Serine incorporator 3

Overview
NameSerine incorporator 3
Smed IDSMED30029350
Length (bp)1633
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine incorporator 3 (SMED30029350) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine incorporator 3 (SMED30029350) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine incorporator 3 (SMED30029350) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine incorporator 3 (SMED30029350) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029350

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30029350SMESG000020805.1 dd_Smed_v4_1130_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30029350SMESG000020805.1 dd_Smed_v4_1130_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30029350SMESG000020805.1 dd_Smed_v4_1130_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30029350SMESG000020805.1 dd_Smed_v4_1130_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30029350SMESG000020805.1 dd_Smed_v4_1130_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029350SMESG000020805.1 dd_Smed_v4_1130_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine incorporator 3 vs. Ensembl Human
Match: SERINC3 (serine incorporator 3 [Source:HGNC Symbol;Acc:HGNC:11699])

HSP 1 Score: 380.563 bits (976), Expect = 1.137e-126
Identity = 211/445 (47.42%), Postives = 287/445 (64.49%), Query Frame = 3
Query:  174 KNSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLIINTYNTSRPNGIGTTVTSV--TNNEQNWSWTVI-----VGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 1487
            KNST TRL+Y   L+L T++S IM     +  L  I   C   E G       I +  DC ++ GY AVYR+ FAMA FFF+F +LM KV +S+D RA + NGFWFFKI   IG+MVG FYIP    F + W ++GMIG  L+ILIQL+LLVDFAHSWNESW++  EE + + +Y  L+ FT  FY  S+  + LLY YY     C  NKFFIS N+ILC++ SI+SI PKI E+ PRSGLLQSS++TLYT+YLTWSAM+N  +++CNP L+      + P       T+V  T    + S +++     +GL VF+L ++YSSIR+S ++ V KLT+ GS++ IL D  +     +     +   DNE+EGV Y YS FH M  L SLY+MMTLT+WY P++   ++ S   +VWVKI SSW+C+ +Y+WTL+AP +   R+F+
Sbjct:   33 KNSTVTRLIYAFILLLSTVVSYIMQRKEMETYLKKIPGFC---EGGFKIHEADINADKDCDVLVGYKAVYRISFAMAIFFFVFSLLMFKVKTSKDLRAAVHNGFWFFKIAALIGIMVGSFYIP-GGYFSSVWFVVGMIGAALFILIQLVLLVDFAHSWNESWVNRMEEGNPRLWYAALLSFTSAFYILSIICVGLLYTYYTKPDGCTENKFFISINLILCVVASIISIHPKIQEHQPRSGLLQSSLITLYTMYLTWSAMSNEPDRSCNPNLMSFITRITAPTLAPGNSTAVVPTPTPPSKSGSLLDSDNFIGLFVFVLCLLYSSIRTSTNSQVDKLTLSGSDSVILGDTTTSGASDEEDGQPRRAVDNEKEGVQYSYSLFHLMLCLASLYIMMTLTSWYSPDAKFQSMTSKWPAVWVKISSSWVCLLLYVWTLVAPLVLTSRDFS 473          
BLAST of Serine incorporator 3 vs. Ensembl Human
Match: SERINC3 (serine incorporator 3 [Source:HGNC Symbol;Acc:HGNC:11699])

HSP 1 Score: 380.563 bits (976), Expect = 1.137e-126
Identity = 211/445 (47.42%), Postives = 287/445 (64.49%), Query Frame = 3
Query:  174 KNSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLIINTYNTSRPNGIGTTVTSV--TNNEQNWSWTVI-----VGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 1487
            KNST TRL+Y   L+L T++S IM     +  L  I   C   E G       I +  DC ++ GY AVYR+ FAMA FFF+F +LM KV +S+D RA + NGFWFFKI   IG+MVG FYIP    F + W ++GMIG  L+ILIQL+LLVDFAHSWNESW++  EE + + +Y  L+ FT  FY  S+  + LLY YY     C  NKFFIS N+ILC++ SI+SI PKI E+ PRSGLLQSS++TLYT+YLTWSAM+N  +++CNP L+      + P       T+V  T    + S +++     +GL VF+L ++YSSIR+S ++ V KLT+ GS++ IL D  +     +     +   DNE+EGV Y YS FH M  L SLY+MMTLT+WY P++   ++ S   +VWVKI SSW+C+ +Y+WTL+AP +   R+F+
Sbjct:   33 KNSTVTRLIYAFILLLSTVVSYIMQRKEMETYLKKIPGFC---EGGFKIHEADINADKDCDVLVGYKAVYRISFAMAIFFFVFSLLMFKVKTSKDLRAAVHNGFWFFKIAALIGIMVGSFYIP-GGYFSSVWFVVGMIGAALFILIQLVLLVDFAHSWNESWVNRMEEGNPRLWYAALLSFTSAFYILSIICVGLLYTYYTKPDGCTENKFFISINLILCVVASIISIHPKIQEHQPRSGLLQSSLITLYTMYLTWSAMSNEPDRSCNPNLMSFITRITAPTLAPGNSTAVVPTPTPPSKSGSLLDSDNFIGLFVFVLCLLYSSIRTSTNSQVDKLTLSGSDSVILGDTTTSGASDEEDGQPRRAVDNEKEGVQYSYSLFHLMLCLASLYIMMTLTSWYSPDAKFQSMTSKWPAVWVKISSSWVCLLLYVWTLVAPLVLTSRDFS 473          
BLAST of Serine incorporator 3 vs. Ensembl Human
Match: SERINC1 (serine incorporator 1 [Source:HGNC Symbol;Acc:HGNC:13464])

