bits (130), Expect = 1.106e-8
Identity = 29/85 (34.12%), Postives = 47/85 (55.29%), Query Frame = 3
Query:   99 QGTDDNVQLKFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVF 353
            +G+DD  Q KF    G+A+D    I  +D  ++R+ I + DG  +   G   +  ++     G+A  S  NI +CD++NHR+QVF
Sbjct: 1167 EGSDDG-QFKFP--RGVAVDDQGYIFVADSGNNRIQIFNPDGSFLKTFGSWGSGDSEFKGLEGVAIMSNGNILVCDRENHRVQVF 1248          

HSP 5 Score: 49.2914 bits (116), Expect = 7.002e-7
Identity = 27/69 (39.13%), Postives = 41/69 (59.42%), Query Frame = 3
Query:  345 QVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSF----NGDG 539
            QV+    + + ++G  G + G F  P  LAV P   +I V+D+SNHR+QVFD +G ++  F    NG+G
Sbjct:  964 QVYLRKRQQLFQLGGRGSEPGSFTWPRGLAVGPDN-SIVVADSSNHRVQVFDSNGIFVKEFGEYGNGEG 1031          
BLAST of SMED30029356 vs. Ensembl Zebrafish
Match: trim71 (tripartite motif containing 71, E3 ubiquitin protein ligase [Source:NCBI gene;Acc:561754])

HSP 1 Score: 106.301 bits (264), Expect = 2.736e-26
Identity = 54/149 (36.24%), Postives = 85/149 (57.05%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            GI +DK   ++ +DR ++RV I    G    + G   +   +   P G+A DS++ I + DKDNHRIQ+F+ +G+++ + G  G + G F+ P  +AV  + K I VSDT NHR+Q+F   GT+L  +  +G    H   PRG+  + E
Sbjct:  567 GICVDKEGYVVVADRSNNRVQIFKPCGTFHHKFGTLGSRPGQFDRPAGVACDSQRRIIVADKDNHRIQIFTFDGQFLLKFGEKGTKNGQFNYPWDVAVNFEGK-ILVSDTRNHRVQLFGPDGTFLNKYGFEGALWKHFDSPRGVAFNQE 714          

HSP 2 Score: 92.8189 bits (229), Expect = 1.229e-21
Identity = 45/155 (29.03%), Postives = 79/155 (50.97%), Query Frame = 3
Query:  126 KFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            +FD  +G+A D  +RII +D+ +HR+ I   DG+ + + G+      + +YPW +A +    I + D  NHR+Q+F  +G ++ + G  G     FD+P  +A   +  ++ V+D +NHR+ V             +G        P+G+ VD E
Sbjct:  608 QFDRPAGVACDSQRRIIVADKDNHRIQIFTFDGQFLLKFGEKGTKNGQFNYPWDVAVNFEGKILVSDTRNHRVQLFGPDGTFLNKYGFEGALWKHFDSPRGVAF-NQEGHLVVTDFNNHRLLVIRPDCQSARFLGSEGTGNGQFLRPQGVAVDQE 761          

HSP 3 Score: 78.5666 bits (192), Expect = 8.972e-17
Identity = 39/123 (31.71%), Postives = 58/123 (47.15%), Query Frame = 3
Query:  222 GKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            G  +   G   +   +L  PWGI  D    + + D+ N+R+Q+F   G +  + G  G + G FD P  +A C   + I V+D  NHRIQ+F   G +L  F   G       YP  + V+ E
Sbjct:  546 GLPMASFGGEGDGDGQLCRPWGICVDKEGYVVVADRSNNRVQIFKPCGTFHHKFGTLGSRPGQFDRPAGVA-CDSQRRIIVADKDNHRIQIFTFDGQFLLKFGEKGTKNGQFNYPWDVAVNFE 667          

HSP 4 Score: 73.9442 bits (180), Expect = 3.489e-15
Identity = 39/123 (31.71%), Postives = 60/123 (48.78%), Query Frame = 3
Query:  129 FDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVF 497
            FD   G+A ++   ++ +D  +HR+ ++  D +    +G       +   P G+A D    I + D  NHRIQVF  NG ++ + G HG   G  D P  +AV P    I   D  N+RI +F
Sbjct:  703 FDSPRGVAFNQEGHLVVTDFNNHRLLVIRPDCQSARFLGSEGTGNGQFLRPQGVAVDQEDRIIVADSRNHRIQVFEPNGNFLCKFGTHGNGFGQMDRPSGIAVTPDGV-IVAVDFGNNRILMF 824          
BLAST of SMED30029356 vs. Ensembl Zebrafish
Match: trim3b (tripartite motif containing 3b [Source:ZFIN;Acc:ZDB-GENE-070112-1132])

HSP 1 Score: 85.8853 bits (211), Expect = 2.787e-19
Identity = 45/129 (34.88%), Postives = 73/129 (56.59%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFN 530
            G+A+D+N  II  D     V I   +GKL+ + G    +  + + P  +A +++  I + D  NH ++V+S +GE++ + G+HG+  G F+ P  +AV     NI V+D  N RIQVFD  G++L   N
Sbjct:  588 GVAVDRNGHIIAVDNKACCVFIFQSNGKLVTKFGARGTSDRQFAGPHFVAVNNKNEIVVTDFHNHSVKVYSADGEFLFKFGSHGEGNGQFNAPTGVAV-DVNGNIIVADWGNSRIQVFDSAGSFLSYIN 715          

HSP 2 Score: 79.337 bits (194), Expect = 4.555e-17
Identity = 45/148 (30.41%), Postives = 73/148 (49.32%), Query Frame = 3
Query:  141 SGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVD 584
            +G+A+D N  +I +D  +  ++I   DGK   +IG       +L  P G+A D   +I   D     + +F +NG+ + + GA G     F  PH++AV  K + I V+D  NH ++V+   G +L+ F   G        P G+ VD
Sbjct:  545 TGVAVDTNGDVIVADYDNRWISIFSPDGKFKNKIGA-----GRLMGPKGVAVDRNGHIIAVDNKACCVFIFQSNGKLVTKFGARGTSDRQFAGPHFVAVNNKNE-IVVTDFHNHSVKVYSADGEFLFKFGSHGEGNGQFNAPTGVAVD 686          

HSP 3 Score: 53.1434 bits (126), Expect = 4.354e-8
Identity = 34/123 (27.64%), Postives = 56/123 (45.53%), Query Frame = 3
Query:  216 IDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVD 584
            I+ +LI  +G     K + +   GI+      + + D +N  IQVF+N+G++    G  G+  G    P  +AV     ++ V+D  N  I +F   G +     G G     L  P+G+ VD
Sbjct:  476 IEDELIYRVGTRGREKGEFTNLQGISASISGRVIVADSNNQCIQVFTNDGQFKARFGVRGRSPGQLQRPTGVAV-DTNGDVIVADYDNRWISIFSPDGKFKNKI-GAG----RLMGPKGVAVD 592          
BLAST of SMED30029356 vs. Ensembl Zebrafish
Match: trim2a (tripartite motif containing 2a [Source:ZFIN;Acc:ZDB-GENE-050327-99])

HSP 1 Score: 83.5741 bits (205), Expect = 1.928e-18
Identity = 45/129 (34.88%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFN 530
            G+++D+N  II  D     V I   +GKL+ + G   N+  + + P   A +    + + D  NH ++VFS  GE+I + G++G+  G F+ P  +AV     NI V+D  N RIQVFD  G++L   N
Sbjct:  580 GVSVDRNGHIIVVDNKSCCVFIFQPNGKLVSKFGNRGNSDKQFAGPHFAAVNQNNEVIVTDFHNHSVKVFSPEGEFILKFGSNGEGNGQFNAPTGVAV-DANGNIIVADWGNSRIQVFDSSGSFLSYIN 707          

HSP 2 Score: 73.1738 bits (178), Expect = 5.895e-15
Identity = 42/148 (28.38%), Postives = 70/148 (47.30%), Query Frame = 3
Query:  141 SGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVD 584
            +G+A+  +  II +D  +  V+I   DGK   +IG       KL  P G++ D   +I + D  +  + +F  NG+ + + G  G     F  PH+ AV  +   + V+D  NH ++VF   G ++  F  +G        P G+ VD
Sbjct:  537 TGVAVHPSGDIIIADYDNKWVSIFSSDGKFKSKIGS-----GKLMGPKGVSVDRNGHIIVVDNKSCCVFIFQPNGKLVSKFGNRGNSDKQFAGPHFAAV-NQNNEVIVTDFHNHSVKVFSPEGEFILKFGSNGEGNGQFNAPTGVAVD 678          

HSP 3 Score: 62.7734 bits (151), Expect = 2.897e-11
Identity = 38/123 (30.89%), Postives = 61/123 (49.59%), Query Frame = 3
Query:  216 IDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVD 584
            I+  LI  IG    NK + +   G+A  S   + I D +N  +Q+FSN+G++    G  G+  G    P  +AV P + +I ++D  N  + +F   G +  S  G G     L  P+G++VD
Sbjct:  468 IEDDLIFRIGTKGRNKGEFTNLQGVAASSVGKVLIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVAVHP-SGDIIIADYDNKWVSIFSSDGKF-KSKIGSG----KLMGPKGVSVD 584          

HSP 4 Score: 62.3882 bits (150), Expect = 3.340e-11
Identity = 36/138 (26.09%), Postives = 67/138 (48.55%), Query Frame = 3
Query:   84 EMVCDQGTDDNVQLKFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVF 497
            ++V   G   N   +F      A+++N  +I +D ++H V +   +G+ I + G +     + + P G+A D+  NI + D  N RIQVF ++G ++  I            P  LA+     ++ V+D+ NH  +V+
Sbjct:  607 KLVSKFGNRGNSDKQFAGPHFAAVNQNNEVIVTDFHNHSVKVFSPEGEFILKFGSNGEGNGQFNAPTGVAVDANGNIIVADWGNSRIQVFDSSGSFLSYINTSADP---LYGPQGLALT-SDGHVVVADSGNHCFKVY 740          
BLAST of SMED30029356 vs. Ensembl Zebrafish
Match: trim2b (tripartite motif containing 2b [Source:ZFIN;Acc:ZDB-GENE-090312-70])

HSP 1 Score: 81.2629 bits (199), Expect = 1.173e-17
Identity = 45/129 (34.88%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFN 530
            G+++D+N  +I  D     V I    GKLI + G   N   + + P   A ++   I I D  NH ++VF+ +GE++ + G++G+  G F+ P  +AV     NI V+D  N RIQVFD  G++L   N
Sbjct:  505 GVSVDQNGHVIVVDNKACTVFIFQPSGKLITKFGSRGNGDRQFAGPHFAAVNNNNEIIITDFHNHSVKVFNADGEFLLKFGSNGEGNGQFNAPTGVAV-DVNGNIIVADWGNSRIQVFDGSGSFLSYIN 632          

HSP 2 Score: 70.0922 bits (170), Expect = 6.946e-14
Identity = 40/148 (27.03%), Postives = 70/148 (47.30%), Query Frame = 3
Query:  141 SGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVD 584
            +G+A+  N  II +D  +  V+I   +GK   ++G       +L  P G++ D   ++ + D     + +F  +G+ I + G+ G     F  PH+ AV      I ++D  NH ++VF+  G +L  F  +G        P G+ VD
Sbjct:  462 TGVAVHPNGDIIIADYDNKWVSIFSSEGKYKAKLGS-----GRLMGPKGVSVDQNGHVIVVDNKACTVFIFQPSGKLITKFGSRGNGDRQFAGPHFAAV-NNNNEIIITDFHNHSVKVFNADGEFLLKFGSNGEGNGQFNAPTGVAVD 603          

HSP 3 Score: 65.4698 bits (158), Expect = 2.900e-12
Identity = 40/123 (32.52%), Postives = 58/123 (47.15%), Query Frame = 3
Query:  216 IDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVD 584
            I+  LI  IG    NK + +   G+A  S   I I D +N  +Q+FSN GE+    G  G+  G    P  +AV P   +I ++D  N  + +F   G Y     G G     L  P+G++VD
Sbjct:  393 IEDDLIFRIGTKGRNKGEFTNLQGVAACSEGRILIADSNNQCVQIFSNTGEFQSRFGVRGRSPGQLQRPTGVAVHP-NGDIIIADYDNKWVSIFSSEGKYKAKL-GSG----RLMGPKGVSVD 509          
BLAST of SMED30029356 vs. Ensembl Zebrafish
Match: trim2b (tripartite motif containing 2b [Source:ZFIN;Acc:ZDB-GENE-090312-70])

HSP 1 Score: 81.2629 bits (199), Expect = 1.173e-17
Identity = 45/129 (34.88%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFN 530
            G+++D+N  +I  D     V I    GKLI + G   N   + + P   A ++   I I D  NH ++VF+ +GE++ + G++G+  G F+ P  +AV     NI V+D  N RIQVFD  G++L   N
Sbjct:  505 GVSVDQNGHVIVVDNKACTVFIFQPSGKLITKFGSRGNGDRQFAGPHFAAVNNNNEIIITDFHNHSVKVFNADGEFLLKFGSNGEGNGQFNAPTGVAV-DVNGNIIVADWGNSRIQVFDGSGSFLSYIN 632          

HSP 2 Score: 70.0922 bits (170), Expect = 6.946e-14
Identity = 40/148 (27.03%), Postives = 70/148 (47.30%), Query Frame = 3
Query:  141 SGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVD 584
            +G+A+  N  II +D  +  V+I   +GK   ++G       +L  P G++ D   ++ + D     + +F  +G+ I + G+ G     F  PH+ AV      I ++D  NH ++VF+  G +L  F  +G        P G+ VD
Sbjct:  462 TGVAVHPNGDIIIADYDNKWVSIFSSEGKYKAKLGS-----GRLMGPKGVSVDQNGHVIVVDNKACTVFIFQPSGKLITKFGSRGNGDRQFAGPHFAAV-NNNNEIIITDFHNHSVKVFNADGEFLLKFGSNGEGNGQFNAPTGVAVD 603          

HSP 3 Score: 65.4698 bits (158), Expect = 2.900e-12
Identity = 40/123 (32.52%), Postives = 58/123 (47.15%), Query Frame = 3
Query:  216 IDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVD 584
            I+  LI  IG    NK + +   G+A  S   I I D +N  +Q+FSN GE+    G  G+  G    P  +AV P   +I ++D  N  + +F   G Y     G G     L  P+G++VD
Sbjct:  393 IEDDLIFRIGTKGRNKGEFTNLQGVAACSEGRILIADSNNQCVQIFSNTGEFQSRFGVRGRSPGQLQRPTGVAVHP-NGDIIIADYDNKWVSIFSSEGKYKAKL-GSG----RLMGPKGVSVD 509          
BLAST of SMED30029356 vs. Ensembl Xenopus
Match: TRIM71 (tripartite motif containing 71, E3 ubiquitin protein ligase [Source:NCBI gene;Acc:100486898])

HSP 1 Score: 102.449 bits (254), Expect = 8.373e-25
Identity = 51/149 (34.23%), Postives = 82/149 (55.03%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            G+ +D+   II +DR ++RV I    G    + G   +   +   P G+A D+ + I + DKDNHR+Q+F+  G+++ + G  G + G F+ P  +AV  + K I VSDT NHR+Q+F   GT+L  +  +G    H   PRG+    +
Sbjct:  596 GVCVDREGYIIVADRSNNRVQIFKPCGTFHHKFGSLGSRPGQFDRPAGVACDNSRRIVVADKDNHRVQIFTFEGQFLLKFGEKGTKNGQFNYPWDVAVNSEGK-ILVSDTRNHRVQLFGPDGTFLNKYGFEGALWKHFDSPRGVAFSQD 743          

HSP 2 Score: 94.7449 bits (234), Expect = 3.683e-22
Identity = 47/157 (29.94%), Postives = 84/157 (53.50%), Query Frame = 3
Query:  126 KFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVF--DKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            +FD  +G+A D ++RI+ +D+ +HRV I   +G+ + + G+      + +YPW +A +S   I + D  NHR+Q+F  +G ++ + G  G     FD+P  +A   +   + V+D +NHR+ +   D    +     G G  +F    P+G+ VD E
Sbjct:  637 QFDRPAGVACDNSRRIVVADKDNHRVQIFTFEGQFLLKFGEKGTKNGQFNYPWDVAVNSEGKILVSDTRNHRVQLFGPDGTFLNKYGFEGALWKHFDSPRGVAF-SQDGYLVVTDFNNHRLLIIKPDCQSAHFLGTEGTGNGQF--LRPQGVAVDQE 790          

HSP 3 Score: 83.1889 bits (204), Expect = 3.483e-18
Identity = 38/116 (32.76%), Postives = 60/116 (51.72%), Query Frame = 3
Query:  243 GKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            G   ++  KL  PWG+  D    I + D+ N+R+Q+F   G +  + G+ G + G FD P  +A C  ++ I V+D  NHR+Q+F   G +L  F   G       YP  + V++E
Sbjct:  582 GGEGDHDGKLCRPWGVCVDREGYIIVADRSNNRVQIFKPCGTFHHKFGSLGSRPGQFDRPAGVA-CDNSRRIVVADKDNHRVQIFTFEGQFLLKFGEKGTKNGQFNYPWDVAVNSE 696          