HSP 1 Score: 363.229 bits (931), Expect = 2.892e-120
Identity = 215/443 (48.53%), Postives = 288/443 (65.01%), Query Frame = 3
Query:  177 NSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLI-INTYNTSRPNGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVSKPQEGGQSVW---DNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNW--YQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 1487
            NST TRL+Y LFL++G  ++C+ML PG +  L+ I   C   E G+ P          C+++ GY AVYR+CF +A F+ L  +LMIKV SS DPRA + NGFWFFK    I +++G F+IP  + F T W  +GM G F +ILIQL+LL+DFAHSWNESW++  EE +++ +Y  L+  T   Y  SL  IVL ++YY     C+ NK FIS NM+LC+  S++SILPKI E  PRSGLLQSS++T+YT+YLTWSAMTN    NCNP+L+ I  YNT+      +TV     + Q W    I+GL++FLL V YSSIR+S ++ V KLT+   E+ ++ D   GA      E G  V    DNE +GV Y YSFFHFM FL SLY+MMTLTNW  Y+P+     + S   +VWVKI SSW+ I +Y+WTL+AP +  +R+F+
Sbjct:   34 NSTVTRLIYALFLLVGVCVACVMLIPGMEEQLNKIPGFCEN-EKGVVP----------CNILVGYKAVYRLCFGLAMFYLLLSLLMIKVKSSSDPRAAVHNGFWFFKFAAAIAIIIGAFFIPEGT-FTTVWFYVGMAGAFCFILIQLVLLIDFAHSWNESWVEKMEEGNSRCWYAALLSATALNYLLSLVAIVLFFVYYTHPASCSENKAFISVNMLLCVGASVMSILPKIQESQPRSGLLQSSVITVYTMYLTWSAMTNEPETNCNPSLLSIIGYNTT------STVPKEGQSVQWWHAQGIIGLILFLLCVFYSSIRTSNNSQVNKLTLTSDESTLIED--GGARSDGSLEDGDDVHRAVDNERDGVTYSYSFFHFMLFLASLYIMMTLTNWYRYEPSRE---MKSQWTAVWVKISSSWIGIVLYVWTLVAPLVLTNRDFD 453          
BLAST of Serine incorporator 3 vs. Ensembl Human
Match: SERINC2 (serine incorporator 2 [Source:HGNC Symbol;Acc:HGNC:23231])

HSP 1 Score: 336.65 bits (862), Expect = 8.215e-110
Identity = 201/442 (45.48%), Postives = 276/442 (62.44%), Query Frame = 3
Query:  174 KNSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSG-FDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCN---PTLIINTYNTSRPNGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 1487
            +NST +RL++  FL LG ++S IML+PG ++ L  +  +C   E    P   T+  G  DC  + GY AVYR+CFA A FFF F +LM+ V SS+DPRA IQNGFWFFK LI +GL VG FYIP  S F   W   G++G FL+ILIQL+LL+DFAHSWN+ W+   EE D++A+Y GL FFT+ FY  S+  + L+++YY     C   K FIS N+  C+ +SI ++LPK+ +  P SGLLQ+S++TLYT+++TWSA+++   + CN   PT + N    + P G  T         Q W    IVGL++FLL  ++ S+RSS H  V  L M   E   + D           EG    +DNE++GV Y YSFFHF   L SL+VMMTLTNWY+P      +++  A VWVKI +SW  + +YLWTL+AP +  +R+F+
Sbjct:   37 RNSTVSRLIFTFFLFLGVLVSIIMLSPGVESQLYKLPWVCE--EGAGIP---TVLQGHIDCGSLLGYRAVYRMCFATAAFFFFFTLLMLCVSSSRDPRAAIQNGFWFFKFLILVGLTVGAFYIPDGS-FTNIWFYFGVVGSFLFILIQLVLLIDFAHSWNQRWLGKAEECDSRAWYAGLFFFTLLFYLLSIAAVALMFMYYTEPSGCHEGKVFISLNLTFCVCVSIAAVLPKVQDAQPNSGLLQASVITLYTMFVTWSALSSIPEQKCNPHLPTQLGNETVVAGPEGYET---------QWWDAPSIVGLIIFLLCTLFISLRSSDHRQVNSL-MQTEECPPMLDATQQQQQVAACEG--RAFDNEQDGVTYSYSFFHFCLVLASLHVMMTLTNWYKPGETRKMISTWTA-VWVKICASWAGLLLYLWTLVAPLLLRNRDFS 459          
BLAST of Serine incorporator 3 vs. Ensembl Human
Match: SERINC2 (serine incorporator 2 [Source:HGNC Symbol;Acc:HGNC:23231])

HSP 1 Score: 336.65 bits (862), Expect = 8.352e-110
Identity = 201/442 (45.48%), Postives = 276/442 (62.44%), Query Frame = 3
Query:  174 KNSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSG-FDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCN---PTLIINTYNTSRPNGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 1487
            +NST +RL++  FL LG ++S IML+PG ++ L  +  +C   E    P   T+  G  DC  + GY AVYR+CFA A FFF F +LM+ V SS+DPRA IQNGFWFFK LI +GL VG FYIP  S F   W   G++G FL+ILIQL+LL+DFAHSWN+ W+   EE D++A+Y GL FFT+ FY  S+  + L+++YY     C   K FIS N+  C+ +SI ++LPK+ +  P SGLLQ+S++TLYT+++TWSA+++   + CN   PT + N    + P G  T         Q W    IVGL++FLL  ++ S+RSS H  V  L M   E   + D           EG    +DNE++GV Y YSFFHF   L SL+VMMTLTNWY+P      +++  A VWVKI +SW  + +YLWTL+AP +  +R+F+
Sbjct:   33 RNSTVSRLIFTFFLFLGVLVSIIMLSPGVESQLYKLPWVCE--EGAGIP---TVLQGHIDCGSLLGYRAVYRMCFATAAFFFFFTLLMLCVSSSRDPRAAIQNGFWFFKFLILVGLTVGAFYIPDGS-FTNIWFYFGVVGSFLFILIQLVLLIDFAHSWNQRWLGKAEECDSRAWYAGLFFFTLLFYLLSIAAVALMFMYYTEPSGCHEGKVFISLNLTFCVCVSIAAVLPKVQDAQPNSGLLQASVITLYTMFVTWSALSSIPEQKCNPHLPTQLGNETVVAGPEGYET---------QWWDAPSIVGLIIFLLCTLFISLRSSDHRQVNSL-MQTEECPPMLDATQQQQQVAACEG--RAFDNEQDGVTYSYSFFHFCLVLASLHVMMTLTNWYKPGETRKMISTWTA-VWVKICASWAGLLLYLWTLVAPLLLRNRDFS 455          
BLAST of Serine incorporator 3 vs. Ensembl Celegans
Match: Y57E12AL.1 (pep chromosome:WBcel235:V:7060811:7062695:1 gene:WBGene00021956.1 transcript:Y57E12AL.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y57E12AL.1)

HSP 1 Score: 367.466 bits (942), Expect = 3.614e-122
Identity = 210/445 (47.19%), Postives = 296/445 (66.52%), Query Frame = 3
Query:  174 KNSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLI-INTYNTSRPNGIGTTVTSVTNNEQNWSWTV----IVGLVVFLLTVIYSSIRSSGHTSVGKLTMHG--SETAI-LTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREF 1484
            K+ST+TR++Y   L   T LSCIML PG +N L+  K  C     GL       Y+G  C+   G+ AVYRVC A A F+ LF ++MI V  S+D R+ IQNGFWFFK LI   L+VG F+I + S   T  + IG+IGGF++ILIQLIL+VDFAH   E+W+  YEE+++   Y GL+      +A +LT ++++YIYY     C L +FF+ FN +LC+ ++ +S+ P + E  PRSGL+Q+ ++T Y +YLTW+A+ N  +K CNP+LI I T N++ P        S   +E ++   +    IV L ++   ++Y+SIR+S +TS+GK+T  G  S+ AI L+   +GA  ++ Q   + V+DNEEEGVAY YSFFHFMF L SLYVMMTLT+WY+P+++L  LNSN ASVWVKI+SSW+C+ +Y WTL+AP ++PDREF
Sbjct:   34 KSSTTTRIMYAFLLFTSTFLSCIMLLPGIQNKLAENKWFCE----GLNE-----YAGISCAHATGFQAVYRVCAATASFYLLFMLIMIGVKDSKDGRSSIQNGFWFFKYLILGALIVGFFFIRSES-LATPLMYIGLIGGFMFILIQLILIVDFAHGLAEAWVTSYEESESNYCYAGLLVTVFGGFALALTAVIIMYIYYASGEGCGLPRFFVIFNTLLCVGLTALSLAPAVQEVSPRSGLVQAVMITGYVMYLTWAALINNPDKACNPSLISIFTGNSTDP--------SHKTDEGHYGIPLPAQSIVSLFLWFACLLYASIRNSSNTSLGKITGGGNTSDEAIQLSSSLNGADDAESQN-SKRVYDNEEEGVAYSYSFFHFMFALASLYVMMTLTSWYKPSNDLSHLNSNMASVWVKIVSSWVCVALYCWTLVAPIIYPDREF 459          
BLAST of Serine incorporator 3 vs. Ensembl Celegans
Match: Y57E12AL.1 (pep chromosome:WBcel235:V:7060811:7062695:1 gene:WBGene00021956.1 transcript:Y57E12AL.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y57E12AL.1)

HSP 1 Score: 365.155 bits (936), Expect = 2.353e-121
Identity = 209/445 (46.97%), Postives = 292/445 (65.62%), Query Frame = 3
Query:  174 KNSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLI-INTYNTSRPNGIGTTVTSVTNNEQNWSWTV----IVGLVVFLLTVIYSSIRSSGHTSVGKLTMHG--SETAI-LTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREF 1484
            K+ST+TR++Y   L   T LSCIML PG +N L+  K  C     GL       Y+G  C+   G+ AVYRVC A A F+ LF ++MI V  S+D R+ IQNGFWFFK LI   L+VG F+I + S   T  + IG+IGGF++ILIQLIL+VDFAH   E+W+  YEE+++   Y GL+      +A +LT ++++YIYY     C L +FF+ FN +LC+ ++ +S+ P + E  PRSGL+Q+ ++T Y +YLTW+A+ N  +K CNP+LI I T N++ P        S   +E ++   +    IV L ++   ++Y+SIR+S +TS+GK+T  G  S+ AI LTD           +  + V+DNEEEGVAY YSFFHFMF L SLYVMMTLT+WY+P+++L  LNSN ASVWVKI+SSW+C+ +Y WTL+AP ++PDREF
Sbjct:   34 KSSTTTRIMYAFLLFTSTFLSCIMLLPGIQNKLAENKWFCE----GLNE-----YAGISCAHATGFQAVYRVCAATASFYLLFMLIMIGVKDSKDGRSSIQNGFWFFKYLILGALIVGFFFIRSES-LATPLMYIGLIGGFMFILIQLILIVDFAHGLAEAWVTSYEESESNYCYAGLLVTVFGGFALALTAVIIMYIYYASGEGCGLPRFFVIFNTLLCVGLTALSLAPAVQEVSPRSGLVQAVMITGYVMYLTWAALINNPDKACNPSLISIFTGNSTDP--------SHKTDEGHYGIPLPAQSIVSLFLWFACLLYASIRNSSNTSLGKITGGGNTSDEAIQLTDDAE-------SQNSKRVYDNEEEGVAYSYSFFHFMFALASLYVMMTLTSWYKPSNDLSHLNSNMASVWVKIVSSWVCVALYCWTLVAPIIYPDREF 453          
BLAST of Serine incorporator 3 vs. Ensembl Celegans
Match: R11H6.2 (pep chromosome:WBcel235:V:14597939:14600091:1 gene:WBGene00011250.1 transcript:R11H6.2.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R11H6.2)

HSP 1 Score: 320.087 bits (819), Expect = 5.564e-104
Identity = 208/437 (47.60%), Postives = 277/437 (63.39%), Query Frame = 3
Query:  174 KNSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLIINTYNTSRPNGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREF 1484
            KNST+TR++Y L LI  T ++ +ML PG +  L   K LC     GL       Y+G +C    GY AVYRVC   A FFFLF +LM  V SS+D R+ IQNGFWFFK L+  G++ G F+I + +   T  + IGM+G FL+ILIQLIL+VDFAH   ES    YE+ND++A Y GL+  T   +   L   V ++I Y     C L KFF+ FN+++C+ IS++S+ P + E  PRSGLLQ  +++ Y +YLTWSA+ +  N++CNPTL  N   ++ P G  T   S        S   ++ L+++L+ ++Y+SIR+S +TS+GK+T    E   L D E G             WDNEEEGVAY YSFFHFMF L SLYVMMTLT+WY P+S+L  LNSN ASVWVK+ SSW+C  +Y WTL+AP +FPDREF
Sbjct:   34 KNSTTTRIMYALMLISATFMAVVMLLPGVQKKLVENKWLCD----GLNE-----YAGVNCEHAIGYQAVYRVCAGAASFFFLFMLLMFGVSSSKDGRSSIQNGFWFFKYLLMFGIIGGFFFIGSET-LATPLMYIGMLGAFLFILIQLILIVDFAHGLAES---QYEDNDSRACYAGLLITTFGGFLVCLIAAVYVFINYAIGDGCGLPKFFVIFNVLICVAISLLSVSPMVQEVNPRSGLLQPVVISAYIIYLTWSALLSNPNESCNPTLA-NVTQSAIPTGGVTKDDSFVTPLPVHS---LISLLIWLICLVYASIRNSSNTSLGKITGDNEEHVQLNDVEGG-----------KAWDNEEEGVAYSYSFFHFMFCLASLYVMMTLTSWYHPDSDLAHLNSNMASVWVKMFSSWICGGLYAWTLVAPIIFPDREF 442          
BLAST of Serine incorporator 3 vs. Ensembl Celegans
Match: R11H6.2 (pep chromosome:WBcel235:V:14598006:14600092:1 gene:WBGene00011250.1 transcript:R11H6.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R11H6.2)