HSP 4 Score: 72.4034 bits (176), Expect = 1.603e-14
Identity = 38/123 (30.89%), Postives = 59/123 (47.97%), Query Frame = 3
Query:  129 FDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVF 497
            FD   G+A  ++  ++ +D  +HR+ I+  D +    +G       +   P G+A D    I + D  NHR+Q+F  NG ++ + G  G   G  D P  +AV P    I V D  N+RI  F
Sbjct:  732 FDSPRGVAFSQDGYLVVTDFNNHRLLIIKPDCQSAHFLGTEGTGNGQFLRPQGVAVDQEGRIIVADSRNHRVQIFEPNGSFLCKFGTQGSGFGQMDRPSGIAVTPD-GTIVVVDFGNNRILAF 853          

HSP 5 Score: 52.7582 bits (125), Expect = 9.860e-8
Identity = 27/84 (32.14%), Postives = 43/84 (51.19%), Query Frame = 3
Query:  102 GTDDNVQLKFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVF 353
            GT+     +F    G+A+D+  RII +D  +HRV I + +G  +C+ G   +   ++  P GIA      I + D  N+RI  F
Sbjct:  770 GTEGTGNGQFLRPQGVAVDQEGRIIVADSRNHRVQIFEPNGSFLCKFGTQGSGFGQMDRPSGIAVTPDGTIVVVDFGNNRILAF 853          
BLAST of SMED30029356 vs. Ensembl Xenopus
Match: TRIM71 (tripartite motif containing 71, E3 ubiquitin protein ligase [Source:NCBI gene;Acc:100486898])

HSP 1 Score: 102.064 bits (253), Expect = 8.914e-25
Identity = 51/149 (34.23%), Postives = 82/149 (55.03%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            G+ +D+   II +DR ++RV I    G    + G   +   +   P G+A D+ + I + DKDNHR+Q+F+  G+++ + G  G + G F+ P  +AV  + K I VSDT NHR+Q+F   GT+L  +  +G    H   PRG+    +
Sbjct:  574 GVCVDREGYIIVADRSNNRVQIFKPCGTFHHKFGSLGSRPGQFDRPAGVACDNSRRIVVADKDNHRVQIFTFEGQFLLKFGEKGTKNGQFNYPWDVAVNSEGK-ILVSDTRNHRVQLFGPDGTFLNKYGFEGALWKHFDSPRGVAFSQD 721          

HSP 2 Score: 94.7449 bits (234), Expect = 3.959e-22
Identity = 47/157 (29.94%), Postives = 84/157 (53.50%), Query Frame = 3
Query:  126 KFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVF--DKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            +FD  +G+A D ++RI+ +D+ +HRV I   +G+ + + G+      + +YPW +A +S   I + D  NHR+Q+F  +G ++ + G  G     FD+P  +A   +   + V+D +NHR+ +   D    +     G G  +F    P+G+ VD E
Sbjct:  615 QFDRPAGVACDNSRRIVVADKDNHRVQIFTFEGQFLLKFGEKGTKNGQFNYPWDVAVNSEGKILVSDTRNHRVQLFGPDGTFLNKYGFEGALWKHFDSPRGVAF-SQDGYLVVTDFNNHRLLIIKPDCQSAHFLGTEGTGNGQF--LRPQGVAVDQE 768          

HSP 3 Score: 83.1889 bits (204), Expect = 3.636e-18
Identity = 38/116 (32.76%), Postives = 60/116 (51.72%), Query Frame = 3
Query:  243 GKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            G   ++  KL  PWG+  D    I + D+ N+R+Q+F   G +  + G+ G + G FD P  +A C  ++ I V+D  NHR+Q+F   G +L  F   G       YP  + V++E
Sbjct:  560 GGEGDHDGKLCRPWGVCVDREGYIIVADRSNNRVQIFKPCGTFHHKFGSLGSRPGQFDRPAGVA-CDNSRRIVVADKDNHRVQIFTFEGQFLLKFGEKGTKNGQFNYPWDVAVNSE 674          

HSP 4 Score: 72.4034 bits (176), Expect = 1.690e-14
Identity = 38/123 (30.89%), Postives = 59/123 (47.97%), Query Frame = 3
Query:  129 FDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVF 497
            FD   G+A  ++  ++ +D  +HR+ I+  D +    +G       +   P G+A D    I + D  NHR+Q+F  NG ++ + G  G   G  D P  +AV P    I V D  N+RI  F
Sbjct:  710 FDSPRGVAFSQDGYLVVTDFNNHRLLIIKPDCQSAHFLGTEGTGNGQFLRPQGVAVDQEGRIIVADSRNHRVQIFEPNGSFLCKFGTQGSGFGQMDRPSGIAVTPD-GTIVVVDFGNNRILAF 831          

HSP 5 Score: 52.7582 bits (125), Expect = 1.001e-7
Identity = 27/84 (32.14%), Postives = 43/84 (51.19%), Query Frame = 3
Query:  102 GTDDNVQLKFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVF 353
            GT+     +F    G+A+D+  RII +D  +HRV I + +G  +C+ G   +   ++  P GIA      I + D  N+RI  F
Sbjct:  748 GTEGTGNGQFLRPQGVAVDQEGRIIVADSRNHRVQIFEPNGSFLCKFGTQGSGFGQMDRPSGIAVTPDGTIVVVDFGNNRILAF 831          
BLAST of SMED30029356 vs. Ensembl Xenopus
Match: surf4.1 (surfeit 4, gene 1 [Source:Xenbase;Acc:XB-GENE-5807555])

HSP 1 Score: 82.8037 bits (203), Expect = 3.670e-18
Identity = 50/153 (32.68%), Postives = 78/153 (50.98%), Query Frame = 3
Query:  141 SGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHG----QQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDN 587
            +G+A+D N  II +D  +  V+I   +GK   +IG       +L  P G+A D   ++ + D  +  I +F +NG+ +   GA G    QQ G  D PH++AV  K + I V+D  NH ++V+   G +LY F   G        P G+ VD+
Sbjct:  350 TGVAVDMNGDIIVADYDNRWVSIFSPEGKFKNKIGV-----GRLMGPKGVAVDRNGHLIVVDNKSCCIFIFQSNGKLVGRFGARGPGDKQQPGALDGPHFVAVNNKNE-IVVTDFHNHSVKVYSADGEFLYKFGSHGEGNGQFNAPTGVAVDS 496          

HSP 2 Score: 67.781 bits (164), Expect = 5.764e-13
Identity = 41/132 (31.06%), Postives = 67/132 (50.76%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSS----NNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSF 527
            G+A+D+N  +I  D     + I   +GKL+   G            L  P  +A +++  I + D  NH ++V+S +GE++ + G+HG+  G F+ P  +AV     NI V+D  N RIQV  + G    S+
Sbjct:  393 GVAVDRNGHLIVVDNKSCCIFIFQSNGKLVGRFGARGPGDKQQPGALDGPHFVAVNNKNEIVVTDFHNHSVKVYSADGEFLYKFGSHGEGNGQFNAPTGVAV-DSNGNIIVADWGNSRIQVKTRVGGQWVSY 523          

HSP 3 Score: 55.8398 bits (133), Expect = 8.408e-9
Identity = 35/123 (28.46%), Postives = 57/123 (46.34%), Query Frame = 3
Query:  216 IDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVD 584
            I+ ++I  +G    +K + S   GI+      I + D +N  IQVF+N+G++    G  G+  G    P  +AV     +I V+D  N  + +F   G +     G G     L  P+G+ VD
Sbjct:  281 IEDEMILRVGSRGRDKGEFSNLQGISASCNNRIVVADSNNQCIQVFTNDGQFKLRFGVRGRSPGQLQRPTGVAV-DMNGDIIVADYDNRWVSIFSPEGKFKNKI-GVG----RLMGPKGVAVD 397          
BLAST of SMED30029356 vs. Ensembl Xenopus
Match: actr6 (ARP6 actin related protein 6 homolog [Source:Xenbase;Acc:XB-GENE-5860964])

HSP 1 Score: 81.6481 bits (200), Expect = 1.141e-17
Identity = 48/149 (32.21%), Postives = 79/149 (53.02%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            G+++D+N  II  D     V I   +GK++   G   N   + + P   A +S   I + D  NH ++VF+ +GE+I + G++G+  G F+ P  +AV     NI V+D  N RIQVFD  G++L   N        L  P+G+++ ++
Sbjct:  481 GVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDKQFAGPHFAAVNSNNEIIVTDFHNHSVKVFNQDGEFILKFGSNGEGNGQFNAPTGVAV-DSNGNIIVADWGNSRIQVFDGSGSFLSYINTSADP---LYGPQGLSLTSD 625          

HSP 2 Score: 66.2402 bits (160), Expect = 1.952e-12
Identity = 48/210 (22.86%), Postives = 80/210 (38.10%), Query Frame = 3
Query:   84 EMVCDQGTDDNVQLKFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSN------------------------------------------NGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDN 587
            +++   GT    + +F  L G+A   N +I+ +D  +  V I   DG+     G    +  +L  P G+A     +I I D DN  + +FS                                           NG+ +   G+ G     F  PH+ AV    + I V+D  NH ++VF++ G ++  F  +G        P G+ VD+
Sbjct:  372 DLIFRVGTKGRNKGEFTNLQGVAASTNGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSADGKFKTKIGSGKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDKQFAGPHFAAVNSNNE-IIVTDFHNHSVKVFNQDGEFILKFGSNGEGNGQFNAPTGVAVDS 580          

HSP 3 Score: 62.7734 bits (151), Expect = 4.004e-11
Identity = 36/123 (29.27%), Postives = 60/123 (48.78%), Query Frame = 3
Query:  216 IDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVD 584
            I+  LI  +G    NK + +   G+A  +   I I D +N  +Q+FSN+G++    G  G+  G    P  +AV P + +I ++D  N  + +F   G +     G G     L  P+G++VD
Sbjct:  369 IEDDLIFRVGTKGRNKGEFTNLQGVAASTNGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVAVHP-SGDIIIADYDNKWVSIFSADGKFKTKI-GSG----KLMGPKGVSVD 485          
BLAST of SMED30029356 vs. Ensembl Xenopus
Match: actr6 (ARP6 actin related protein 6 homolog [Source:Xenbase;Acc:XB-GENE-5860964])

HSP 1 Score: 81.6481 bits (200), Expect = 1.277e-17
Identity = 48/149 (32.21%), Postives = 79/149 (53.02%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            G+++D+N  II  D     V I   +GK++   G   N   + + P   A +S   I + D  NH ++VF+ +GE+I + G++G+  G F+ P  +AV     NI V+D  N RIQVFD  G++L   N        L  P+G+++ ++
Sbjct:  593 GVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDKQFAGPHFAAVNSNNEIIVTDFHNHSVKVFNQDGEFILKFGSNGEGNGQFNAPTGVAV-DSNGNIIVADWGNSRIQVFDGSGSFLSYINTSADP---LYGPQGLSLTSD 737          

HSP 2 Score: 65.855 bits (159), Expect = 3.313e-12
Identity = 48/204 (23.53%), Postives = 77/204 (37.75%), Query Frame = 3
Query:  102 GTDDNVQLKFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSN------------------------------------------NGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDN 587
            GT    + +F  L G+A   N +I+ +D  +  V I   DG+     G    +  +L  P G+A     +I I D DN  + +FS                                           NG+ +   G+ G     F  PH+ AV    + I V+D  NH ++VF++ G ++  F  +G        P G+ VD+
Sbjct:  490 GTKGRNKGEFTNLQGVAASTNGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSADGKFKTKIGSGKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDKQFAGPHFAAVNSNNE-IIVTDFHNHSVKVFNQDGEFILKFGSNGEGNGQFNAPTGVAVDS 692          

HSP 3 Score: 62.3882 bits (150), Expect = 5.454e-11
Identity = 36/123 (29.27%), Postives = 60/123 (48.78%), Query Frame = 3
Query:  216 IDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVD 584
            I+  LI  +G    NK + +   G+A  +   I I D +N  +Q+FSN+G++    G  G+  G    P  +AV P + +I ++D  N  + +F   G +     G G     L  P+G++VD
Sbjct:  481 IEDDLIFRVGTKGRNKGEFTNLQGVAASTNGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVAVHP-SGDIIIADYDNKWVSIFSADGKFKTKI-GSG----KLMGPKGVSVD 597          
BLAST of SMED30029356 vs. Ensembl Mouse
Match: Trim71 (tripartite motif-containing 71 [Source:MGI Symbol;Acc:MGI:2685973])

HSP 1 Score: 107.842 bits (268), Expect = 6.880e-27
Identity = 53/149 (35.57%), Postives = 84/149 (56.38%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            G+++DK   II +DR ++R+ +    G    + G   +   +   P G+A D+ + I + DKDNHRIQ+F+  G+++ + G  G + G F+ P  +AV  + K I VSDT NHRIQ+F   G +L  +  +G    H   PRG+  +NE
Sbjct:  598 GVSVDKEGFIIVADRSNNRIQVFKPCGSFHHKFGTLGSRPGQFDRPAGVACDASRRIIVADKDNHRIQIFTFEGQFLLKFGEKGTKNGQFNYPWDVAVNSEGK-ILVSDTRNHRIQLFGPDGVFLNKYGFEGSLWKHFDSPRGVAFNNE 745          

HSP 2 Score: 95.5153 bits (236), Expect = 1.411e-22
Identity = 46/155 (29.68%), Postives = 80/155 (51.61%), Query Frame = 3
Query:  126 KFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            +FD  +G+A D ++RII +D+ +HR+ I   +G+ + + G+      + +YPW +A +S   I + D  NHRIQ+F  +G ++ + G  G     FD+P  +A      ++ V+D +NHR+ V             +G        P+G+ VD E
Sbjct:  639 QFDRPAGVACDASRRIIVADKDNHRIQIFTFEGQFLLKFGEKGTKNGQFNYPWDVAVNSEGKILVSDTRNHRIQLFGPDGVFLNKYGFEGSLWKHFDSPRGVAF-NNEGHLVVTDFNNHRLLVIHPDCQSARFLGSEGSGNGQFLRPQGVAVDQE 792          

HSP 3 Score: 87.0409 bits (214), Expect = 1.137e-19
Identity = 41/116 (35.34%), Postives = 60/116 (51.72%), Query Frame = 3
Query:  243 GKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            G   + + KL  PWG++ D    I + D+ N+RIQVF   G +  + G  G + G FD P  +A C  ++ I V+D  NHRIQ+F   G +L  F   G       YP  + V++E
Sbjct:  584 GSEGDGEGKLCRPWGVSVDKEGFIIVADRSNNRIQVFKPCGSFHHKFGTLGSRPGQFDRPAGVA-CDASRRIIVADKDNHRIQIFTFEGQFLLKFGEKGTKNGQFNYPWDVAVNSE 698          

HSP 4 Score: 74.3294 bits (181), Expect = 3.043e-15
Identity = 38/123 (30.89%), Postives = 61/123 (49.59%), Query Frame = 3
Query:  129 FDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVF 497
            FD   G+A +    ++ +D  +HR+ ++  D +    +G   +   +   P G+A D    I + D  NHR+Q+F  NG ++ + GA G   G  D P  +AV P    I V D  N+RI +F
Sbjct:  734 FDSPRGVAFNNEGHLVVTDFNNHRLLVIHPDCQSARFLGSEGSGNGQFLRPQGVAVDQEGRIIVADSRNHRVQMFEANGSFLCKFGAQGSGFGQMDRPSGIAVTPDGL-IVVVDFGNNRILIF 855          
BLAST of SMED30029356 vs. Ensembl Mouse
Match: Trim3 (tripartite motif-containing 3 [Source:MGI Symbol;Acc:MGI:1860040])

HSP 1 Score: 83.5741 bits (205), Expect = 2.022e-18
Identity = 44/129 (34.11%), Postives = 69/129 (53.49%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFN 530
            G+A+D+N  II  D     V     +GKL+   G         + P  +A +++  I + D  NH ++V+S +GE++ + G+HG+  G F+ P  +AV     NI V+D  N RIQVFD  G++L   N
Sbjct:  580 GVAVDRNGHIIVVDNKSCCVFTFQPNGKLVGRFGGRGATDRHFAGPHFVAVNNKNEIVVTDFHNHSVKVYSADGEFLFKFGSHGEGNGQFNAPTGVAV-DSNGNIIVADWGNSRIQVFDSSGSFLSYIN 707          

HSP 2 Score: 78.5666 bits (192), Expect = 9.583e-17
Identity = 45/149 (30.20%), Postives = 72/149 (48.32%), Query Frame = 3
Query:  141 SGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDN 587
            +G+A+D N  II +D  +  V+I   +GK   +IG       +L  P G+A D   +I + D  +  +  F  NG+ +   G  G     F  PH++AV  K + I V+D  NH ++V+   G +L+ F   G        P G+ VD+
Sbjct:  537 TGVAVDTNGDIIVADYDNRWVSIFSPEGKFKTKIGA-----GRLMGPKGVAVDRNGHIIVVDNKSCCVFTFQPNGKLVGRFGGRGATDRHFAGPHFVAVNNKNE-IVVTDFHNHSVKVYSADGEFLFKFGSHGEGNGQFNAPTGVAVDS 679          

HSP 3 Score: 61.6178 bits (148), Expect = 6.248e-11
Identity = 31/117 (26.50%), Postives = 57/117 (48.72%), Query Frame = 3
Query:  147 IAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVF 497
            +A++    I+ +D ++H V +   DG+ + + G       + + P G+A DS  NI + D  N RIQVF ++G ++  I    +       P  LA+     ++ V+D  NH  + +
Sbjct:  628 VAVNNKNEIVVTDFHNHSVKVYSADGEFLFKFGSHGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDSSGSFLSYINTSAEP---LYGPQGLALT-SDGHVVVADAGNHCFKAY 740          