HSP 1 Score: 320.087 bits (819), Expect = 5.564e-104
Identity = 208/437 (47.60%), Postives = 277/437 (63.39%), Query Frame = 3
Query:  174 KNSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLIINTYNTSRPNGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREF 1484
            KNST+TR++Y L LI  T ++ +ML PG +  L   K LC     GL       Y+G +C    GY AVYRVC   A FFFLF +LM  V SS+D R+ IQNGFWFFK L+  G++ G F+I + +   T  + IGM+G FL+ILIQLIL+VDFAH   ES    YE+ND++A Y GL+  T   +   L   V ++I Y     C L KFF+ FN+++C+ IS++S+ P + E  PRSGLLQ  +++ Y +YLTWSA+ +  N++CNPTL  N   ++ P G  T   S        S   ++ L+++L+ ++Y+SIR+S +TS+GK+T    E   L D E G             WDNEEEGVAY YSFFHFMF L SLYVMMTLT+WY P+S+L  LNSN ASVWVK+ SSW+C  +Y WTL+AP +FPDREF
Sbjct:   34 KNSTTTRIMYALMLISATFMAVVMLLPGVQKKLVENKWLCD----GLNE-----YAGVNCEHAIGYQAVYRVCAGAASFFFLFMLLMFGVSSSKDGRSSIQNGFWFFKYLLMFGIIGGFFFIGSET-LATPLMYIGMLGAFLFILIQLILIVDFAHGLAES---QYEDNDSRACYAGLLITTFGGFLVCLIAAVYVFINYAIGDGCGLPKFFVIFNVLICVAISLLSVSPMVQEVNPRSGLLQPVVISAYIIYLTWSALLSNPNESCNPTLA-NVTQSAIPTGGVTKDDSFVTPLPVHS---LISLLIWLICLVYASIRNSSNTSLGKITGDNEEHVQLNDVEGG-----------KAWDNEEEGVAYSYSFFHFMFCLASLYVMMTLTSWYHPDSDLAHLNSNMASVWVKMFSSWICGGLYAWTLVAPIIFPDREF 442          
BLAST of Serine incorporator 3 vs. Ensembl Fly
Match: TMS1 (gene:FBgn0028399 transcript:FBtr0310552)

HSP 1 Score: 329.717 bits (844), Expect = 2.405e-107
Identity = 196/441 (44.44%), Postives = 269/441 (61.00%), Query Frame = 3
Query:  177 NSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALC----TPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLIINTYNTSRPNGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 1487
            N++S+R +Y   L++GT+L  I L+PG ++TL  +   C    + Y  G   A        DC    GY AVYRVCF MACFF L  ++M+ V SS+DPR+ IQN FW  K LI  G  +G  +IP  S F  + + +G+IGG  +IL+QL+++VDFAHS  E+WI+  E  +++ YY+ L   T+  Y  SLT I LLYIY+     C +NKFFIS N+I C+ IS++SILP + E +P SGLLQSS++TLYTVYLTWSA+ N   K CNP +          N   T           +  T I+GLVV+LL ++Y+ I S+    V K++   SE   L+D E+G   S     G+   D E EGV Y +S FH +F   SLYVMMTLTNWY+P+S +   N N+AS+WVKI+SSWL + IY W+L AP +  +R+F+
Sbjct:   34 NASSSRFMYAFILLVGTVLGAIALSPGLQDTLKKMP-FCINSTSSYSSGALSAVSGGSLQVDCEYALGYMAVYRVCFGMACFFALMSLIMLGVKSSRDPRSHIQNNFWPLKFLICFGAAIGAIFIPDGS-FGPAMMWVGLIGGLAFILVQLVIIVDFAHSLAENWIESAE--NSRGYYYALAGVTLLCYILSLTGITLLYIYFTTSTGCGINKFFISINLIFCLAISVISILPAVQERLPHSGLLQSSLVTLYTVYLTWSAVANNPEKECNPGMF--GMMEGFGNATTTAAPPTHTTRVTFDTTNIIGLVVWLLCILYNCISSA--VEVSKISHDNSEKRALSDTEAGTDGS-----GKPSTDTETEGVTYSWSMFHLVFVCASLYVMMTLTNWYKPHSEIELFNGNEASMWVKIVSSWLGVFIYGWSLAAPIVLTNRDFS 461          
BLAST of Serine incorporator 3 vs. Ensembl Fly
Match: TMS1 (gene:FBgn0028399 transcript:FBtr0075389)

HSP 1 Score: 327.791 bits (839), Expect = 1.137e-106
Identity = 195/441 (44.22%), Postives = 267/441 (60.54%), Query Frame = 3
Query:  177 NSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALC----TPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLIINTYNTSRPNGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 1487
            N++S+R +Y   L++GT+L  I L+PG ++TL  +   C    + Y  G   A        DC    GY AVYRVCF MACFF L  ++M+ V SS+DPR+ IQN FW  K LI  G  +G  +IP  S F  + + +G+IGG  +IL+QL+++VDFAHS  E+WI+  E  +++ YY+ L   T+  Y  SLT I LLYIY+     C +NKFFIS N+I C+ IS++SILP + E +P SGLLQSS++TLYTVYLTWSA+ N   K CNP +          N   T           +  T I+GLVV+LL ++Y+ I S+    V K++   SE  +LT+  S         G  S  D E EGV Y +S FH +F   SLYVMMTLTNWY+P+S +   N N+AS+WVKI+SSWL + IY W+L AP +  +R+F+
Sbjct:   34 NASSSRFMYAFILLVGTVLGAIALSPGLQDTLKKMP-FCINSTSSYSSGALSAVSGGSLQVDCEYALGYMAVYRVCFGMACFFALMSLIMLGVKSSRDPRSHIQNNFWPLKFLICFGAAIGAIFIPDGS-FGPAMMWVGLIGGLAFILVQLVIIVDFAHSLAENWIESAE--NSRGYYYALAGVTLLCYILSLTGITLLYIYFTTSTGCGINKFFISINLIFCLAISVISILPAVQERLPHSGLLQSSLVTLYTVYLTWSAVANNPEKECNPGMF--GMMEGFGNATTTAAPPTHTTRVTFDTTNIIGLVVWLLCILYNCISSA--VEVSKISHDNSEKRVLTEALSDTEAGTDGSGKPST-DTETEGVTYSWSMFHLVFVCASLYVMMTLTNWYKPHSEIELFNGNEASMWVKIVSSWLGVFIYGWSLAAPIVLTNRDFS 465          
BLAST of Serine incorporator 3 vs. Ensembl Fly
Match: TMS1 (gene:FBgn0028399 transcript:FBtr0310550)

HSP 1 Score: 325.094 bits (832), Expect = 1.464e-105
Identity = 196/442 (44.34%), Postives = 269/442 (60.86%), Query Frame = 3
Query:  177 NSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALC----TPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLIINTYNTSRPNGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSET-AILTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 1487
            N++S+R +Y   L++GT+L  I L+PG ++TL  +   C    + Y  G   A        DC    GY AVYRVCF MACFF L  ++M+ V SS+DPR+ IQN FW  K LI  G  +G  +IP  S F  + + +G+IGG  +IL+QL+++VDFAHS  E+WI+  E  +++ YY+ L   T+  Y  SLT I LLYIY+     C +NKFFIS N+I C+ IS++SILP + E +P SGLLQSS++TLYTVYLTWSA+ N   K CNP +          N   T           +  T I+GLVV+LL ++Y+ I S+    V K++   SE    L+D E+G   S     G+   D E EGV Y +S FH +F   SLYVMMTLTNWY+P+S +   N N+AS+WVKI+SSWL + IY W+L AP +  +R+F+
Sbjct:   34 NASSSRFMYAFILLVGTVLGAIALSPGLQDTLKKMP-FCINSTSSYSSGALSAVSGGSLQVDCEYALGYMAVYRVCFGMACFFALMSLIMLGVKSSRDPRSHIQNNFWPLKFLICFGAAIGAIFIPDGS-FGPAMMWVGLIGGLAFILVQLVIIVDFAHSLAENWIESAE--NSRGYYYALAGVTLLCYILSLTGITLLYIYFTTSTGCGINKFFISINLIFCLAISVISILPAVQERLPHSGLLQSSLVTLYTVYLTWSAVANNPEKECNPGMF--GMMEGFGNATTTAAPPTHTTRVTFDTTNIIGLVVWLLCILYNCISSA--VEVSKISHDNSEKREALSDTEAGTDGS-----GKPSTDTETEGVTYSWSMFHLVFVCASLYVMMTLTNWYKPHSEIELFNGNEASMWVKIVSSWLGVFIYGWSLAAPIVLTNRDFS 462          
BLAST of Serine incorporator 3 vs. Ensembl Fly
Match: TMS1 (gene:FBgn0028399 transcript:FBtr0310551)

HSP 1 Score: 322.783 bits (826), Expect = 1.090e-104
Identity = 195/441 (44.22%), Postives = 267/441 (60.54%), Query Frame = 3
Query:  177 NSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALC----TPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLIINTYNTSRPNGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 1487
            N++S+R +Y   L++GT+L  I L+PG ++TL  +   C    + Y  G   A        DC    GY AVYRVCF MACFF L  ++M+ V SS+DPR+ IQN FW  K LI  G  +G  +IP  S F  + + +G+IGG  +IL+QL+++VDFAHS  E+WI+  E  +++ YY+ L   T+  Y  SLT I LLYIY+     C +NKFFIS N+I C+ IS++SILP + E +P SGLLQSS++TLYTVYLTWSA+ N   K CNP +          N   T           +  T I+GLVV+LL ++Y+ I S+    V K++   SE     D E+G   S     G+   D E EGV Y +S FH +F   SLYVMMTLTNWY+P+S +   N N+AS+WVKI+SSWL + IY W+L AP +  +R+F+
Sbjct:   34 NASSSRFMYAFILLVGTVLGAIALSPGLQDTLKKMP-FCINSTSSYSSGALSAVSGGSLQVDCEYALGYMAVYRVCFGMACFFALMSLIMLGVKSSRDPRSHIQNNFWPLKFLICFGAAIGAIFIPDGS-FGPAMMWVGLIGGLAFILVQLVIIVDFAHSLAENWIESAE--NSRGYYYALAGVTLLCYILSLTGITLLYIYFTTSTGCGINKFFISINLIFCLAISVISILPAVQERLPHSGLLQSSLVTLYTVYLTWSAVANNPEKECNPGMF--GMMEGFGNATTTAAPPTHTTRVTFDTTNIIGLVVWLLCILYNCISSA--VEVSKISHDNSEK---RDTEAGTDGS-----GKPSTDTETEGVTYSWSMFHLVFVCASLYVMMTLTNWYKPHSEIELFNGNEASMWVKIVSSWLGVFIYGWSLAAPIVLTNRDFS 458          
BLAST of Serine incorporator 3 vs. Ensembl Fly
Match: TMS1 (gene:FBgn0028399 transcript:FBtr0310553)

HSP 1 Score: 321.242 bits (822), Expect = 3.979e-104
Identity = 193/441 (43.76%), Postives = 264/441 (59.86%), Query Frame = 3
Query:  177 NSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALC----TPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLIINTYNTSRPNGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 1487
            N++S+R +Y   L++GT+L  I L+PG ++TL  +   C    + Y  G   A        DC    GY AVYRVCF MACFF L  ++M+ V SS+DPR+ IQN FW  K LI  G  +G  +IP  S F  + + +G+IGG  +IL+QL+++VDFAHS  E+WI+  E  +++ YY+ L   T+  Y  SLT I LLYIY+     C +NKFFIS N+I C+ IS++SILP + E +P SGLLQSS++TLYTVYLTWSA+ N   K CNP +          N   T           +  T I+GLVV+LL ++Y+ I S+    V K++   SE        SG P +          D E EGV Y +S FH +F   SLYVMMTLTNWY+P+S +   N N+AS+WVKI+SSWL + IY W+L AP +  +R+F+
Sbjct:   34 NASSSRFMYAFILLVGTVLGAIALSPGLQDTLKKMP-FCINSTSSYSSGALSAVSGGSLQVDCEYALGYMAVYRVCFGMACFFALMSLIMLGVKSSRDPRSHIQNNFWPLKFLICFGAAIGAIFIPDGS-FGPAMMWVGLIGGLAFILVQLVIIVDFAHSLAENWIESAE--NSRGYYYALAGVTLLCYILSLTGITLLYIYFTTSTGCGINKFFISINLIFCLAISVISILPAVQERLPHSGLLQSSLVTLYTVYLTWSAVANNPEKECNPGMF--GMMEGFGNATTTAAPPTHTTRVTFDTTNIIGLVVWLLCILYNCISSA--VEVSKISHDNSEKREAGTDGSGKPST----------DTETEGVTYSWSMFHLVFVCASLYVMMTLTNWYKPHSEIELFNGNEASMWVKIVSSWLGVFIYGWSLAAPIVLTNRDFS 456          
BLAST of Serine incorporator 3 vs. Ensembl Zebrafish
Match: serinc1 (serine incorporator 1 [Source:ZFIN;Acc:ZDB-GENE-030131-4415])