HSP 4 Score: 55.8398 bits (133), Expect = 6.489e-9
Identity = 35/123 (28.46%), Postives = 56/123 (45.53%), Query Frame = 3
Query:  216 IDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVD 584
            I+ +L+  +G     K + +   G++  S   I + D +N  IQVFSN G++    G  G+  G    P  +AV     +I V+D  N  + +F   G +     G G     L  P+G+ VD
Sbjct:  468 IEDELVFRVGSRGREKGEFTNLQGVSAASSGRIVVADSNNQCIQVFSNEGQFKFRFGVRGRSPGQLQRPTGVAV-DTNGDIIVADYDNRWVSIFSPEGKFKTKI-GAG----RLMGPKGVAVD 584          
BLAST of SMED30029356 vs. Ensembl Mouse
Match: Trim3 (tripartite motif-containing 3 [Source:MGI Symbol;Acc:MGI:1860040])

HSP 1 Score: 83.5741 bits (205), Expect = 2.022e-18
Identity = 44/129 (34.11%), Postives = 69/129 (53.49%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFN 530
            G+A+D+N  II  D     V     +GKL+   G         + P  +A +++  I + D  NH ++V+S +GE++ + G+HG+  G F+ P  +AV     NI V+D  N RIQVFD  G++L   N
Sbjct:  580 GVAVDRNGHIIVVDNKSCCVFTFQPNGKLVGRFGGRGATDRHFAGPHFVAVNNKNEIVVTDFHNHSVKVYSADGEFLFKFGSHGEGNGQFNAPTGVAV-DSNGNIIVADWGNSRIQVFDSSGSFLSYIN 707          

HSP 2 Score: 78.5666 bits (192), Expect = 9.583e-17
Identity = 45/149 (30.20%), Postives = 72/149 (48.32%), Query Frame = 3
Query:  141 SGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDN 587
            +G+A+D N  II +D  +  V+I   +GK   +IG       +L  P G+A D   +I + D  +  +  F  NG+ +   G  G     F  PH++AV  K + I V+D  NH ++V+   G +L+ F   G        P G+ VD+
Sbjct:  537 TGVAVDTNGDIIVADYDNRWVSIFSPEGKFKTKIGA-----GRLMGPKGVAVDRNGHIIVVDNKSCCVFTFQPNGKLVGRFGGRGATDRHFAGPHFVAVNNKNE-IVVTDFHNHSVKVYSADGEFLFKFGSHGEGNGQFNAPTGVAVDS 679          

HSP 3 Score: 61.6178 bits (148), Expect = 6.248e-11
Identity = 31/117 (26.50%), Postives = 57/117 (48.72%), Query Frame = 3
Query:  147 IAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVF 497
            +A++    I+ +D ++H V +   DG+ + + G       + + P G+A DS  NI + D  N RIQVF ++G ++  I    +       P  LA+     ++ V+D  NH  + +
Sbjct:  628 VAVNNKNEIVVTDFHNHSVKVYSADGEFLFKFGSHGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDSSGSFLSYINTSAEP---LYGPQGLALT-SDGHVVVADAGNHCFKAY 740          

HSP 4 Score: 55.8398 bits (133), Expect = 6.489e-9
Identity = 35/123 (28.46%), Postives = 56/123 (45.53%), Query Frame = 3
Query:  216 IDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVD 584
            I+ +L+  +G     K + +   G++  S   I + D +N  IQVFSN G++    G  G+  G    P  +AV     +I V+D  N  + +F   G +     G G     L  P+G+ VD
Sbjct:  468 IEDELVFRVGSRGREKGEFTNLQGVSAASSGRIVVADSNNQCIQVFSNEGQFKFRFGVRGRSPGQLQRPTGVAV-DTNGDIIVADYDNRWVSIFSPEGKFKTKI-GAG----RLMGPKGVAVD 584          
BLAST of SMED30029356 vs. Ensembl Mouse
Match: Trim3 (tripartite motif-containing 3 [Source:MGI Symbol;Acc:MGI:1860040])

HSP 1 Score: 83.5741 bits (205), Expect = 2.022e-18
Identity = 44/129 (34.11%), Postives = 69/129 (53.49%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFN 530
            G+A+D+N  II  D     V     +GKL+   G         + P  +A +++  I + D  NH ++V+S +GE++ + G+HG+  G F+ P  +AV     NI V+D  N RIQVFD  G++L   N
Sbjct:  580 GVAVDRNGHIIVVDNKSCCVFTFQPNGKLVGRFGGRGATDRHFAGPHFVAVNNKNEIVVTDFHNHSVKVYSADGEFLFKFGSHGEGNGQFNAPTGVAV-DSNGNIIVADWGNSRIQVFDSSGSFLSYIN 707          

HSP 2 Score: 78.5666 bits (192), Expect = 9.583e-17
Identity = 45/149 (30.20%), Postives = 72/149 (48.32%), Query Frame = 3
Query:  141 SGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDN 587
            +G+A+D N  II +D  +  V+I   +GK   +IG       +L  P G+A D   +I + D  +  +  F  NG+ +   G  G     F  PH++AV  K + I V+D  NH ++V+   G +L+ F   G        P G+ VD+
Sbjct:  537 TGVAVDTNGDIIVADYDNRWVSIFSPEGKFKTKIGA-----GRLMGPKGVAVDRNGHIIVVDNKSCCVFTFQPNGKLVGRFGGRGATDRHFAGPHFVAVNNKNE-IVVTDFHNHSVKVYSADGEFLFKFGSHGEGNGQFNAPTGVAVDS 679          

HSP 3 Score: 61.6178 bits (148), Expect = 6.248e-11
Identity = 31/117 (26.50%), Postives = 57/117 (48.72%), Query Frame = 3
Query:  147 IAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVF 497
            +A++    I+ +D ++H V +   DG+ + + G       + + P G+A DS  NI + D  N RIQVF ++G ++  I    +       P  LA+     ++ V+D  NH  + +
Sbjct:  628 VAVNNKNEIVVTDFHNHSVKVYSADGEFLFKFGSHGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDSSGSFLSYINTSAEP---LYGPQGLALT-SDGHVVVADAGNHCFKAY 740          

HSP 4 Score: 55.8398 bits (133), Expect = 6.489e-9
Identity = 35/123 (28.46%), Postives = 56/123 (45.53%), Query Frame = 3
Query:  216 IDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVD 584
            I+ +L+  +G     K + +   G++  S   I + D +N  IQVFSN G++    G  G+  G    P  +AV     +I V+D  N  + +F   G +     G G     L  P+G+ VD
Sbjct:  468 IEDELVFRVGSRGREKGEFTNLQGVSAASSGRIVVADSNNQCIQVFSNEGQFKFRFGVRGRSPGQLQRPTGVAV-DTNGDIIVADYDNRWVSIFSPEGKFKTKI-GAG----RLMGPKGVAVD 584          
BLAST of SMED30029356 vs. Ensembl Mouse
Match: Trim2 (tripartite motif-containing 2 [Source:MGI Symbol;Acc:MGI:1933163])

HSP 1 Score: 80.1073 bits (196), Expect = 3.203e-17
Identity = 45/129 (34.88%), Postives = 69/129 (53.49%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFN 530
            G+++D+N  II  D     V I   +GK++   G   N   + + P   A +S   I I D  NH ++VF+  GE++ + G++G+  G F+ P  +AV     NI V+D  N RIQVFD  G++L   N
Sbjct:  597 GVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPHFAAVNSNNEIIITDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVAV-DSNGNIIVADWGNSRIQVFDGSGSFLSYIN 724          

HSP 2 Score: 71.633 bits (174), Expect = 2.623e-14
Identity = 42/149 (28.19%), Postives = 72/149 (48.32%), Query Frame = 3
Query:  141 SGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDN 587
            +G+A+  +  II +D  +  V+I   DGK   +IG       KL  P G++ D   +I + D     + +F  NG+ +   G+ G     F  PH+ AV    + I ++D  NH ++VF++ G ++  F  +G        P G+ VD+
Sbjct:  554 TGVAVHPSGDIIIADYDNKWVSIFSNDGKFKTKIGS-----GKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPHFAAVNSNNE-IIITDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVAVDS 696          

HSP 3 Score: 62.3882 bits (150), Expect = 3.943e-11
Identity = 36/123 (29.27%), Postives = 60/123 (48.78%), Query Frame = 3
Query:  216 IDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVD 584
            I+  LI  +G    NK + +   G+A  +   I I D +N  +Q+FSN+G++    G  G+  G    P  +AV P + +I ++D  N  + +F   G +     G G     L  P+G++VD
Sbjct:  485 IEDDLIFRVGTKGRNKGEFTNLQGVAASTSGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVAVHP-SGDIIIADYDNKWVSIFSNDGKFKTKI-GSG----KLMGPKGVSVD 601          
BLAST of SMED30029356 vs. UniProt/SwissProt
Match: sp|Q03601|NHL1_CAEEL (RING finger protein nhl-1 OS=Caenorhabditis elegans OX=6239 GN=nhl-1 PE=1 SV=2)

HSP 1 Score: 146.362 bits (368), Expect = 1.854e-39
Identity = 64/155 (41.29%), Postives = 100/155 (64.52%), Query Frame = 3
Query:  126 KFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            + D  +G+A  K  R+I SDRY+HR+++  ++G  +   G      AK + PWG+A D   +I++ DKDNHR+QVF  NG++I + G+ G   G  ++P ++AV   T +++VSD+SNHRI VFD HG +L+SF  +G      K+PRGI +D++
Sbjct:  758 QLDSAAGLASSK-LRVIVSDRYNHRISVFGLEGDHLFSFGGHGQGNAKFNNPWGVAVDDLGSIYVADKDNHRVQVFDKNGQFIAKFGSFGHLPGQLNSPLFIAVSRVTHHVYVSDSSNHRISVFDPHGVHLFSFGEEGFHGGQFKFPRGIAIDSQ 911          

HSP 2 Score: 83.5741 bits (205), Expect = 1.213e-17
Identity = 47/146 (32.19%), Postives = 77/146 (52.74%), Query Frame = 3
Query:  126 KFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDS-RQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLK 560
            KF+   G+A+D    I  +D+ +HRV + D +G+ I + G   +   +L+ P  IA      ++++ D  NHRI VF  +G ++   G  G   G F  P  +A+    +N+ ++D+ N+RIQVFD  G ++ SF   G     LK
Sbjct:  804 KFNNPWGVAVDDLGSIYVADKDNHRVQVFDKNGQFIAKFGSFGHLPGQLNSPLFIAVSRVTHHVYVSDSSNHRISVFDPHGVHLFSFGEEGFHGGQFKFPRGIAI-DSQENLIIADSGNNRIQVFDAQGQFVSSFGTWGGGAGQLK 948          

HSP 3 Score: 77.0258 bits (188), Expect = 2.606e-15
Identity = 39/115 (33.91%), Postives = 58/115 (50.43%), Query Frame = 3
Query:  243 GKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDN 587
            G+      +L++P GI   S   +  CD  NHR+ VF  +G+++++ G +G   G  D+   LA       + VSD  NHRI VF   G +L+SF G G        P G+ VD+
Sbjct:  703 GRKGAKDGELNWPRGICALSGGLVATCDSSNHRVCVFDKDGKFVRQFGGYGAGAGQLDSAAGLA--SSKLRVIVSDRYNHRISVFGLEGDHLFSFGGHGQGNAKFNNPWGVAVDD 815          

HSP 4 Score: 72.7886 bits (177), Expect = 7.590e-14
Identity = 38/118 (32.20%), Postives = 61/118 (51.69%), Query Frame = 3
Query:  147 IAIDK-NKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVF 497
            IA+ +    +  SD  +HR+++ D  G  +   G+   +  +  +P GIA DS++N+ I D  N+RIQVF   G+++   G  G   G       + V     +I V+D  NHRIQ+F
Sbjct:  858 IAVSRVTHHVYVSDSSNHRISVFDPHGVHLFSFGEEGFHGGQFKFPRGIAIDSQENLIIADSGNNRIQVFDAQGQFVSSFGTWGGGAGQLKGVEDVCVTAD-GSIVVTDRENHRIQIF 974          
BLAST of SMED30029356 vs. UniProt/SwissProt
Match: sp|Q9U489|LIN41_CAEEL (Protein lin-41 OS=Caenorhabditis elegans OX=6239 GN=lin-41 PE=1 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 1.571e-27
Identity = 59/146 (40.41%), Postives = 82/146 (56.16%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKN-IFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKF-HLKYPRGI 575
            GI +D+  R+I +DR ++RV I D DG  I + G S N   +   P GI T+S  NI + DKDNHR+QVF  NG ++ + G  G+  G F+ P    V   + N I VSDT NHR+Q+F   G ++     D    F +L  PRG+
Sbjct:  850 GICVDQRGRVIVADRSNNRVQIFDKDGNFISKFGTSGNRPGQFDRPAGITTNSLNNIVVADKDNHRVQVFDENGMFLLKFGDRGRAVGYFNYP--WGVATNSHNAIAVSDTRNHRVQIFTPQGQFVRKCGFDSAYFFKNLDSPRGL 993          

HSP 2 Score: 93.2041 bits (230), Expect = 7.116e-21
Identity = 41/119 (34.45%), Postives = 63/119 (52.94%), Query Frame = 3
Query:  231 ICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDN 587
            I   GK  +   +L  PWGI  D R  + + D+ N+R+Q+F  +G +I + G  G + G FD P  +       NI V+D  NHR+QVFD++G +L  F   G    +  YP G+  ++
Sbjct:  832 ILTFGKEGSGDGELCRPWGICVDQRGRVIVADRSNNRVQIFDKDGNFISKFGTSGNRPGQFDRPAGITT-NSLNNIVVADKDNHRVQVFDENGMFLLKFGDRGRAVGYFNYPWGVATNS 949          

HSP 3 Score: 87.8113 bits (216), Expect = 4.721e-19
Identity = 49/167 (29.34%), Postives = 83/167 (49.70%), Query Frame = 3
Query:  102 GTDDNVQLKFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQ-CGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTY---LYSFNGDGPTKFHLKYPRGITVDNE 590
            GT  N   +FD  +GI  +    I+ +D+ +HRV + D +G  + + G         +YPWG+AT+S   I + D  NHR+Q+F+  G+++++ G          D+P  L   P  + + ++D +NHR+ V          +Y   GDG   F    P+G+ +D E
Sbjct:  883 GTSGNRPGQFDRPAGITTNSLNNIVVADKDNHRVQVFDENGMFLLKFGDRGRAVGYFNYPWGVATNSHNAIAVSDTRNHRVQIFTPQGQFVRKCGFDSAYFFKNLDSPRGLCYLPDGQ-LLITDFNNHRLAVLSPRNMSEMKVYGSEGDGDGMF--VRPQGVVIDPE 1046          
BLAST of SMED30029356 vs. UniProt/SwissProt
Match: sp|Q1PSW8|LIN41_MOUSE (E3 ubiquitin-protein ligase TRIM71 OS=Mus musculus OX=10090 GN=Trim71 PE=1 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 4.813e-26
Identity = 53/149 (35.57%), Postives = 84/149 (56.38%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            G+++DK   II +DR ++R+ +    G    + G   +   +   P G+A D+ + I + DKDNHRIQ+F+  G+++ + G  G + G F+ P  +AV  + K I VSDT NHRIQ+F   G +L  +  +G    H   PRG+  +NE
Sbjct:  598 GVSVDKEGFIIVADRSNNRIQVFKPCGSFHHKFGTLGSRPGQFDRPAGVACDASRRIIVADKDNHRIQIFTFEGQFLLKFGEKGTKNGQFNYPWDVAVNSEGK-ILVSDTRNHRIQLFGPDGVFLNKYGFEGSLWKHFDSPRGVAFNNE 745          

HSP 2 Score: 95.5153 bits (236), Expect = 9.867e-22
Identity = 46/155 (29.68%), Postives = 80/155 (51.61%), Query Frame = 3
Query:  126 KFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            +FD  +G+A D ++RII +D+ +HR+ I   +G+ + + G+      + +YPW +A +S   I + D  NHRIQ+F  +G ++ + G  G     FD+P  +A      ++ V+D +NHR+ V             +G        P+G+ VD E
Sbjct:  639 QFDRPAGVACDASRRIIVADKDNHRIQIFTFEGQFLLKFGEKGTKNGQFNYPWDVAVNSEGKILVSDTRNHRIQLFGPDGVFLNKYGFEGSLWKHFDSPRGVAF-NNEGHLVVTDFNNHRLLVIHPDCQSARFLGSEGSGNGQFLRPQGVAVDQE 792          

HSP 3 Score: 87.0409 bits (214), Expect = 7.954e-19
Identity = 41/116 (35.34%), Postives = 60/116 (51.72%), Query Frame = 3
Query:  243 GKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            G   + + KL  PWG++ D    I + D+ N+RIQVF   G +  + G  G + G FD P  +A C  ++ I V+D  NHRIQ+F   G +L  F   G       YP  + V++E
Sbjct:  584 GSEGDGEGKLCRPWGVSVDKEGFIIVADRSNNRIQVFKPCGSFHHKFGTLGSRPGQFDRPAGVA-CDASRRIIVADKDNHRIQIFTFEGQFLLKFGEKGTKNGQFNYPWDVAVNSE 698          