HSP 1 Score: 407.142 bits (1045), Expect = 1.677e-137
Identity = 224/440 (50.91%), Postives = 292/440 (66.36%), Query Frame = 3
Query:  174 KNSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLI-INTYNTSRPNGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVS-KPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 1487
             NST TRL+Y  F++LG  ++CIML PG +  L  I   C   E G+  +   +    +C ++ GY AVYRVCF MA FF LF ++M+KV SSQDPRA + NGFWFFK      + VG F+IP    F T W  IGM G F +ILIQL+LL+DFAHSWNESW++  EE +++ +Y  L+  T   YA SL  +VL Y+YY     C  NK FIS NM+LC+  S++SILPKI E  PRSGLLQSSI+TLYT+YLTWSAMTN  ++ CNP+L+ I   N++ P G    V       Q W    IVGL++FL+ V+YSSIR+S +T V KLT+   E+A++ D    AP + +  +G     DNE++GV Y YSFFHFM FL SLY+MMTLTNWY P+SN  T+ S   SVWVKI SSW+CI +Y+WTL+AP +  +R+F+
Sbjct:   33 NNSTVTRLIYAFFMLLGVGIACIMLMPGMEGQLKKIPGFC---EGGMGSSIPGVEGHVNCDVLVGYKAVYRVCFGMAMFFLLFSLIMVKVKSSQDPRAAVHNGFWFFKFAAATAITVGAFFIPEGP-FTTVWFYIGMAGAFCFILIQLVLLIDFAHSWNESWVEKMEEGNSRCWYAALLSATAINYALSLMSLVLFYVYYTHSDGCTENKVFISINMLLCVGASVMSILPKIQESQPRSGLLQSSIVTLYTMYLTWSAMTNEPDRRCNPSLLGIIGLNSTSPAGQDRVV-------QWWDAQGIVGLILFLMCVLYSSIRNSSNTQVNKLTLTSDESALIEDGP--APENFEVGDGTNRAIDNEKDGVTYSYSFFHFMLFLASLYIMMTLTNWYSPDSNYETMTSKWPSVWVKISSSWICISLYVWTLVAPLVLTNRDFD 459          
BLAST of Serine incorporator 3 vs. Ensembl Zebrafish
Match: serinc2 (serine incorporator 2 [Source:ZFIN;Acc:ZDB-GENE-041111-296])

HSP 1 Score: 373.244 bits (957), Expect = 2.794e-124
Identity = 219/439 (49.89%), Postives = 294/439 (66.97%), Query Frame = 3
Query:  177 NSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSG-FDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLIINTYNTSRPNGIGTTVTSVTNN-EQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 1487
            NST TRL +  FL+LGTI+S IM+ PG +  L  I   C   E G   +S   + G  +C +I GY +VYR+CFAMACFFFLF ++MI+V SS+DPRA IQNGFWFFK LI +G+ VG F+IP +  F T W   G++G F++ILIQLILLVDFAHSWN+ W++  E+ ++K +Y  L+ FT+  Y  +   +VL YI+Y    DC  NK FIS N+I CI++S+V+ILPK+ E  P SGLLQ+S+++LYT+YLTWSAM+N  N+ CNP+L+    +  +      T TS      Q W    +VGLV+FLL  +Y+SIRSS ++ V KL M   E   L   ++   +S  ++G +   DNEE+GV Y YSFFHF  FL SLY+MMTLTNWYQP ++   + +   SVWVKI SSWL + +YLWTL+AP +  DR+FN
Sbjct:   34 NSTVTRLAFSFFLLLGTIVSIIMILPGMETQLKKIPGFC---EGG---SSIPGFEGKVNCDVIVGYKSVYRMCFAMACFFFLFSIIMIRVRSSKDPRAAIQNGFWFFKFLILVGITVGAFFIP-DGMFNTVWYYFGVVGSFIFILIQLILLVDFAHSWNQKWVENAEDGNSKCWYAALLSFTLVHYICAFAAVVLFYIFYTQPDDCTENKVFISLNLIFCIIVSVVAILPKVQEAQPSSGLLQASLISLYTMYLTWSAMSNNPNRKCNPSLL----SIVKGQSAAPTPTSTPGVFTQWWDAQSVVGLVIFLLCTLYASIRSSNNSQVNKL-MQTEEVQGLASSDANDAIS--EDGVRRAVDNEEDGVTYGYSFFHFSLFLASLYIMMTLTNWYQPETDYAAMTTTMPSVWVKICSSWLGLGLYLWTLVAPLVLTDRDFN 458          
BLAST of Serine incorporator 3 vs. Ensembl Zebrafish
Match: serinc2l (serine incorporator 2, like [Source:ZFIN;Acc:ZDB-GENE-100921-58])

HSP 1 Score: 367.851 bits (943), Expect = 3.443e-122
Identity = 216/437 (49.43%), Postives = 287/437 (65.68%), Query Frame = 3
Query:  174 KNSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLIINTYNTSRPNGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREF 1484
             NST TRL++  FL+LGT++S IM+ PG +  L  I   C        P    I +  +C +I GY +VYR+CFAMACFFFLF  +MI+V SS+DPR  +QNGFWFFK LI +G+ VG F+IP  + F   W   G++G F +ILIQLILL+DFAHSWNE W+   EE ++K ++ GL+FFTI +YA +   IVL Y+YY    +C  +KFFISFN+ILC+++S+VSILPK+ +  P+SGLLQSSI+TLYT+Y+TWSAMTN  N+ CNP+L+    N S    +    TS     Q W    IVGLV+FL    Y+SIRSS +  V +L         +  +E G    +       V DNEE+GV Y+YSFFHF   L SLY+MMTLTNWY+P++    + S   +VWVKI SSWL + +YLWTL+AP +F +R+F
Sbjct:   33 NNSTITRLIFSFFLLLGTLVSVIMILPGMETQLRKIPGFCQGGTT--IPG---IENHVNCDVIVGYKSVYRMCFAMACFFFLFFAIMIRVKSSKDPRGAVQNGFWFFKFLILVGITVGAFFIPDGT-FHDVWFYFGIVGSFAFILIQLILLIDFAHSWNEVWVRNAEEGNSKCWFSGLLFFTILYYALAFAAIVLFYLYYTKPDNCTEHKFFISFNLILCVIVSVVSILPKVQDASPQSGLLQSSIITLYTMYVTWSAMTNNPNRECNPSLLGLVSNISTTEAVP---TSSPGTVQWWDAQGIVGLVIFLFCTFYASIRSSSNAQVNRLMQTEEGKGGVGGEEVGEDGLR------RVVDNEEDGVTYNYSFFHFHLLLASLYIMMTLTNWYKPDTTTQAMQSTMPAVWVKICSSWLGLGLYLWTLVAPVIFSNRDF 454          
BLAST of Serine incorporator 3 vs. Ensembl Zebrafish
Match: serinc5 (serine incorporator 5 [Source:NCBI gene;Acc:406835])

HSP 1 Score: 261.151 bits (666), Expect = 8.292e-81
Identity = 170/451 (37.69%), Postives = 249/451 (55.21%), Query Frame = 3
Query:  174 KNSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPA-SYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPD-CALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLIINTYNTSRP--NGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSI-----RSSGHTSVGKLTMHGSETAI-----LTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQ-PNSNLLTLNSNDASV-WVKIISSWLCICIYLWTLLAPCMFPDR 1478
            K STSTR +Y LF +L T+   IM++P  +  +           I  Y      + +G +CS + GY AVY+VCF MACFFF F V  I+V +S   RA + NGFWFFK +  +    GGF++P    F+  W  +G  GGFL+I+IQL+LLV FAH WN++W  G     NK +Y  L   T+  ++ ++  +V +++YY  HP+ C LNK F+  N  LC ++S+++I P I  + P SGLLQ +++TLY +YLT+SA+ +   +     +  N      P  +G+ +    VT           VG  +    ++YS +     RSS    V +  M  +E A      + D E      +   GGQ+V  +E +G  Y Y FFHF+FFLGSLYVMMT+TNW+   N+ +  L     SV W+K+ SSW+C+  Y+WTL+ P +FP R
Sbjct:   30 KQSTSTRFMYALFFMLVTVTCVIMMSPTVEMAMRE--------HIPFYSQMCQQLNAGENCSTLVGYSAVYKVCFGMACFFFFFAVFTIRVQNSTGCRAAVHNGFWFFKFVALLACCAGGFFLPNQDQFLEVWRYVGAAGGFLFIIIQLMLLVQFAHRWNQNWSSG--ATYNKLWYAALALVTLVLFSVAVGGMVFMFMYY-THPEACFLNKIFLGVNGGLCFIVSLLAISPCIQTFQPTSGLLQPAVITLYVMYLTFSALASKPIEMVEDEIKGNITVCVFPFKSGLKSDTNIVTG----------VGTAILFCCILYSCLISTTKRSSAALQVYRNDMPENERARCCFCWVDDTEDYD--DEKTSGGQNVKYDERDGTVYSYCFFHFVFFLGSLYVMMTVTNWFHYDNAKIERLLEGSWSVFWIKMASSWVCLFFYMWTLVVPMLFPQR 457          
BLAST of Serine incorporator 3 vs. Ensembl Zebrafish
Match: si:ch73-267c23.10 (si:ch73-267c23.10 [Source:ZFIN;Acc:ZDB-GENE-160114-59])

HSP 1 Score: 234.958 bits (598), Expect = 4.487e-73
Identity = 127/279 (45.52%), Postives = 174/279 (62.37%), Query Frame = 3
Query:  672 EENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTL--IIN--TYNTSRPNGIGTTVTSVTNNE--QNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVSKPQEG--GQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREF 1484
            E+ + K +Y  L+  T   Y  S +  +L +  Y     C LNKFFI FNM+LC+  S +S+LP I EY PRSGLLQSSI+TLYT+YLTWSAMTN  ++ CNP+L  II   T  T  P  I     +V      + W    IVGL +F+L ++YSSIRSS  + V KLT+  ++ A + D+ + +     +E      + DNE E V Y Y+FFHFM FL SLY+MMTLTNWY P+++   + S   +VWVKI SSW+C+ +Y W+L+AP + P+R+F
Sbjct:    2 EKENEKRWYIALVLVTGLNYILSFSAALLCFSIYTQPEGCVLNKFFICFNMLLCVTASALSVLPTIQEYQPRSGLLQSSIMTLYTMYLTWSAMTNEPDRTCNPSLLSIIQQITSTTVAPLEIENQTATVPTAPYLRWWDAQSIVGLAIFVLCILYSSIRSSNTSQVNKLTL-AAKDATVQDESAASSAEAAEENTTAHHMEDNERETVQYSYAFFHFMLFLASLYIMMTLTNWYSPDTDYNAMRSKWPAVWVKISSSWVCLTLYTWSLIAPMILPNRDF 279          
BLAST of Serine incorporator 3 vs. Ensembl Xenopus
Match: serinc1 (serine incorporator 1, gene 1 [Source:NCBI gene;Acc:496872])

HSP 1 Score: 402.519 bits (1033), Expect = 1.587e-135
Identity = 219/439 (49.89%), Postives = 286/439 (65.15%), Query Frame = 3
Query:  177 NSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTL--IINTYNTSRPNGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 1487
            NST TRL+Y  FL++G  ++C+ML PG +  L  I   C   + G+  +   I    +C ++ GY AVYRVCF MA FF LF +LMIKV SSQDPRA + NGFWFFK    +G+ VG F+IP    F T W  +GM G F +ILIQL+LL+DFAHSWNESW++  EE +++ +Y  L+  T   Y  SL  IVL Y+YY     CA NK FIS NM+LCI  S++S+LPKI E  PRSGLLQSS++T+YT+YLTWSAMTN  ++ CNP+L  II   +TS P  +           Q W    IVGLV+FLL V+YSSIR+S ++ V KLT+   E+ ++ D        +  +      DNE +GV Y YSFFHFM FL SLY+MMTLTNWY P+S+   + S   SVWVKI SSW+CI +Y+WTL+AP +  +R+F+
Sbjct:   32 NSTVTRLIYAFFLLIGVTVACVMLIPGMEEQLKKIPGFC---DGGMGSSIPGISGHVNCDVLVGYKAVYRVCFGMAMFFLLFSLLMIKVKSSQDPRASVHNGFWFFKFAAAVGITVGAFFIPEGP-FTTVWFYVGMGGAFCFILIQLVLLIDFAHSWNESWVEKMEEGNSRCWYAALLSATGMNYVLSLVAIVLFYVYYTHPEGCAENKAFISVNMLLCIGASLMSVLPKIQESQPRSGLLQSSVITVYTMYLTWSAMTNEPDRKCNPSLLSIIGYNSTSTPGQVKVV--------QWWDAQGIVGLVLFLLCVLYSSIRTSNNSQVNKLTLTSDESTLIEDGGRSDGSMEDSDNAHRAVDNERDGVTYSYSFFHFMLFLASLYIMMTLTNWYSPDSSYEMMTSKWPSVWVKISSSWVCIVLYVWTLVAPLVLTNRDFD 458          
BLAST of Serine incorporator 3 vs. Ensembl Xenopus
Match: serinc1 (serine incorporator 1, gene 1 [Source:NCBI gene;Acc:496872])