HSP 4 Score: 74.3294 bits (181), Expect = 2.128e-14
Identity = 38/123 (30.89%), Postives = 61/123 (49.59%), Query Frame = 3
Query:  129 FDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVF 497
            FD   G+A +    ++ +D  +HR+ ++  D +    +G   +   +   P G+A D    I + D  NHR+Q+F  NG ++ + GA G   G  D P  +AV P    I V D  N+RI +F
Sbjct:  734 FDSPRGVAFNNEGHLVVTDFNNHRLLVIHPDCQSARFLGSEGSGNGQFLRPQGVAVDQEGRIIVADSRNHRVQMFEANGSFLCKFGAQGSGFGQMDRPSGIAVTPDGL-IVVVDFGNNRILIF 855          
BLAST of SMED30029356 vs. UniProt/SwissProt
Match: sp|E7FAM5|LIN41_DANRE (E3 ubiquitin-protein ligase TRIM71 OS=Danio rerio OX=7955 GN=trim71 PE=1 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 2.065e-25
Identity = 54/149 (36.24%), Postives = 85/149 (57.05%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            GI +DK   ++ +DR ++RV I    G    + G   +   +   P G+A DS++ I + DKDNHRIQ+F+ +G+++ + G  G + G F+ P  +AV  + K I VSDT NHR+Q+F   GT+L  +  +G    H   PRG+  + E
Sbjct:  567 GICVDKEGYVVVADRSNNRVQIFKPCGTFHHKFGTLGSRPGQFDRPAGVACDSQRRIIVADKDNHRIQIFTFDGQFLLKFGEKGTKNGQFNYPWDVAVNFEGK-ILVSDTRNHRVQLFGPDGTFLNKYGFEGALWKHFDSPRGVAFNQE 714          

HSP 2 Score: 92.8189 bits (229), Expect = 9.281e-21
Identity = 45/155 (29.03%), Postives = 79/155 (50.97%), Query Frame = 3
Query:  126 KFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            +FD  +G+A D  +RII +D+ +HR+ I   DG+ + + G+      + +YPW +A +    I + D  NHR+Q+F  +G ++ + G  G     FD+P  +A   +  ++ V+D +NHR+ V             +G        P+G+ VD E
Sbjct:  608 QFDRPAGVACDSQRRIIVADKDNHRIQIFTFDGQFLLKFGEKGTKNGQFNYPWDVAVNFEGKILVSDTRNHRVQLFGPDGTFLNKYGFEGALWKHFDSPRGVAF-NQEGHLVVTDFNNHRLLVIRPDCQSARFLGSEGTGNGQFLRPQGVAVDQE 761          

HSP 3 Score: 78.5666 bits (192), Expect = 6.773e-16
Identity = 39/123 (31.71%), Postives = 58/123 (47.15%), Query Frame = 3
Query:  222 GKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            G  +   G   +   +L  PWGI  D    + + D+ N+R+Q+F   G +  + G  G + G FD P  +A C   + I V+D  NHRIQ+F   G +L  F   G       YP  + V+ E
Sbjct:  546 GLPMASFGGEGDGDGQLCRPWGICVDKEGYVVVADRSNNRVQIFKPCGTFHHKFGTLGSRPGQFDRPAGVA-CDSQRRIIVADKDNHRIQIFTFDGQFLLKFGEKGTKNGQFNYPWDVAVNFE 667          

HSP 4 Score: 73.9442 bits (180), Expect = 2.634e-14
Identity = 39/123 (31.71%), Postives = 60/123 (48.78%), Query Frame = 3
Query:  129 FDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVF 497
            FD   G+A ++   ++ +D  +HR+ ++  D +    +G       +   P G+A D    I + D  NHRIQVF  NG ++ + G HG   G  D P  +AV P    I   D  N+RI +F
Sbjct:  703 FDSPRGVAFNQEGHLVVTDFNNHRLLVIRPDCQSARFLGSEGTGNGQFLRPQGVAVDQEDRIIVADSRNHRIQVFEPNGNFLCKFGTHGNGFGQMDRPSGIAVTPDGV-IVAVDFGNNRILMF 824          
BLAST of SMED30029356 vs. UniProt/SwissProt
Match: sp|D3ZVM4|LIN41_RAT (E3 ubiquitin-protein ligase TRIM71 OS=Rattus norvegicus OX=10116 GN=Trim71 PE=3 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 2.225e-25
Identity = 52/149 (34.90%), Postives = 84/149 (56.38%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            G+++DK   II +DR ++R+ +    G    + G   +   +   P G+A D+ + I + DKDNHRIQ+F+  G+++ + G  G + G F+ P  +AV  + K I VSDT NHRIQ+F   G +L  +  +G    H   PRG+  ++E
Sbjct:  598 GVSVDKEGYIIVADRSNNRIQVFKPCGSFHHKFGTLGSRPGQFDRPAGVACDASRRIVVADKDNHRIQIFTFEGQFLLKFGEKGTKNGQFNYPWDVAVNSEGK-ILVSDTRNHRIQLFGPDGVFLNKYGFEGSLWKHFDSPRGVAFNHE 745          

HSP 2 Score: 95.1301 bits (235), Expect = 1.162e-21
Identity = 53/201 (26.37%), Postives = 89/201 (44.28%), Query Frame = 3
Query:  126 KFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNP------------------HYLAV----CPKTK------------------------NIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            +FD  +G+A D ++RI+ +D+ +HR+ I   +G+ + + G+      + +YPW +A +S   I + D  NHRIQ+F  +G ++ + G  G     FD+P                  H L V    C   +                         I V+D+ NHR+Q+F+ +G++L  F   G     +  P GI V  E
Sbjct:  639 QFDRPAGVACDASRRIVVADKDNHRIQIFTFEGQFLLKFGEKGTKNGQFNYPWDVAVNSEGKILVSDTRNHRIQLFGPDGVFLNKYGFEGSLWKHFDSPRGVAFNHEGHLVVTDFNNHRLLVIHPDCQSARFLGSEGTGNGQFLRPQGVAVDQEGRIIVADSRNHRVQMFEANGSFLCKFGAQGSGFGQMDRPSGIAVTPE 839          

HSP 3 Score: 87.8113 bits (216), Expect = 4.876e-19
Identity = 42/123 (34.15%), Postives = 62/123 (50.41%), Query Frame = 3
Query:  222 GKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            G  +   G   + + KL  PWG++ D    I + D+ N+RIQVF   G +  + G  G + G FD P  +A C  ++ I V+D  NHRIQ+F   G +L  F   G       YP  + V++E
Sbjct:  577 GLPVLSFGSEGDGEGKLCRPWGVSVDKEGYIIVADRSNNRIQVFKPCGSFHHKFGTLGSRPGQFDRPAGVA-CDASRRIVVADKDNHRIQIFTFEGQFLLKFGEKGTKNGQFNYPWDVAVNSE 698          

HSP 4 Score: 74.3294 bits (181), Expect = 1.972e-14
Identity = 38/123 (30.89%), Postives = 61/123 (49.59%), Query Frame = 3
Query:  129 FDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVF 497
            FD   G+A +    ++ +D  +HR+ ++  D +    +G       +   P G+A D    I + D  NHR+Q+F  NG ++ + GA G   G  D P  +AV P+   I V D  N+RI +F
Sbjct:  734 FDSPRGVAFNHEGHLVVTDFNNHRLLVIHPDCQSARFLGSEGTGNGQFLRPQGVAVDQEGRIIVADSRNHRVQMFEANGSFLCKFGAQGSGFGQMDRPSGIAVTPEGL-IVVVDFGNNRILIF 855          
BLAST of SMED30029356 vs. TrEMBL
Match: A0A2T7PAN7 (RING-type domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_09743 PE=4 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 3.710e-46
Identity = 73/155 (47.10%), Postives = 107/155 (69.03%), Query Frame = 3
Query:  126 KFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            +FDCL+GI ++   ++I +DRY+HR+ I D +G      G    N  +L+YPWGIA D+   I++CDK+NHR+QVF +NG ++++ G  G   G FDNPHY+AV P  K ++VSD+SNHRIQVF  +G +L+SF   G  +  +K+PRGI +DN+
Sbjct:  652 EFDCLAGITVNGLGQVIIADRYNHRIQIFDRNGSFQSAFGSEGINDGQLNYPWGIACDNMGFIYVCDKENHRVQVFQSNGSFVRKFGRLGNGTGHFDNPHYVAVSPDNK-VYVSDSSNHRIQVFSIYGDFLFSFGTSGTLRGQMKFPRGIAIDNQ 805          

HSP 2 Score: 63.929 bits (154), Expect = 2.271e-8
Identity = 34/124 (27.42%), Postives = 59/124 (47.58%), Query Frame = 3
Query:  129 FDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFD 500
            FD    +A+  + ++  SD  +HR+ +  I G  +   G S   + ++ +P GIA D++  + + D  N+R+Q+F  +G Y    G  G + G F     +A+      + V     H IQV D
Sbjct:  747 FDNPHYVAVSPDNKVYVSDSSNHRIQVFSIYGDFLFSFGTSGTLRGQMKFPRGIAIDNQGFVVVADSGNNRVQIFRADGRYYSMFGGWGSENGQFKGLEGIAILANGNVVSV-----HPIQVDD 865          
BLAST of SMED30029356 vs. TrEMBL
Match: C3ZPM4 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_88379 PE=4 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 4.680e-46
Identity = 73/155 (47.10%), Postives = 105/155 (67.74%), Query Frame = 3
Query:  126 KFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            +FDCL+G+ ++    I+ +DRY+HRV I D +G+ I + G+  +   +LSYPWG+ATD    I++CDKDNHR+QVF  +G ++++ G  G   G F+NPHY+AV    K + VSD+SNHRIQVFDK+G ++  F  +G      KYPRG+ VD E
Sbjct:  504 EFDCLAGVTVNSQGWIVTADRYNHRVQIFDSNGRFIRQFGQEGSRDGQLSYPWGVATDRMGFIYVCDKDNHRVQVFRLDGAFVRKFGRLGNGNGQFENPHYIAVARDNK-VIVSDSSNHRIQVFDKYGRFVLKFGSEGSGNGQFKYPRGVAVDQE 657          

HSP 2 Score: 77.0258 bits (188), Expect = 8.597e-13
Identity = 37/121 (30.58%), Postives = 62/121 (51.24%), Query Frame = 3
Query:  222 GKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVD 584
            G +  + G   ++    ++P G+A      I + D  NHR+QVF+ NG+ ++  G++G   G FD    + V  +   I  +D  NHR+Q+FD +G ++  F  +G     L YP G+  D
Sbjct:  442 GLIQTKFGSKGSDLGHFTWPRGVAVSPENYIIVADSSNHRVQVFTPNGQLVRVFGSYGTGEGEFDCLAGVTVNSQGW-IVTADRYNHRVQIFDSNGRFIRQFGQEGSRDGQLSYPWGVATD 561          

HSP 3 Score: 63.1586 bits (152), Expect = 3.991e-8
Identity = 26/87 (29.89%), Postives = 47/87 (54.02%), Query Frame = 3
Query:  147 IAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCG 407
            IA+ ++ ++I SD  +HR+ + D  G+ + + G   +   +  YP G+A D   +I + D  N+R+QVF  +G ++   G  G   G
Sbjct:  605 IAVARDNKVIVSDSSNHRIQVFDKYGRFVLKFGSEGSGNGQFKYPRGVAVDQEGHIIVGDSGNNRLQVFRQDGSFLCAFGTWGSGDG 691          
BLAST of SMED30029356 vs. TrEMBL
Match: A0A3S1BIG0 (Uncharacterized protein (Fragment) OS=Elysia chlorotica OX=188477 GN=EGW08_003169 PE=4 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 1.767e-45
Identity = 79/182 (43.41%), Postives = 117/182 (64.29%), Query Frame = 3
Query:   45 IFSDKGVCEKVIPEMVCDQGTDDNVQLKFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            +FS +GV  K       D+G       +FDCL+GIA++   ++I +DRY+HRV I D +G      G    N  +L+YPWG+A D+   I++CDK+N+RIQVF +NG Y++  G+ G   G F NPHY+AV P  K ++VSD+SNHRIQVF  +G +++SF   G  +  +K+PRGI +D++
Sbjct:  644 VFSSRGVFIKTFGRHGQDEG-------EFDCLAGIAVNGLGQVIIADRYNHRVQIFDRNGVFQRAFGSEGRNPGQLNYPWGVACDNMGFIYVCDKENNRIQVFQSNGSYVRMFGSQGSLPGQFVNPHYIAVSPDNK-VYVSDSSNHRIQVFSLYGDFIFSFGSCGSLRGQMKFPRGIAIDHQ 817          

HSP 2 Score: 70.8626 bits (172), Expect = 1.068e-10
Identity = 36/117 (30.77%), Postives = 61/117 (52.14%), Query Frame = 3
Query:  147 IAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVF 497
            IA+  + ++  SD  +HR+ +  + G  I   G   + + ++ +P GIA D +  + + D  N+RIQVF ++G +    G+ G + G F     LA+    K I V D  NH +Q+F
Sbjct:  765 IAVSPDNKVYVSDSSNHRIQVFSLYGDFIFSFGSCGSLRGQMKFPRGIAIDHQGFVVVADSGNNRIQVFRSDGRFYSMFGSWGCERGHFKGLEGLAILADGK-IAVGDRENHCVQIF 880          
BLAST of SMED30029356 vs. TrEMBL
Match: A0A2C9JJJ9 (RING-type domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106075207 PE=4 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 5.391e-45
Identity = 72/154 (46.75%), Postives = 108/154 (70.13%), Query Frame = 3
Query:  129 FDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            FDCL+G+AI+   ++I +DRY+HR+ I D  G+     G   + + +L+YPWG+A D+   I++CDK+NHR+QVF +NG Y++  G  G + G F+NPHY+AV P  K ++VSD+SNHRIQVF  +G +L++F   G  +  +K+PRGI VDN+
Sbjct:  656 FDCLAGVAINGLGQVIIADRYNHRIQIFDRCGRFQNAFGSEGSGEGQLNYPWGVACDNMGFIYVCDKENHRVQVFQSNGTYVRMFGRLGTRPGEFENPHYIAVSPDNK-VYVSDSSNHRIQVFSMYGDFLFTFGTCGALRGQMKFPRGIAVDNQ 808          

HSP 2 Score: 86.2705 bits (212), Expect = 4.369e-16
Identity = 41/123 (33.33%), Postives = 69/123 (56.10%), Query Frame = 3
Query:  222 GKLICEIGKSSNNKAKLSYPWGIATDSRQ-NIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDN 587
            G  +   G+  ++ A+ ++P G++      NI++ D  NHR+QVF + G+++K  G HGQ  G FD    +A+      + ++D  NHRIQ+FD+ G +  +F  +G  +  L YP G+  DN
Sbjct:  592 GTALVRFGQRGSDIAQFTWPRGVSVSPMDDNIYVADSSNHRVQVFDSTGKFLKTFGQHGQGEGDFDCLAGVAI-NGLGQVIIADRYNHRIQIFDRCGRFQNAFGSEGSGEGQLNYPWGVACDN 713          

HSP 3 Score: 74.7146 bits (182), Expect = 4.078e-12
Identity = 35/117 (29.91%), Postives = 61/117 (52.14%), Query Frame = 3
Query:  147 IAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVF 497
            IA+  + ++  SD  +HR+ +  + G  +   G     + ++ +P GIA D++  + + D  N+R+Q+F  +G +    G  G + G F     L++     NI VSD  NHRIQ+F
Sbjct:  756 IAVSPDNKVYVSDSSNHRIQVFSMYGDFLFTFGTCGALRGQMKFPRGIAVDNQGFVVVADSGNNRVQIFRADGRFYSMFGGWGNENGQFKGLEGLSIL-TNGNIVVSDRENHRIQIF 871          
BLAST of SMED30029356 vs. TrEMBL
Match: A0A0A9Y5M2 (RING finger protein nhl-1 OS=Lygus hesperus OX=30085 GN=nhl-1_1 PE=4 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 6.309e-45
Identity = 72/163 (44.17%), Postives = 111/163 (68.10%), Query Frame = 3
Query:  102 GTDDNVQLKFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            GT  N + +FDCL+GIA+++  + I +DRY+HR+ +MD  G+ +   G    +  K +YPWGI TD+   I++CDK+NHR+QVF ++G ++ + G+HG + G  D+PHY+AV   T  + VSD++NHRIQVFD +G  L SF  +G  +   K+PRG+ VD++
Sbjct: 1017 GTYGNGEGEFDCLAGIAVNRIGQFIIADRYNHRIQVMDPSGRFLRAFGSQGTSDGKFNYPWGITTDALGFIYVCDKENHRVQVFQSDGTFVGKFGSHGSKIGQLDHPHYIAV-SNTNKVIVSDSNNHRIQVFDVNGRVLSSFGQEGSEEGQFKFPRGVAVDDQ 1178          

HSP 2 Score: 89.3521 bits (220), Expect = 4.340e-17
Identity = 41/117 (35.04%), Postives = 67/117 (57.26%), Query Frame = 3
Query:  147 IAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVF 497
            IA+    ++I SD  +HR+ + D++G+++   G+  + + +  +P G+A D +  I + D  N+RIQ+F+  GE+I+  G  G   G F     +AV   + NI V D  NHRIQVF
Sbjct: 1126 IAVSNTNKVIVSDSNNHRIQVFDVNGRVLSSFGQEGSEEGQFKFPRGVAVDDQGYILVGDSGNNRIQIFTAEGEFIRAFGCWGSGEGEFKGLEGVAVMSNS-NILVCDRENHRIQVF 1241          

HSP 3 Score: 83.1889 bits (204), Expect = 6.055e-15
Identity = 42/118 (35.59%), Postives = 61/118 (51.69%), Query Frame = 3
Query:  231 ICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVD 584
            +  +G   +     ++P G+AT    +I + D  NHR+QVF +NG + KE G +G   G FD    +AV  +     ++D  NHRIQV D  G +L +F   G +     YP GIT D
Sbjct:  966 VFSVGSRGSEPGYFTWPRGVATGPDNSIVVADSSNHRVQVFDSNGLFQKEFGTYGNGEGEFDCLAGIAV-NRIGQFIIADRYNHRIQVMDPSGRFLRAFGSQGTSDGKFNYPWGITTD 1082          
BLAST of SMED30029356 vs. Ensembl Cavefish
Match: ENSAMXT00000052572.1 (E3 ubiquitin-protein ligase TRIM71-like [Source:NCBI gene;Acc:103046967])

HSP 1 Score: 111.309 bits (277), Expect = 3.500e-28
Identity = 55/149 (36.91%), Postives = 83/149 (55.70%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            GIA+D    +I +DR ++RV +   DG      G   +   +   P G+A D ++ I + DKDNHRIQ+F+ +G ++   G  G + G F+ P  +AV   T  I VSDT NHRIQ+F  +G++L  +  +GP   H   PRG++   E
Sbjct:  518 GIAVDSEGFVIVADRSNNRVQVFGPDGSFQHAFGSLGSQPGEFDRPAGVACDLQRRIIVADKDNHRIQIFTFHGRFLFTFGEKGSKNGQFNYPWDVAV-NSTGQILVSDTRNHRIQLFSSNGSFLNKYGFEGPLWKHFDSPRGVSFTRE 665          

HSP 2 Score: 98.9821 bits (245), Expect = 6.078e-24
Identity = 58/200 (29.00%), Postives = 91/200 (45.50%), Query Frame = 3
Query:  126 KFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNP-------------------HYLAVCPKTKN---------------------------IFVSDTSNHRIQVFDKHGTYLYSF--NGDGPTKFHLKYPRGITV 581
            +FD  +G+A D  +RII +D+ +HR+ I    G+ +   G+  +   + +YPW +A +S   I + D  NHRIQ+FS+NG ++ + G  G     FD+P                     L + P  K+                           I V+D+ NHR+QVF + GT+L  F   GDGP +  +  P G+ V
Sbjct:  559 EFDRPAGVACDLQRRIIVADKDNHRIQIFTFHGRFLFTFGEKGSKNGQFNYPWDVAVNSTGQILVSDTRNHRIQLFSSNGSFLNKYGFEGPLWKHFDSPRGVSFTREGHLVVTDFNNHRMLVIQPDCKSARFLGTEGTGNGQFMRPQGVAVDRENRIIVADSRNHRLQVFQQDGTFLCKFGTQGDGPGQ--MDCPSGLAV 756          

HSP 3 Score: 92.4337 bits (228), Expect = 1.427e-21
Identity = 43/124 (34.68%), Postives = 65/124 (52.42%), Query Frame = 3
Query:  216 IDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDN 587
            + G  +   G     + +L  PWGIA DS   + + D+ N+R+QVF  +G +    G+ G Q G FD P  +A C   + I V+D  NHRIQ+F  HG +L++F   G       YP  + V++
Sbjct:  495 LSGLPVATFGSEGEAEGQLCRPWGIAVDSEGFVIVADRSNNRVQVFGPDGSFQHAFGSLGSQPGEFDRPAGVA-CDLQRRIIVADKDNHRIQIFTFHGRFLFTFGEKGSKNGQFNYPWDVAVNS 617          

HSP 4 Score: 70.0922 bits (170), Expect = 5.735e-14
Identity = 38/123 (30.89%), Postives = 58/123 (47.15%), Query Frame = 3
Query:  129 FDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVF 497
            FD   G++  +   ++ +D  +HR+ ++  D K    +G       +   P G+A D    I + D  NHR+QVF  +G ++ + G  G   G  D P  LAV P    I V D  N+RI  F
Sbjct:  654 FDSPRGVSFTREGHLVVTDFNNHRMLVIQPDCKSARFLGTEGTGNGQFMRPQGVAVDRENRIIVADSRNHRLQVFQQDGTFLCKFGTQGDGPGQMDCPSGLAVTPDGL-IVVVDFGNNRILKF 775          

HSP 5 Score: 50.8322 bits (120), Expect = 2.359e-7
Identity = 25/84 (29.76%), Postives = 42/84 (50.00%), Query Frame = 3
Query:  102 GTDDNVQLKFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVF 353
            GT+     +F    G+A+D+  RII +D  +HR+ +   DG  +C+ G   +   ++  P G+A      I + D  N+RI  F
Sbjct:  692 GTEGTGNGQFMRPQGVAVDRENRIIVADSRNHRLQVFQQDGTFLCKFGTQGDGPGQMDCPSGLAVTPDGLIVVVDFGNNRILKF 775          
BLAST of SMED30029356 vs. Ensembl Cavefish
Match: trim71 (tripartite motif containing 71 [Source:NCBI gene;Acc:103034143])

HSP 1 Score: 105.531 bits (262), Expect = 3.207e-26
Identity = 53/149 (35.57%), Postives = 84/149 (56.38%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            GI +DK   +I +DR ++R+ I    G    + G   +   +   P G+A DS++ I + DKDNHRIQ+F+ +G+++ + G  G + G F+ P  +AV  + K I VSDT NHR+Q+F   G +L  +  +G    H   PRG+  + E
Sbjct:  555 GICVDKEGYVIVADRSNNRIQIFKPCGTFHHKFGTLGSRPGQFDRPAGVACDSQRRIIVADKDNHRIQIFTFDGQFLLKFGEKGTKNGQFNYPWDVAVNSEGK-ILVSDTRNHRVQLFGPDGVFLNKYGFEGALWKHFDSPRGVAFNQE 702          

HSP 2 Score: 94.7449 bits (234), Expect = 1.916e-22
Identity = 46/155 (29.68%), Postives = 80/155 (51.61%), Query Frame = 3
Query:  126 KFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            +FD  +G+A D  +RII +D+ +HR+ I   DG+ + + G+      + +YPW +A +S   I + D  NHR+Q+F  +G ++ + G  G     FD+P  +A   +  ++ V+D +NHR+ V             +G        P+G+ VD E
Sbjct:  596 QFDRPAGVACDSQRRIIVADKDNHRIQIFTFDGQFLLKFGEKGTKNGQFNYPWDVAVNSEGKILVSDTRNHRVQLFGPDGVFLNKYGFEGALWKHFDSPRGVAF-NQEGHLVVTDFNNHRLLVIRPDCQSARFLGSEGTGNGQFLRPQGVAVDQE 749          

HSP 3 Score: 83.5741 bits (205), Expect = 1.711e-18
Identity = 41/123 (33.33%), Postives = 61/123 (49.59%), Query Frame = 3
Query:  222 GKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            G  I   G   +++ +L  PWGI  D    + + D+ N+RIQ+F   G +  + G  G + G FD P  +A C   + I V+D  NHRIQ+F   G +L  F   G       YP  + V++E
Sbjct:  534 GLPIASFGGEGDSEGQLCRPWGICVDKEGYVIVADRSNNRIQIFKPCGTFHHKFGTLGSRPGQFDRPAGVA-CDSQRRIIVADKDNHRIQIFTFDGQFLLKFGEKGTKNGQFNYPWDVAVNSE 655          

HSP 4 Score: 71.633 bits (174), Expect = 1.970e-14
Identity = 38/123 (30.89%), Postives = 59/123 (47.97%), Query Frame = 3
Query:  129 FDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVF 497
            FD   G+A ++   ++ +D  +HR+ ++  D +    +G       +   P G+A D    I + D  NHRIQVF  NG ++ + G  G   G  D P  +AV P    I   D  N+RI +F
Sbjct:  691 FDSPRGVAFNQEGHLVVTDFNNHRLLVIRPDCQSARFLGSEGTGNGQFLRPQGVAVDQEDRIIVADSRNHRIQVFEPNGNFLCKFGTQGSGFGQMDRPSGIAVTPDGM-IVAVDFGNNRILMF 812          
BLAST of SMED30029356 vs. Ensembl Cavefish
Match: trim3a (tripartite motif containing 3a [Source:ZFIN;Acc:ZDB-GENE-080522-4])

HSP 1 Score: 88.1965 bits (217), Expect = 3.850e-20
Identity = 50/149 (33.56%), Postives = 83/149 (55.70%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            G+A+DKN  II +D     V I   +GKL+ + G    +  + S P  +A +++  I + D  NH ++V++ +GE++ + G+HG+  G F+ P  +AV     NI V+D  N RIQVFD  G++L   N    T   L  P+G+ + ++
Sbjct:  551 GVAVDKNGHIIAADNKACCVFIFQSNGKLVTKFGAKGTSDRQFSGPHFVAVNNKNEIVVTDFHNHSVKVYNADGEFLFKFGSHGEGNGQFNAPTGVAV-DGNGNIIVADWGNSRIQVFDSSGSFLSYIN---TTADPLYGPQGLALTSD 695          

HSP 2 Score: 79.337 bits (194), Expect = 3.676e-17
Identity = 45/148 (30.41%), Postives = 72/148 (48.65%), Query Frame = 3
Query:  141 SGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVD 584
            +G+ +D N  II +D  +  + I   DGK   +IG       +L  P G+A D   +I   D     + +F +NG+ + + GA G     F  PH++AV  K + I V+D  NH ++V++  G +L+ F   G        P G+ VD
Sbjct:  508 TGVTVDMNGDIIVADYDNRWITIFSSDGKFKSKIGA-----GRLMGPKGVAVDKNGHIIAADNKACCVFIFQSNGKLVTKFGAKGTSDRQFSGPHFVAVNNKNE-IVVTDFHNHSVKVYNADGEFLFKFGSHGEGNGQFNAPTGVAVD 649          

HSP 3 Score: 56.9954 bits (136), Expect = 1.724e-9
Identity = 39/123 (31.71%), Postives = 58/123 (47.15%), Query Frame = 3
Query:  216 IDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVD 584
            I+ +LI  +G     + + S   GI+T S   I + D +N  IQVFSN+G++    G  G+  G    P  + V     +I V+D  N  I +F   G +  S  G G     L  P+G+ VD
Sbjct:  439 IEDELIYRVGTRGRERGEFSNLQGISTSSNGRIVVADSNNQCIQVFSNDGQFKLRFGVRGRSPGQLQRPTGVTV-DMNGDIIVADYDNRWITIFSSDGKF-KSKIGAG----RLMGPKGVAVD 555          
BLAST of SMED30029356 vs. Ensembl Cavefish
Match: trim2b (tripartite motif containing 2b [Source:ZFIN;Acc:ZDB-GENE-090312-70])

HSP 1 Score: 81.6481 bits (200), Expect = 7.201e-18
Identity = 44/129 (34.11%), Postives = 69/129 (53.49%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFN 530
            G+++D+N  +I  D     V I    GKL+ + G   N   + + P   A ++   I + D  NH ++VFS  GE++ + G++G+  G F+ P  +AV     NI V+D  N RIQVFD  G++L   N
Sbjct:  487 GVSVDQNGHVIVVDNKACMVFIFQPSGKLVTKFGSRGNGDKQFAGPHFAAVNNNNEIIVTDFHNHSVKVFSAEGEFLLKFGSNGEGNGQFNAPTGVAV-DVNGNIIVADWGNSRIQVFDGSGSFLSYIN 614          

HSP 2 Score: 72.0182 bits (175), Expect = 1.236e-14
Identity = 41/148 (27.70%), Postives = 69/148 (46.62%), Query Frame = 3
Query:  141 SGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVD 584
            +G+A+  N  II +D  +  V+I   DGK   ++G       +L  P G++ D   ++ + D     + +F  +G+ + + G+ G     F  PH+ AV      I V+D  NH ++VF   G +L  F  +G        P G+ VD
Sbjct:  444 TGVAVHPNGDIIIADYDNKWVSIFTSDGKYKAKLGS-----GRLMGPKGVSVDQNGHVIVVDNKACMVFIFQPSGKLVTKFGSRGNGDKQFAGPHFAAV-NNNNEIIVTDFHNHSVKVFSAEGEFLLKFGSNGEGNGQFNAPTGVAVD 585          

HSP 3 Score: 63.1586 bits (152), Expect = 1.325e-11
Identity = 40/123 (32.52%), Postives = 60/123 (48.78%), Query Frame = 3
Query:  216 IDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVD 584
            I+  LI  IG    NK + +   G+A  S ++I I D +N  +Q+FSN GE+    G  G+  G    P  +AV P   +I ++D  N  + +F   G Y     G G     L  P+G++VD
Sbjct:  376 IEDDLIFRIGTKGRNKGEFTNLQGVAA-SPESILIADSNNQCVQIFSNQGEFQSRFGVRGRSPGQLQRPTGVAVHP-NGDIIIADYDNKWVSIFTSDGKYKAKL-GSG----RLMGPKGVSVD 491          

HSP 4 Score: 60.8474 bits (146), Expect = 1.057e-10
Identity = 36/138 (26.09%), Postives = 65/138 (47.10%), Query Frame = 3
Query:   84 EMVCDQGTDDNVQLKFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVF 497
            ++V   G+  N   +F      A++ N  II +D ++H V +   +G+ + + G +     + + P G+A D   NI + D  N RIQVF  +G ++  I            P  LA+     ++ V+D+ NH  +V+
Sbjct:  514 KLVTKFGSRGNGDKQFAGPHFAAVNNNNEIIVTDFHNHSVKVFSAEGEFLLKFGSNGEGNGQFNAPTGVAVDVNGNIIVADWGNSRIQVFDGSGSFLSYINTAADP---LYGPQGLALT-SDGHVVVADSGNHCFKVY 647          
BLAST of SMED30029356 vs. Ensembl Cavefish
Match: trim2a (tripartite motif containing 2 [Source:NCBI gene;Acc:103036279])

HSP 1 Score: 79.7221 bits (195), Expect = 2.758e-17
Identity = 44/129 (34.11%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFN 530
            G+ +D+N  II  D     V I   +GKL+ + G   N   + + P   A +    I + D  NH ++VF+  GE++ + G++G+  G F+ P  +AV     NI V+D  N RIQVFD  G++L   N
Sbjct:  583 GVTVDRNGHIIVVDNKACCVFIFQPNGKLVTKFGNRGNGDKQFAGPHFAAVNQNNEIIVTDFHNHSVKVFNPEGEFLLKFGSNGEGNGQFNAPTGVAV-DVNGNIIVADWGNSRIQVFDGSGSFLSYIN 710          

HSP 2 Score: 73.1738 bits (178), Expect = 5.448e-15
Identity = 44/148 (29.73%), Postives = 68/148 (45.95%), Query Frame = 3
Query:  141 SGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVD 584
            +G+A+     II +D  +  V+I   DGK   +IG       KL  P G+  D   +I + D     + +F  NG+ + + G  G     F  PH+ AV  +   I V+D  NH ++VF+  G +L  F  +G        P G+ VD
Sbjct:  540 TGVAVHPTGDIIIADYDNKWVSIFSNDGKFKTKIGS-----GKLMGPKGVTVDRNGHIIVVDNKACCVFIFQPNGKLVTKFGNRGNGDKQFAGPHFAAV-NQNNEIIVTDFHNHSVKVFNPEGEFLLKFGSNGEGNGQFNAPTGVAVD 681          

HSP 3 Score: 63.5438 bits (153), Expect = 1.129e-11
Identity = 37/123 (30.08%), Postives = 60/123 (48.78%), Query Frame = 3
Query:  216 IDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVD 584
            I+  L+  IG    NK + +   G+A  +   + I D +N  +Q+FSN+G++    G  G+  G    P  +AV P T +I ++D  N  + +F   G +     G G     L  P+G+TVD
Sbjct:  471 IEDDLMFRIGTKGRNKGEFTNLQGVAASNVGKVLIADSNNQCVQIFSNDGQFKSRFGVRGRSPGQLQRPTGVAVHP-TGDIIIADYDNKWVSIFSNDGKFKTKI-GSG----KLMGPKGVTVD 587          
BLAST of SMED30029356 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005035.1 (pep scaffold:Pmarinus_7.0:GL476697:205350:209715:-1 gene:ENSPMAG00000004581.1 transcript:ENSPMAT00000005035.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 137.502 bits (345), Expect = 2.358e-40
Identity = 68/159 (42.77%), Postives = 102/159 (64.15%), Query Frame = 3
Query:  126 KFDCLSGIAIDKN-KRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYL---YSFNGDGPTKFHLKYPRGITVDNE 590
            +FDCLSG+ ++     I+ +DRY+HRV I D  G+ +   G+    + +LSYPWG+A DS   +++CDKDNHR+QVFS +G +++  G  G   G  D+PHYLAV P+ + + VSD  NHR+Q+FD++G Y+      +G G     ++YPRG+ VD  
Sbjct:   63 QFDCLSGVTVNAQLGLILVADRYNHRVQIFDRTGRFLRAFGREGAGRGQLSYPWGVACDSSGLVYVCDKDNHRVQVFSPDGVFVRGFGGPGSGEGRLDHPHYLAVTPQGR-VAVSDCGNHRVQIFDRYGRYISKLGDSSGSGSGPGQMRYPRGVAVDRS 220          

HSP 2 Score: 89.3521 bits (220), Expect = 3.996e-22
Identity = 40/123 (32.52%), Postives = 66/123 (53.66%), Query Frame = 3
Query:  222 GKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            G+     G     + + ++P G+A     ++ + D  NHR+QVF  +G +I+ IG+HG   G FD    + V  +   I V+D  NHR+Q+FD+ G +L +F  +G  +  L YP G+  D+ 
Sbjct:    1 GRPRLRFGCKGTEEGRFTWPRGLAVTPEGHLIVADSSNHRLQVFDWSGRFIRAIGSHGSGDGQFDCLSGVTVNAQLGLILVADRYNHRVQIFDRTGRFLRAFGREGAGRGQLSYPWGVACDSS 123          

HSP 3 Score: 65.0846 bits (157), Expect = 3.974e-13
Identity = 41/120 (34.17%), Postives = 65/120 (54.17%), Query Frame = 3
Query:  147 IAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKA---KLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVF 497
            +A+    R+  SD  +HRV I D  G+ I ++G SS + +   ++ YP G+A D   NI + D  N+R++VF  +G ++   G+ G + G       LA+     +I V D  NHRIQ+F
Sbjct:  165 LAVTPQGRVAVSDCGNHRVQIFDRYGRYISKLGDSSGSGSGPGQMRYPRGVAVDRSGNIVVADSGNNRVKVFRPDGTFLHAFGSWGSEDGQMKGLEGLAL--HAGDIVVCDRENHRIQIF 282          
BLAST of SMED30029356 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009943.1 (pep scaffold:Pmarinus_7.0:GL488567:275:4344:1 gene:ENSPMAG00000008992.1 transcript:ENSPMAT00000009943.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 104.76 bits (260), Expect = 1.269e-26
Identity = 50/151 (33.11%), Postives = 77/151 (50.99%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQN--IFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            G+ +D   R+I +DR + R+ +    G  + + G   ++  +   P G+A D  +   I + DKDNHR+Q+FS  G  +   G  G + G F  P  +AV P    I VSDT NHR+Q+F   G ++  +  +G    H   PRG+  D E
Sbjct:  300 GVCVDSEGRVIVADRSNDRIQVFGPSGGFLFKFGAHGSHPGQFDRPAGVAWDPGRGGRIVVSDKDNHRVQIFSGEGRVLSTFGERGSESGQFCYPWDVAVSPGDGLILVSDTRNHRVQLFSPDGAFVNKYGFEGALWKHFDSPRGVAFDAE 450          

HSP 2 Score: 83.1889 bits (204), Expect = 3.705e-19
Identity = 43/120 (35.83%), Postives = 61/120 (50.83%), Query Frame = 3
Query:  225 KLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCP-KTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITV 581
            K+I   G + + +  L  PWG+  DS   + + D+ N RIQVF  +G ++ + GAHG   G FD P  +A  P +   I VSD  NHR+Q+F   G  L +F   G       YP  + V
Sbjct:  282 KVIFSCGGTGDGQ--LCRPWGVCVDSEGRVIVADRSNDRIQVFGPSGGFLFKFGAHGSHPGQFDRPAGVAWDPGRGGRIVVSDKDNHRVQIFSGEGRVLSTFGERGSESGQFCYPWDVAV 399          

HSP 3 Score: 79.7221 bits (195), Expect = 5.278e-18
Identity = 43/140 (30.71%), Postives = 67/140 (47.86%), Query Frame = 3
Query:  171 IICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            I+ SD  +HRV +   DG  + + G           P G+A D+   + + D +NHR+ V   +    + +G  G   G F  P  +AV P+ + I V+D+ NHR+QVF+  G +L  F   G     +  P G+ V  E
Sbjct:  406 ILVSDTRNHRVQLFSPDGAFVNKYGFEGALWKHFDSPRGVAFDAEGRLLVTDFNNHRLLVVRPDCRSARFLGGSGSGPGQFLRPQGVAVDPEGR-IAVADSRNHRVQVFEPDGAFLCQFGAPGGGPGQMDRPSGVAVTPE 544          

HSP 4 Score: 73.559 bits (179), Expect = 8.087e-16
Identity = 35/112 (31.25%), Postives = 57/112 (50.89%), Query Frame = 3
Query:  129 FDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFV 464
            FD   G+A D   R++ +D  +HR+ ++  D +    +G S +   +   P G+A D    I + D  NHR+QVF  +G ++ + GA G   G  D P  +AV P+   + V
Sbjct:  439 FDSPRGVAFDAEGRLLVTDFNNHRLLVVRPDCRSARFLGGSGSGPGQFLRPQGVAVDPEGRIAVADSRNHRVQVFEPDGAFLCQFGAPGGGPGQMDRPSGVAVTPEGLIVVV 550          
BLAST of SMED30029356 vs. Ensembl Sea Lamprey
Match: trim2b (tripartite motif containing 2b [Source:ZFIN;Acc:ZDB-GENE-090312-70])

HSP 1 Score: 84.7297 bits (208), Expect = 2.307e-20
Identity = 45/129 (34.88%), Postives = 71/129 (55.04%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFN 530
            G+A+D+N  II  D     V      GKL+   G   N   + + P  +A +S  +I + D  NH ++VF+++GE++ + G++G+  G F+ P  +AV     NI V+D  N RIQVFD  G++L   N
Sbjct:  108 GVAVDRNGHIIVVDNKACCVTAFQPSGKLVTRFGSRGNGDKQFAGPHFVAVNSNNDIIVTDFHNHSVKVFNSDGEFLLKFGSNGEGNGQFNAPTGVAV-DALGNIIVADWGNSRIQVFDSSGSFLSYIN 235          

HSP 2 Score: 74.7146 bits (182), Expect = 1.114e-16
Identity = 43/148 (29.05%), Postives = 70/148 (47.30%), Query Frame = 3
Query:  141 SGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVD 584
            +G+A+  N  +I +D  +  V+I   DGK   ++G       KL  P G+A D   +I + D     +  F  +G+ +   G+ G     F  PH++AV     +I V+D  NH ++VF+  G +L  F  +G        P G+ VD
Sbjct:   65 TGVAVHPNGDVIVADYDNKWVSIFGTDGKFKSKLGA-----GKLLGPKGVAVDRNGHIIVVDNKACCVTAFQPSGKLVTRFGSRGNGDKQFAGPHFVAVN-SNNDIIVTDFHNHSVKVFNSDGEFLLKFGSNGEGNGQFNAPTGVAVD 206          

HSP 3 Score: 63.5438 bits (153), Expect = 9.972e-13
Identity = 36/138 (26.09%), Postives = 69/138 (50.00%), Query Frame = 3
Query:   84 EMVCDQGTDDNVQLKFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVF 497
            ++V   G+  N   +F     +A++ N  II +D ++H V + + DG+ + + G +     + + P G+A D+  NI + D  N RIQVF ++G ++  I            P  LA+     ++ V+D+ NH  +++
Sbjct:  135 KLVTRFGSRGNGDKQFAGPHFVAVNSNNDIIVTDFHNHSVKVFNSDGEFLLKFGSNGEGNGQFNAPTGVAVDALGNIIVADWGNSRIQVFDSSGSFLSYINTSADP---LYGPQGLALTCD-GHVIVADSGNHCFKIY 268          
BLAST of SMED30029356 vs. Ensembl Nematostella
Match: EDO34308 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPQ3])

HSP 1 Score: 121.709 bits (304), Expect = 3.592e-32
Identity = 57/167 (34.13%), Postives = 94/167 (56.29%), Query Frame = 3
Query:   84 EMVCDQGTDDNVQLKFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVD 584
            E +   G+    + +F+C + + ID   R+I  D  ++RV +++ +G  I + G+          PWG+A  +   I + D +N+R+Q+FS  G+++ + G+ G + G F+ P YL V  +   IFVSD+ NHRIQVFD +G Y+ SF   G  K    +PRG+ +D
Sbjct:  522 EFITSFGSHGERRGEFNCPTDVDIDNRGRVIICDNGNNRVQVLNRNGGFIGKFGREGTGNGYFKSPWGLAVTANNEIVVADMENNRVQMFSPEGKFMMKFGSPGDRPGQFNAPGYLLVNNEDDQIFVSDSKNHRIQVFDMNGVYIRSFGSQGAGKGQFMHPRGLAMD 688          

HSP 2 Score: 87.4261 bits (215), Expect = 2.730e-20
Identity = 41/114 (35.96%), Postives = 66/114 (57.89%), Query Frame = 3
Query:  156 DKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVF 497
            +++ +I  SD  +HR+ + D++G  I   G     K +  +P G+A D   ++ I D  NHR+Q+ ++ GE++KEIG+ G   G    P  +A+ P +  I VSD SN+RI VF
Sbjct:  641 NEDDQIFVSDSKNHRIQVFDMNGVYIRSFGSQGAGKGQFMHPRGLAMDIAGHLIIADMGNHRLQILNSAGEFVKEIGSEGSGDGQLSFPESVAIMPNSGYIVVSDLSNNRIHVF 754          

HSP 3 Score: 85.8853 bits (211), Expect = 8.304e-20
Identity = 41/147 (27.89%), Postives = 75/147 (51.02%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYP-WGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITV 581
            G+A+  N  I+ +D  ++RV +   +GK + + G   +   + + P + +  +    IF+ D  NHRIQVF  NG YI+  G+ G   G F +P  LA+     ++ ++D  NHR+Q+ +  G ++     +G     L +P  + +
Sbjct:  589 GLAVTANNEIVVADMENNRVQMFSPEGKFMMKFGSPGDRPGQFNAPGYLLVNNEDDQIFVSDSKNHRIQVFDMNGVYIRSFGSQGAGKGQFMHPRGLAM-DIAGHLIIADMGNHRLQILNSAGEFVKEIGSEGSGDGQLSFPESVAI 734          

HSP 4 Score: 77.7962 bits (190), Expect = 5.082e-17
Identity = 36/120 (30.00%), Postives = 67/120 (55.83%), Query Frame = 3
Query:  222 GKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITV 581
            G  I + G+  + K +   P+G+A D+   I++ D  NHR+QV    GE+I   G+HG++ G F+ P  + +  + + + + D  N+R+QV +++G ++  F  +G    + K P G+ V
Sbjct:  474 GGTIMKFGQYGSKKREFKSPFGVAIDNEGRIYVADSYNHRVQVLGTRGEFITSFGSHGERRGEFNCPTDVDIDNRGR-VIICDNGNNRVQVLNRNGGFIGKFGREGTGNGYFKSPWGLAV 592          
BLAST of SMED30029356 vs. Ensembl Nematostella
Match: EDO36857 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHB3])

HSP 1 Score: 103.605 bits (257), Expect = 1.325e-27
Identity = 59/182 (32.42%), Postives = 96/182 (52.75%), Query Frame = 3
Query:   45 IFSDKGVCEKVIPEMVCDQGTDDNVQLKFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            +FS KG  ++  PE       D+++       SG+A+D + R+I  DR + R+ I D  G  +   G   N + + + P  +A +S+ +I + D  N RIQVFS+ G Y+   G  G+  G F+ P  + V  + + + VSD+ NHRIQ+F   G+YL  F  +G  +   K P G+ V ++
Sbjct:   45 VFSIKGEFQRAFPE-------DESLHHP----SGVAVDTDGRVIVVDRGNARIVIYDSKGNHVTSFGSLGNGRGQFNCPSHVAINSKGHIIVSDFGNDRIQVFSSTGSYMFRFGRSGRGDGEFNWPTGVGVNSRDE-VIVSDSFNHRIQIFRADGSYLSQFGSEGSREGEFKRPEGVAVAHQ 214          

HSP 2 Score: 88.9669 bits (219), Expect = 5.398e-22
Identity = 50/155 (32.26%), Postives = 80/155 (51.61%), Query Frame = 3
Query:   45 IFSDKGVCEKVIPEM----VCDQGTDDNVQLKFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVF 497
            I  D+G    VI +     V   G+  N + +F+C S +AI+    II SD  + R+ +    G  +   G+S     + ++P G+  +SR  + + D  NHRIQ+F  +G Y+ + G+ G + G F  P  +AV  +  +I V+D  N RIQVF
Sbjct:   77 IVVDRGNARIVIYDSKGNHVTSFGSLGNGRGQFNCPSHVAINSKGHIIVSDFGNDRIQVFSSTGSYMFRFGRSGRGDGEFNWPTGVGVNSRDEVIVSDSFNHRIQIFRADGSYLSQFGSEGSREGEFKRPEGVAVAHQ-GSIVVADWGNDRIQVF 230          

HSP 3 Score: 58.5362 bits (140), Expect = 9.932e-11
Identity = 41/168 (24.40%), Postives = 65/168 (38.69%), Query Frame = 3
Query:  216 IDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEY-------------------------------------------IKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            ++ K +   G     + +L  P G+A     NI + D  N+R+QVFS  GE+                                           +   G+ G   G F+ P ++A+  K  +I VSD  N RIQVF   G+Y++ F   G       +P G+ V++ 
Sbjct:    1 MNSKFLFRFGSLGRGEGQLQSPSGVAVTPDGNIVVSDMINNRMQVFSIKGEFQRAFPEDESLHHPSGVAVDTDGRVIVVDRGNARIVIYDSKGNHVTSFGSLGNGRGQFNCPSHVAINSK-GHIIVSDFGNDRIQVFSSTGSYMFRFGRSGRGDGEFNWPTGVGVNSR 167          
BLAST of SMED30029356 vs. Ensembl Nematostella
Match: EDO47729 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLP8])

HSP 1 Score: 108.227 bits (269), Expect = 1.535e-27
Identity = 52/149 (34.90%), Postives = 85/149 (57.05%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            G+A D   +++ +D ++HR+ I D +GK++ + G       ++ YP G+A D   NIF+ D  N+RIQ F+  GE+I++ G  G   G    P   AV  + + + V+D  NHRIQVFD  G +L++F   G ++     PR I+V ++
Sbjct:  487 GVATDPYGQLVVTDHHNHRIQIYDSEGKMMRQFGIRGKGDGEIWYPAGVAVDKSGNIFVADHGNNRIQAFTQEGEFIRKFGGKGTGLGQMKGPCGAAVDGENR-VLVADRDNHRIQVFDSEGNFLFTFGSYGDSQGKFNCPRHISVSSK 634          

HSP 2 Score: 98.9821 bits (245), Expect = 2.223e-24
Identity = 49/150 (32.67%), Postives = 78/150 (52.00%), Query Frame = 3
Query:  141 SGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            +G+A+DK+  I  +D  ++R+     +G+ I + G       ++  P G A D    + + D+DNHRIQVF + G ++   G++G   G F+ P +++V  K + I VSD  N R+QVFD  G +L  F   G        P G+  D E
Sbjct:  533 AGVAVDKSGNIFVADHGNNRIQAFTQEGEFIRKFGGKGTGLGQMKGPCGAAVDGENRVLVADRDNHRIQVFDSEGNFLFTFGSYGDSQGKFNCPRHISVSSKGE-ILVSDAGNFRVQVFDGAGNFLSKFGEKGSNNGQFSCPAGVATDAE 681          

HSP 3 Score: 78.9518 bits (193), Expect = 2.293e-17
Identity = 40/104 (38.46%), Postives = 59/104 (56.73%), Query Frame = 3
Query:  279 PWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            PWG+ATD    + + D  NHRIQ++ + G+ +++ G  G+  G    P  +AV  K+ NIFV+D  N+RIQ F + G ++  F G G     +K P G  VD E
Sbjct:  485 PWGVATDPYGQLVVTDHHNHRIQIYDSEGKMMRQFGIRGKGDGEIWYPAGVAV-DKSGNIFVADHGNNRIQAFTQEGEFIRKFGGKGTGLGQMKGPCGAAVDGE 587          

HSP 4 Score: 70.4774 bits (171), Expect = 1.592e-14
Identity = 40/135 (29.63%), Postives = 70/135 (51.85%), Query Frame = 3
Query:  102 GTDDNVQLKFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHG---QQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVF 497
            G+  + Q KF+C   I++     I+ SD  + RV + D  G  + + G+  +N  + S P G+ATD+  +I + D  N  +QVF+++GE+IK I       +    F  P  +A+     N+ V+D   H++ +F
Sbjct:  614 GSYGDSQGKFNCPRHISVSSKGEILVSDAGNFRVQVFDGAGNFLSKFGEKGSNNGQFSCPAGVATDAEGHIVVADLKNLNVQVFNSDGEFIKRISQDPDSVKNASYFGKPTGVAI-SDNGNVVVADRGLHKVMLF 747          
BLAST of SMED30029356 vs. Ensembl Nematostella
Match: EDO37098 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGN2])

HSP 1 Score: 95.5153 bits (236), Expect = 1.609e-24
Identity = 47/150 (31.33%), Postives = 76/150 (50.67%), Query Frame = 3
Query:  141 SGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            +G+A+DK+  I  +D  ++R+     +G+   +         ++  P G A D    + + D+DNHRIQVF + G ++   G++G   G F+ P +++V  K + I VSD  N R+QVFD  G +L  F   G        P G+  D E
Sbjct:   15 AGVAVDKSSNIFVADHGNNRIQAFTQEGEFTRKFDGKGTGIGQMKGPCGAAVDGENWVLVADRDNHRIQVFDSEGNFLFTFGSYGDSQGKFNCPRHISVSMKGE-ILVSDAGNFRVQVFDGAGNFLSKFGEKGSNNGQFSCPAGVATDAE 163          

HSP 2 Score: 79.337 bits (194), Expect = 1.816e-18
Identity = 40/114 (35.09%), Postives = 58/114 (50.88%), Query Frame = 3
Query:  240 IGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITV 581
             G       ++ YP G+A D   NIF+ D  N+RIQ F+  GE+ ++    G   G    P   AV  +   + V+D  NHRIQVFD  G +L++F   G ++     PR I+V
Sbjct:    1 FGARGTGDGEIWYPAGVAVDKSSNIFVADHGNNRIQAFTQEGEFTRKFDGKGTGIGQMKGPCGAAVDGENW-VLVADRDNHRIQVFDSEGNFLFTFGSYGDSQGKFNCPRHISV 113          

HSP 3 Score: 65.4698 bits (158), Expect = 2.453e-13
Identity = 38/137 (27.74%), Postives = 68/137 (49.64%), Query Frame = 3
Query:  102 GTDDNVQLKFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEI-----GAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVF 497
            G+  + Q KF+C   I++     I+ SD  + RV + D  G  + + G+  +N  + S P G+ATD+  +I + D  N  +QVF+++GE IK I         +    F  P  +A+     ++ V+    H++ +F
Sbjct:   96 GSYGDSQGKFNCPRHISVSMKGEILVSDAGNFRVQVFDGAGNFLSKFGEKGSNNGQFSCPAGVATDAEGHIVVADLKNLNVQVFNSDGELIKRIRISQDPVSVRNASYFGKPKGVAISDNV-SVVVASRGLHKVMLF 231          
BLAST of SMED30029356 vs. Ensembl Nematostella
Match: EDO47715 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLM1])

HSP 1 Score: 95.9005 bits (237), Expect = 2.534e-23
Identity = 56/151 (37.09%), Postives = 82/151 (54.30%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIG--KSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            GIA   N  I+ +D  +HRV I + DG+ + + G   +      +++P G+A      I I ++DNHRIQ+F  NGE I+  G+ G   G F  PH+L V  + K + V+D  N RIQVF+  G  L+SF  +G        P G+T D+E
Sbjct:  538 GIARLTNGHIVVADFNNHRVQIFNEDGRFLRKFGFYGTGGEPGSMNHPCGVACTPGGLILISEQDNHRIQMFDVNGEPIRMFGSQGFTKGQFIYPHHLCVTQRDK-VVVADCVNDRIQVFNIEGECLFSFGKEGTQNGLFDGPEGVTCDDE 687          

HSP 2 Score: 91.6633 bits (226), Expect = 9.850e-22
Identity = 49/149 (32.89%), Postives = 77/149 (51.68%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            G+A      I+ S++ +HR+ + D++G+ I   G     K +  YP  +    R  + + D  N RIQVF+  GE +   G  G Q G+FD P  +  C    NI VSD  NHR+Q+F+  G ++ +F   G  + + + P GI V N+
Sbjct:  587 GVACTPGGLILISEQDNHRIQMFDVNGEPIRMFGSQGFTKGQFIYPHHLCVTQRDKVVVADCVNDRIQVFNIEGECLFSFGKEGTQNGLFDGPEGVT-CDDEDNILVSDYHNHRVQIFNAEGGFVAAFGQFGDEEGNFRNPCGIAVTND 734          

HSP 3 Score: 82.4185 bits (202), Expect = 1.457e-18
Identity = 49/155 (31.61%), Postives = 84/155 (54.19%), Query Frame = 3
Query:  126 KFDCLSGIAIDK-NKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQ--QCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITV 581
            +F     +AID+ N+  I +D  +HRV + D +G  + + G    +K +   P GIA  +  +I + D +NHR+Q+F+ +G ++++ G +G   + G  ++P  +A  P    I +S+  NHRIQ+FD +G  +  F   G TK    YP  + V
Sbjct:  484 EFSIPWAVAIDEENECFIVTDCNNHRVQVFDFNGVFMFKFGCEGIDKGQFKNPKGIARLTNGHIVVADFNNHRVQIFNEDGRFLRKFGFYGTGGEPGSMNHPCGVACTPGGL-ILISEQDNHRIQMFDVNGEPIRMFGSQGFTKGQFIYPHHLCV 637          

HSP 4 Score: 75.0998 bits (183), Expect = 4.320e-16
Identity = 35/117 (29.91%), Postives = 61/117 (52.14%), Query Frame = 3
Query:  147 IAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVF 497
            + + +  +++ +D  + R+ + +I+G+ +   GK          P G+  D   NI + D  NHR+Q+F+  G ++   G  G + G F NP  +AV     N+ V D+ NHRIQ+F
Sbjct:  635 LCVTQRDKVVVADCVNDRIQVFNIEGECLFSFGKEGTQNGLFDGPEGVTCDDEDNILVSDYHNHRVQIFNAEGGFVAAFGQFGDEEGNFRNPCGIAV-TNDGNVVVVDSGNHRIQIF 750          

HSP 5 Score: 54.299 bits (129), Expect = 5.354e-9
Identity = 25/75 (33.33%), Postives = 39/75 (52.00%), Query Frame = 3
Query:  129 FDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVF 353
            FD   G+  D    I+ SD ++HRV I + +G  +   G+  + +     P GIA  +  N+ + D  NHRIQ+F
Sbjct:  676 FDGPEGVTCDDEDNILVSDYHNHRVQIFNAEGGFVAAFGQFGDEEGNFRNPCGIAVTNDGNVVVVDSGNHRIQIF 750          

HSP 6 Score: 53.9138 bits (128), Expect = 8.653e-9
Identity = 25/72 (34.72%), Postives = 41/72 (56.94%), Query Frame = 3
Query:  363 GEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGIT 578
            G+ I+  G+ G   G F  P  +A+  + +   V+D +NHR+QVFD +G +++ F  +G  K   K P+GI 
Sbjct:  469 GKAIRTFGSEGAGGGEFSIPWAVAIDEENECFIVTDCNNHRVQVFDFNGVFMFKFGCEGIDKGQFKNPKGIA 540          
BLAST of SMED30029356 vs. Ensembl Medaka
Match: trim71 (tripartite motif containing 71 [Source:NCBI gene;Acc:101156749])

HSP 1 Score: 103.605 bits (257), Expect = 1.740e-25
Identity = 50/149 (33.56%), Postives = 85/149 (57.05%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            G+ +DK   ++ +DR ++R+ I    G    + G   +   +   P G+A D+++ I + DKDNHR+QVF+  G+++ + G  G + G F+ P  +AV  + K I VSDT NHR+Q+F   G++L  +  +G    H   PRG+  ++E
Sbjct:  569 GVCVDKEGYVVVADRSNNRIQIFKPCGTFHHKFGSLGSRPGQFDRPAGVACDTQRRIIVADKDNHRVQVFTFEGQFLLKFGEKGTKNGQFNYPWDVAVNSEGK-ILVSDTRNHRVQLFAPDGSFLNKYGFEGALWKHFDSPRGVAFNHE 716          

HSP 2 Score: 95.9005 bits (237), Expect = 9.380e-23
Identity = 46/155 (29.68%), Postives = 81/155 (52.26%), Query Frame = 3
Query:  126 KFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            +FD  +G+A D  +RII +D+ +HRV +   +G+ + + G+      + +YPW +A +S   I + D  NHR+Q+F+ +G ++ + G  G     FD+P  +A      ++ V+D +NHR+ V             +G        P+G+TVD E
Sbjct:  610 QFDRPAGVACDTQRRIIVADKDNHRVQVFTFEGQFLLKFGEKGTKNGQFNYPWDVAVNSEGKILVSDTRNHRVQLFAPDGSFLNKYGFEGALWKHFDSPRGVAF-NHEDHLVVTDFNNHRLLVIRPDCQSARFLGSEGTGNGQFLRPQGVTVDQE 763          

HSP 3 Score: 80.8777 bits (198), Expect = 1.486e-17
Identity = 39/123 (31.71%), Postives = 59/123 (47.97%), Query Frame = 3
Query:  222 GKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            G  +   G       +L  PWG+  D    + + D+ N+RIQ+F   G +  + G+ G + G FD P  +A C   + I V+D  NHR+QVF   G +L  F   G       YP  + V++E
Sbjct:  548 GSQMSSFGCEGEGDGQLCRPWGVCVDKEGYVVVADRSNNRIQIFKPCGTFHHKFGSLGSRPGQFDRPAGVA-CDTQRRIIVADKDNHRVQVFTFEGQFLLKFGEKGTKNGQFNYPWDVAVNSE 669          

HSP 4 Score: 68.5514 bits (166), Expect = 2.087e-13
Identity = 37/123 (30.08%), Postives = 57/123 (46.34%), Query Frame = 3
Query:  129 FDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVF 497
            FD   G+A +    ++ +D  +HR+ ++  D +    +G       +   P G+  D    I + D  NHRIQ+F  NG ++ + G  G   G  D P  +AV P    I V D  N+RI  F
Sbjct:  705 FDSPRGVAFNHEDHLVVTDFNNHRLLVIRPDCQSARFLGSEGTGNGQFLRPQGVTVDQENRIIVADSRNHRIQIFEPNGNFLCKFGTQGSGYGQMDRPSGVAVMPDGV-IVVVDFGNNRILKF 826          
BLAST of SMED30029356 vs. Ensembl Medaka
Match: trim71 (tripartite motif containing 71 [Source:NCBI gene;Acc:101156749])

HSP 1 Score: 95.9005 bits (237), Expect = 8.104e-23
Identity = 46/155 (29.68%), Postives = 81/155 (52.26%), Query Frame = 3
Query:  126 KFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            +FD  +G+A D  +RII +D+ +HRV +   +G+ + + G+      + +YPW +A +S   I + D  NHR+Q+F+ +G ++ + G  G     FD+P  +A      ++ V+D +NHR+ V             +G        P+G+TVD E
Sbjct:  601 QFDRPAGVACDTQRRIIVADKDNHRVQVFTFEGQFLLKFGEKGTKNGQFNYPWDVAVNSEGKILVSDTRNHRVQLFAPDGSFLNKYGFEGALWKHFDSPRGVAF-NHEDHLVVTDFNNHRLLVIRPDCQSARFLGSEGTGNGQFLRPQGVTVDQE 754          

HSP 2 Score: 93.9745 bits (232), Expect = 4.191e-22
Identity = 50/150 (33.33%), Postives = 84/150 (56.00%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMD-IDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            G+ +DK   ++ +DR ++R+     I   L C+  +          P G+A D+++ I + DKDNHR+QVF+  G+++ + G  G + G F+ P  +AV  + K I VSDT NHR+Q+F   G++L  +  +G    H   PRG+  ++E
Sbjct:  569 GVCVDKEGYVVVADRSNNRIQCPKLIQFFLPCQFDR----------PAGVACDTQRRIIVADKDNHRVQVFTFEGQFLLKFGEKGTKNGQFNYPWDVAVNSEGK-ILVSDTRNHRVQLFAPDGSFLNKYGFEGALWKHFDSPRGVAFNHE 707          

HSP 3 Score: 68.9366 bits (167), Expect = 1.894e-13
Identity = 37/123 (30.08%), Postives = 57/123 (46.34%), Query Frame = 3
Query:  129 FDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVF 497
            FD   G+A +    ++ +D  +HR+ ++  D +    +G       +   P G+  D    I + D  NHRIQ+F  NG ++ + G  G   G  D P  +AV P    I V D  N+RI  F
Sbjct:  696 FDSPRGVAFNHEDHLVVTDFNNHRLLVIRPDCQSARFLGSEGTGNGQFLRPQGVTVDQENRIIVADSRNHRIQIFEPNGNFLCKFGTQGSGYGQMDRPSGVAVMPDGV-IVVVDFGNNRILKF 817          
BLAST of SMED30029356 vs. Ensembl Medaka
Match: trim3a (tripartite motif-containing protein 3 [Source:NCBI gene;Acc:101175583])

HSP 1 Score: 85.8853 bits (211), Expect = 2.216e-19
Identity = 45/129 (34.88%), Postives = 73/129 (56.59%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFN 530
            G+A+DKN  II +D     V I   +GKL+ + G    +    + P  +A +++  I + D  NH ++V++ +GE++ + G+HG+  G F+ P  +AV     NI V+D  N RIQVFD  G++L   N
Sbjct:  587 GVAVDKNGHIITADNKACCVFIFQSNGKLVTKFGARGTSDRHFTGPHFVAVNNKNEIVVTDFHNHSVKVYNADGEFLFKFGSHGEGNGQFNAPTGVAV-DANGNIIVADWGNSRIQVFDSSGSFLSYIN 714          

HSP 2 Score: 78.1814 bits (191), Expect = 9.610e-17
Identity = 45/148 (30.41%), Postives = 73/148 (49.32%), Query Frame = 3
Query:  141 SGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVD 584
            +G+ +D N  II +D  +  ++I   DGK   +IG       +L  P G+A D   +I   D     + +F +NG+ + + GA G     F  PH++AV  K + I V+D  NH ++V++  G +L+ F   G        P G+ VD
Sbjct:  544 TGVTVDVNGDIIVADYDNRWISIFSSDGKFKNKIGA-----GRLMGPKGVAVDKNGHIITADNKACCVFIFQSNGKLVTKFGARGTSDRHFTGPHFVAVNNKNE-IVVTDFHNHSVKVYNADGEFLFKFGSHGEGNGQFNAPTGVAVD 685          

HSP 3 Score: 55.8398 bits (133), Expect = 5.219e-9
Identity = 37/123 (30.08%), Postives = 57/123 (46.34%), Query Frame = 3
Query:  216 IDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVD 584
            I+ +LI  +G    +K + +   GI+  S   I + D +N  IQVFSN+G++    G  G+  G    P  + V     +I V+D  N  I +F   G +     G G     L  P+G+ VD
Sbjct:  475 IEDELIYRVGTRGRDKGEFTNLQGISASSNGRIVVADSNNQCIQVFSNDGQFKMRFGVRGRSPGQLQRPTGVTV-DVNGDIIVADYDNRWISIFSSDGKFKNKI-GAG----RLMGPKGVAVD 591          
BLAST of SMED30029356 vs. Ensembl Medaka
Match: trim3b (tripartite motif-containing protein 3 [Source:NCBI gene;Acc:101169131])

HSP 1 Score: 85.5001 bits (210), Expect = 2.844e-19
Identity = 45/129 (34.88%), Postives = 72/129 (55.81%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFN 530
            G+A+DKN  II  D     V I   +GKL+ + G       + + P  +A +++  I + D  NH ++V++ +GE++ + G+HG+  G F+ P  +AV     NI V+D  N RIQVFD  G++L   N
Sbjct:  588 GVAVDKNGHIITVDNKACCVFIFQSNGKLVTKFGGRGTTDRQFAGPHFVAVNNKNEIIVTDFHNHSVKVYNADGEFLFKFGSHGEGNGQFNAPTGVAV-DANGNIIVADWGNSRIQVFDSTGSFLSYIN 715          

HSP 2 Score: 77.411 bits (189), Expect = 2.046e-16
Identity = 44/148 (29.73%), Postives = 72/148 (48.65%), Query Frame = 3
Query:  141 SGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVD 584
            +G+ +D N  I+ +D  +  V+I   DGK   +IG       +L  P G+A D   +I   D     + +F +NG+ + + G  G     F  PH++AV  K + I V+D  NH ++V++  G +L+ F   G        P G+ VD
Sbjct:  545 TGVTVDMNGDIVVADYDNRWVSIFGSDGKFKNKIGA-----GRLMGPKGVAVDKNGHIITVDNKACCVFIFQSNGKLVTKFGGRGTTDRQFAGPHFVAVNNKNE-IIVTDFHNHSVKVYNADGEFLFKFGSHGEGNGQFNAPTGVAVD 686          

HSP 3 Score: 54.299 bits (129), Expect = 1.528e-8
Identity = 35/123 (28.46%), Postives = 56/123 (45.53%), Query Frame = 3
Query:  216 IDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVD 584
            I+ +LI  +G     K + +   GI+  S   + + D +N  IQVFSN+G++    G  G+  G    P  + V     +I V+D  N  + +F   G +     G G     L  P+G+ VD
Sbjct:  476 IEDELIYRVGSRGREKGEFTNLQGISASSNGRVVVADSNNQCIQVFSNDGQFKMRFGVRGRSPGQLQRPTGVTV-DMNGDIVVADYDNRWVSIFGSDGKFKNKI-GAG----RLMGPKGVAVD 592          
BLAST of SMED30029356 vs. Ensembl Medaka
Match: trim2b (tripartite motif-containing protein 2 [Source:NCBI gene;Acc:101163206])

HSP 1 Score: 82.4185 bits (202), Expect = 3.652e-18
Identity = 45/129 (34.88%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFN 530
            G+++D+N  +I  D     V I  + GKLI + G   N   + + P   A +    I I D  NH ++VF+  GE + + G++G+  G F+ P  +AV     NI V+D  N RIQVFD  G++L   N
Sbjct:  507 GVSVDQNGHVIVVDNKACTVFIFQLTGKLITKFGSRGNGDKQFAGPHFAAVNKNNEIIITDFHNHSVKVFTPEGELVLKFGSNGEGNGQFNAPTGVAV-DTNGNIIVADWGNSRIQVFDGSGSFLSYIN 634          

HSP 2 Score: 67.0106 bits (162), Expect = 6.898e-13
Identity = 39/148 (26.35%), Postives = 68/148 (45.95%), Query Frame = 3
Query:  141 SGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVD 584
            +G+A+  +  II +D  +  V+I   +GK   ++G       +L  P G++ D   ++ + D     + +F   G+ I + G+ G     F  PH+ AV  K   I ++D  NH ++VF   G  +  F  +G        P G+ VD
Sbjct:  464 TGVAVHPSGDIIIADYDNKWVSIFTSEGKFKAKLGS-----GRLMGPKGVSVDQNGHVIVVDNKACTVFIFQLTGKLITKFGSRGNGDKQFAGPHFAAV-NKNNEIIITDFHNHSVKVFTPEGELVLKFGSNGEGNGQFNAPTGVAVD 605          

HSP 3 Score: 65.4698 bits (158), Expect = 2.637e-12
Identity = 39/123 (31.71%), Postives = 60/123 (48.78%), Query Frame = 3
Query:  216 IDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVD 584
            I+  LI +IG    NK + +   G+A  S   I I D +N  +Q+FSN GE+    G  G+  G    P  +AV P + +I ++D  N  + +F   G +     G G     L  P+G++VD
Sbjct:  395 IEDDLIFKIGTKGRNKGEFTNLQGVAASSIGRILIADSNNQCVQIFSNEGEFKSRFGVRGRTPGQLQRPTGVAVHP-SGDIIIADYDNKWVSIFTSEGKFKAKL-GSG----RLMGPKGVSVD 511          
BLAST of SMED30029356 vs. Planmine SMEST
Match: SMESG000015738.1 (SMESG000015738.1)

HSP 1 Score: 385.571 bits (989), Expect = 2.447e-132
Identity = 182/182 (100.00%), Postives = 182/182 (100.00%), Query Frame = 3
Query:   45 IFSDKGVCEKVIPEMVCDQGTDDNVQLKFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            IFSDKGVCEKVIPEMVCDQGTDDNVQLKFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE
Sbjct:  397 IFSDKGVCEKVIPEMVCDQGTDDNVQLKFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 578          

HSP 2 Score: 79.337 bits (194), Expect = 3.037e-17
Identity = 44/113 (38.94%), Postives = 59/113 (52.21%), Query Frame = 3
Query:  159 KNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVF 497
            K K I  SD  +HR+ + D  G  +         K  L YP GI  D+  N+ ICD  N+RI +FSN G+++   G+HG   G F     +AV    + I VSD  NHRIQ+F
Sbjct:  530 KTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNEGNVLICDYGNNRISIFSNQGKFLYLFGSHGSHDGQFKGLEGIAVFNDGR-IAVSDRDNHRIQIF 641          

HSP 3 Score: 56.225 bits (134), Expect = 2.464e-9
Identity = 41/126 (32.54%), Postives = 51/126 (40.48%), Query Frame = 3
Query:  231 ICEIGKSSNNKAKLSYPWGIATDSRQN-IFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVC------PKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDN 587
            I   G       +  +P GIA DS  N I I D  NHR+Q+FS+ G   K I       G  DN      C       K K I  SD  +HR+ + D  G  +         K  L YP GI  D+
Sbjct:  357 ILTFGSKGTGSGEFIWPRGIAIDSSTNRIIIADSSNHRVQIFSDKGVCEKVIPEMVCDQGTDDNVQLKFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDS 482          
BLAST of SMED30029356 vs. Planmine SMEST
Match: SMESG000029727.1 (SMESG000029727.1)

HSP 1 Score: 63.5438 bits (153), Expect = 7.898e-12
Identity = 39/119 (32.77%), Postives = 58/119 (48.74%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFD 500
            GI +DK  +II +D     +      GK I ++  +  +  KL+ P  +   S  +I + D  NH ++VF  NG Y  E G HG   G F+ P  +  C    +I VSD  N RI +F+
Sbjct:  266 GICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGIC-CSDEDDIVVSDWGNSRIVIFN 383          

HSP 2 Score: 60.4622 bits (145), Expect = 7.368e-11
Identity = 40/148 (27.03%), Postives = 65/148 (43.92%), Query Frame = 3
Query:  147 IAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            IA   N   + +D     + + D+ G  +   G+       L  P GI  D    I + D  +  +  F   G++IK++  + +       PH+L +   T +I V+D  NH ++VFDK+G Y   F   G +     YP GI   +E
Sbjct:  225 IAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKV-----LLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVII-STGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDE 366          
BLAST of SMED30029356 vs. Planmine SMEST
Match: SMESG000029727.1 (SMESG000029727.1)

HSP 1 Score: 63.1586 bits (152), Expect = 8.742e-12
Identity = 39/119 (32.77%), Postives = 58/119 (48.74%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFD 500
            GI +DK  +II +D     +      GK I ++  +  +  KL+ P  +   S  +I + D  NH ++VF  NG Y  E G HG   G F+ P  +  C    +I VSD  N RI +F+
Sbjct:  272 GICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVIISTGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGIC-CSDEDDIVVSDWGNSRIVIFN 389          

HSP 2 Score: 60.4622 bits (145), Expect = 7.996e-11
Identity = 40/148 (27.03%), Postives = 65/148 (43.92%), Query Frame = 3
Query:  147 IAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            IA   N   + +D     + + D+ G  +   G+       L  P GI  D    I + D  +  +  F   G++IK++  + +       PH+L +   T +I V+D  NH ++VFDK+G Y   F   G +     YP GI   +E
Sbjct:  231 IAETTNGHYLVTDFELKIILVYDLLGNYVSSFGQKV-----LLGPKGICVDKTGQIIVADNKDSSLVFFKATGKFIKKVKDNPRSDNKLAGPHFLVII-STGDILVTDFYNHCVKVFDKNGIYQNEFGQHGDSWGEFNYPTGICCSDE 372          
BLAST of SMED30029356 vs. Planmine SMEST
Match: SMESG000007013.1 (SMESG000007013.1)

HSP 1 Score: 57.7658 bits (138), Expect = 6.878e-10
Identity = 41/164 (25.00%), Postives = 60/164 (36.59%), Query Frame = 3
Query:  228 LICEIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNP---------HYLAV--------------------------------CPKTKN--IFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNE 590
            LI  IG+  +   +   P G+       +FICD  NHRIQV S  G +I+  G  G++    +NP          Y+ V                                  KT+N  + V+D   H I + D  G  +  F G G   + L YP  I +  +
Sbjct:   57 LIKRIGRKGSGTGQFLNPSGLCISKEDELFICDTGNHRIQVVSLEGHFIRCFGKFGKEISNLNNPISVLLIRDEQYILVTDGDIKKIKMYSISGQFSCIFSENSNFKHPFALAKTQNDYVAVTDLETHLINIIDPEGNLIRQFGGIGDKPYSLNYPTQIAISRD 220          
BLAST of SMED30029356 vs. Planmine SMEST
Match: SMESG000059098.1 (SMESG000059098.1)

HSP 1 Score: 56.9954 bits (136), Expect = 1.500e-9
Identity = 27/94 (28.72%), Postives = 48/94 (51.06%), Query Frame = 3
Query:  243 GKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNH--RIQVFDKHGTYL 518
            G   + + ++S P G      + I + D  NHRIQ+F+ +G+++ + G  G+  G    P  +A+   T+   V D  N   R+Q+F + G +L
Sbjct:  567 GSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFL 660          

HSP 2 Score: 48.9062 bits (115), Expect = 8.450e-7
Identity = 42/189 (22.22%), Postives = 76/189 (40.21%), Query Frame = 3
Query:  144 GIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPWGIA-TDSRQNIFICDKDNH--RIQVFSNNGEYIKEIGAH--------------------------------GQQCGMFD------NPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDN 587
            G  +  ++ I+ +D  +HR+ I   DG+ + + G +  ++ +L +P  +A   S Q   +CD+ N   R+Q+F  +G ++++I                                   G+    FD       P  +AV       F+ D   H + VF + GT++  F  +  T F    P GI V +
Sbjct:  581 GFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIVAVDSVSPSVFVVSEGGELIKWFDCSSCMREPSDIAV--HGDEYFICDFKGHCVCVFKQDGTFVQRFGNETITNF----PNGIDVSD 763          
The following BLAST results are available for this feature:
BLAST of SMED30029356 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRIM717.737e-2634.90tripartite motif containing 71 [Source:HGNC Symbol... [more]
TRIM32.826e-1834.11tripartite motif containing 3 [Source:HGNC Symbol;... [more]
TRIM32.909e-1834.11tripartite motif containing 3 [Source:HGNC Symbol;... [more]
TRIM32.945e-1834.11tripartite motif containing 3 [Source:HGNC Symbol;... [more]
TRIM32.945e-1834.11tripartite motif containing 3 [Source:HGNC Symbol;... [more]
back to top
BLAST of SMED30029356 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nhl-11.457e-4041.29RING finger protein nhl-1 [Source:UniProtKB/Swiss... [more]
nhl-12.370e-4041.29RING finger protein nhl-1 [Source:UniProtKB/Swiss... [more]
lin-411.234e-2840.41pep chromosome:WBcel235:I:9335965:9342443:-1 gene:... [more]
lin-411.234e-2840.41pep chromosome:WBcel235:I:9334812:9342496:-1 gene:... [more]
lin-411.235e-2840.41pep chromosome:WBcel235:I:9335965:9342443:-1 gene:... [more]
back to top
BLAST of SMED30029356 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tn4.662e-4239.26gene:FBgn0265356 transcript:FBtr0114622[more]
tn7.691e-4239.26gene:FBgn0265356 transcript:FBtr0086573[more]
tn7.691e-4239.26gene:FBgn0265356 transcript:FBtr0086572[more]
tn8.021e-4239.26gene:FBgn0265356 transcript:FBtr0340448[more]
tn1.111e-4139.26gene:FBgn0265356 transcript:FBtr0340447[more]
back to top
BLAST of SMED30029356 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trim712.736e-2636.24tripartite motif containing 71, E3 ubiquitin prote... [more]
trim3b2.787e-1934.88tripartite motif containing 3b [Source:ZFIN;Acc:ZD... [more]
trim2a1.928e-1834.88tripartite motif containing 2a [Source:ZFIN;Acc:ZD... [more]
trim2b1.173e-1734.88tripartite motif containing 2b [Source:ZFIN;Acc:ZD... [more]
trim2b1.173e-1734.88tripartite motif containing 2b [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of SMED30029356 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRIM718.373e-2534.23tripartite motif containing 71, E3 ubiquitin prote... [more]
TRIM718.914e-2534.23tripartite motif containing 71, E3 ubiquitin prote... [more]
surf4.13.670e-1832.68surfeit 4, gene 1 [Source:Xenbase;Acc:XB-GENE-5807... [more]
actr61.141e-1732.21ARP6 actin related protein 6 homolog [Source:Xenba... [more]
actr61.277e-1732.21ARP6 actin related protein 6 homolog [Source:Xenba... [more]
back to top
BLAST of SMED30029356 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trim716.880e-2735.57tripartite motif-containing 71 [Source:MGI Symbol;... [more]
Trim32.022e-1834.11tripartite motif-containing 3 [Source:MGI Symbol;A... [more]
Trim32.022e-1834.11tripartite motif-containing 3 [Source:MGI Symbol;A... [more]
Trim32.022e-1834.11tripartite motif-containing 3 [Source:MGI Symbol;A... [more]
Trim23.203e-1734.88tripartite motif-containing 2 [Source:MGI Symbol;A... [more]
back to top
BLAST of SMED30029356 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q03601|NHL1_CAEEL1.854e-3941.29RING finger protein nhl-1 OS=Caenorhabditis elegan... [more]
sp|Q9U489|LIN41_CAEEL1.571e-2740.41Protein lin-41 OS=Caenorhabditis elegans OX=6239 G... [more]
sp|Q1PSW8|LIN41_MOUSE4.813e-2635.57E3 ubiquitin-protein ligase TRIM71 OS=Mus musculus... [more]
sp|E7FAM5|LIN41_DANRE2.065e-2536.24E3 ubiquitin-protein ligase TRIM71 OS=Danio rerio ... [more]
sp|D3ZVM4|LIN41_RAT2.225e-2534.90E3 ubiquitin-protein ligase TRIM71 OS=Rattus norve... [more]
back to top
BLAST of SMED30029356 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7PAN73.710e-4647.10RING-type domain-containing protein OS=Pomacea can... [more]
C3ZPM44.680e-4647.10Uncharacterized protein OS=Branchiostoma floridae ... [more]
A0A3S1BIG01.767e-4543.41Uncharacterized protein (Fragment) OS=Elysia chlor... [more]
A0A2C9JJJ95.391e-4546.75RING-type domain-containing protein OS=Biomphalari... [more]
A0A0A9Y5M26.309e-4544.17RING finger protein nhl-1 OS=Lygus hesperus OX=300... [more]
back to top
BLAST of SMED30029356 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000052572.13.500e-2836.91E3 ubiquitin-protein ligase TRIM71-like [Source:NC... [more]
trim713.207e-2635.57tripartite motif containing 71 [Source:NCBI gene;A... [more]
trim3a3.850e-2033.56tripartite motif containing 3a [Source:ZFIN;Acc:ZD... [more]
trim2b7.201e-1834.11tripartite motif containing 2b [Source:ZFIN;Acc:ZD... [more]
trim2a2.758e-1734.11tripartite motif containing 2 [Source:NCBI gene;Ac... [more]
back to top
BLAST of SMED30029356 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000005035.12.358e-4042.77pep scaffold:Pmarinus_7.0:GL476697:205350:209715:-... [more]
ENSPMAT00000009943.11.269e-2633.11pep scaffold:Pmarinus_7.0:GL488567:275:4344:1 gene... [more]
trim2b2.307e-2034.88tripartite motif containing 2b [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of SMED30029356 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029356 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO343083.592e-3234.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO368571.325e-2732.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477291.535e-2734.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO370981.609e-2431.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477152.534e-2337.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30029356 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trim711.740e-2533.56tripartite motif containing 71 [Source:NCBI gene;A... [more]
trim718.104e-2329.68tripartite motif containing 71 [Source:NCBI gene;A... [more]
trim3a2.216e-1934.88tripartite motif-containing protein 3 [Source:NCBI... [more]
trim3b2.844e-1934.88tripartite motif-containing protein 3 [Source:NCBI... [more]
trim2b3.652e-1834.88tripartite motif-containing protein 2 [Source:NCBI... [more]
back to top
BLAST of SMED30029356 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000015738.12.447e-132100.00SMESG000015738.1[more]
SMESG000029727.17.898e-1232.77SMESG000029727.1[more]
SMESG000029727.18.742e-1232.77SMESG000029727.1[more]
SMESG000007013.16.878e-1025.00SMESG000007013.1[more]
SMESG000059098.11.500e-928.72SMESG000059098.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029356 ID=SMED30029356|Name=SMED30029356|organism=Schmidtea mediterranea sexual|type=transcript|length=591bp
CTAAAATGCATATATAATGGTTATATTGATGTTTATTATTATAGATTTTT
TCGGATAAAGGTGTTTGTGAAAAAGTCATCCCAGAAATGGTATGCGATCA
AGGAACTGATGATAATGTGCAATTAAAATTTGACTGTTTAAGTGGTATAG
CAATTGACAAAAATAAAAGAATAATATGCTCTGACCGATATCATCATCGG
GTCGCCATTATGGATATTGATGGGAAACTGATTTGTGAAATTGGGAAAAG
CTCCAATAATAAAGCTAAACTCAGTTACCCATGGGGTATTGCCACTGATT
CTCGGCAGAATATATTCATATGTGATAAGGATAATCATAGGATACAGGTT
TTTTCTAATAACGGAGAATATATTAAAGAAATCGGTGCTCATGGTCAACA
ATGCGGCATGTTTGATAACCCGCATTATTTAGCTGTGTGCCCGAAAACCA
AAAACATTTTTGTCAGTGACACTTCAAATCACAGAATTCAGGTTTTTGAT
AAACATGGCACATATTTATACAGTTTTAATGGCGACGGACCGACGAAATT
TCACTTAAAGTATCCACGTGGGATAACTGTAGACAACGAGG
back to top

protein sequence of SMED30029356-orf-1

>SMED30029356-orf-1 ID=SMED30029356-orf-1|Name=SMED30029356-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=168bp
MVCDQGTDDNVQLKFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLIC
EIGKSSNNKAKLSYPWGIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIG
AHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGD
GPTKFHLKYPRGITVDNE
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR0110426-blade_b-propeller_TolB-like
IPR001258NHL_repeat
IPR013017NHL_repeat_subgr
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011042Six-bladed beta-propeller, TolB-likeGENE3DG3DSA:2.120.10.30coord: 48..168
e-value: 1.1E-37
score: 131.8
IPR001258NHL repeatPFAMPF01436NHLcoord: 62..89
e-value: 9.9E-9
score: 34.8
coord: 109..137
e-value: 8.2E-7
score: 28.8
NoneNo IPR availablePANTHERPTHR24104FAMILY NOT NAMEDcoord: 15..167
NoneNo IPR availableSUPERFAMILYSSF63825YWTD domaincoord: 13..167
IPR013017NHL repeat, subgroupPROSITEPS51125NHLcoord: 96..140
score: 12.541
IPR013017NHL repeat, subgroupPROSITEPS51125NHLcoord: 15..45
score: 6.374
IPR013017NHL repeat, subgroupPROSITEPS51125NHLcoord: 151..168
score: 5.099
IPR013017NHL repeat, subgroupPROSITEPS51125NHLcoord: 49..92
score: 12.768