HSP 1 Score: 402.134 bits (1032), Expect = 2.058e-135
Identity = 219/439 (49.89%), Postives = 286/439 (65.15%), Query Frame = 3
Query:  177 NSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTL--IINTYNTSRPNGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 1487
            NST TRL+Y  FL++G  ++C+ML PG +  L  I   C   + G+  +   I    +C ++ GY AVYRVCF MA FF LF +LMIKV SSQDPRA + NGFWFFK    +G+ VG F+IP    F T W  +GM G F +ILIQL+LL+DFAHSWNESW++  EE +++ +Y  L+  T   Y  SL  IVL Y+YY     CA NK FIS NM+LCI  S++S+LPKI E  PRSGLLQSS++T+YT+YLTWSAMTN  ++ CNP+L  II   +TS P  +           Q W    IVGLV+FLL V+YSSIR+S ++ V KLT+   E+ ++ D        +  +      DNE +GV Y YSFFHFM FL SLY+MMTLTNWY P+S+   + S   SVWVKI SSW+CI +Y+WTL+AP +  +R+F+
Sbjct:   32 NSTVTRLIYAFFLLIGVTVACVMLIPGMEEQLKKIPGFC---DGGMGSSIPGISGHVNCDVLVGYKAVYRVCFGMAMFFLLFSLLMIKVKSSQDPRASVHNGFWFFKFAAAVGITVGAFFIPEGP-FTTVWFYVGMGGAFCFILIQLVLLIDFAHSWNESWVEKMEEGNSRCWYAALLSATGMNYVLSLVAIVLFYVYYTHPEGCAENKAFISVNMLLCIGASLMSVLPKIQESQPRSGLLQSSVITVYTMYLTWSAMTNEPDRKCNPSLLSIIGYNSTSTPGQVKVV--------QWWDAQGIVGLVLFLLCVLYSSIRTSNNSQVNKLTLTSDESTLIEDGGRSDGSMEDSDNAHRAVDNERDGVTYSYSFFHFMLFLASLYIMMTLTNWYSPDSSYEMMTSKWPSVWVKISSSWVCIVLYVWTLVAPLVLTNRDFD 458          
BLAST of Serine incorporator 3 vs. Ensembl Xenopus
Match: serinc1 (serine incorporator 1, gene 1 [Source:NCBI gene;Acc:496872])

HSP 1 Score: 402.134 bits (1032), Expect = 2.344e-135
Identity = 219/439 (49.89%), Postives = 286/439 (65.15%), Query Frame = 3
Query:  177 NSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTL--IINTYNTSRPNGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 1487
            NST TRL+Y  FL++G  ++C+ML PG +  L  I   C   + G+  +   I    +C ++ GY AVYRVCF MA FF LF +LMIKV SSQDPRA + NGFWFFK    +G+ VG F+IP    F T W  +GM G F +ILIQL+LL+DFAHSWNESW++  EE +++ +Y  L+  T   Y  SL  IVL Y+YY     CA NK FIS NM+LCI  S++S+LPKI E  PRSGLLQSS++T+YT+YLTWSAMTN  ++ CNP+L  II   +TS P  +           Q W    IVGLV+FLL V+YSSIR+S ++ V KLT+   E+ ++ D        +  +      DNE +GV Y YSFFHFM FL SLY+MMTLTNWY P+S+   + S   SVWVKI SSW+CI +Y+WTL+AP +  +R+F+
Sbjct:   32 NSTVTRLIYAFFLLIGVTVACVMLIPGMEEQLKKIPGFC---DGGMGSSIPGISGHVNCDVLVGYKAVYRVCFGMAMFFLLFSLLMIKVKSSQDPRASVHNGFWFFKFAAAVGITVGAFFIPEGP-FTTVWFYVGMGGAFCFILIQLVLLIDFAHSWNESWVEKMEEGNSRCWYAALLSATGMNYVLSLVAIVLFYVYYTHPEGCAENKAFISVNMLLCIGASLMSVLPKIQESQPRSGLLQSSVITVYTMYLTWSAMTNEPDRKCNPSLLSIIGYNSTSTPGQVKVV--------QWWDAQGIVGLVLFLLCVLYSSIRTSNNSQVNKLTLTSDESTLIEDGGRSDGSMEDSDNAHRAVDNERDGVTYSYSFFHFMLFLASLYIMMTLTNWYSPDSSYEMMTSKWPSVWVKISSSWVCIVLYVWTLVAPLVLTNRDFD 458          
BLAST of Serine incorporator 3 vs. Ensembl Xenopus
Match: serinc1 (serine incorporator 1, gene 1 [Source:NCBI gene;Acc:496872])

HSP 1 Score: 401.749 bits (1031), Expect = 3.108e-135
Identity = 219/439 (49.89%), Postives = 286/439 (65.15%), Query Frame = 3
Query:  177 NSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTL--IINTYNTSRPNGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 1487
            NST TRL+Y  FL++G  ++C+ML PG +  L  I   C   + G+  +   I    +C ++ GY AVYRVCF MA FF LF +LMIKV SSQDPRA + NGFWFFK    +G+ VG F+IP    F T W  +GM G F +ILIQL+LL+DFAHSWNESW++  EE +++ +Y  L+  T   Y  SL  IVL Y+YY     CA NK FIS NM+LCI  S++S+LPKI E  PRSGLLQSS++T+YT+YLTWSAMTN  ++ CNP+L  II   +TS P  +           Q W    IVGLV+FLL V+YSSIR+S ++ V KLT+   E+ ++ D        +  +      DNE +GV Y YSFFHFM FL SLY+MMTLTNWY P+S+   + S   SVWVKI SSW+CI +Y+WTL+AP +  +R+F+
Sbjct:   32 NSTVTRLIYAFFLLIGVTVACVMLIPGMEEQLKKIPGFC---DGGMGSSIPGISGHVNCDVLVGYKAVYRVCFGMAMFFLLFSLLMIKVKSSQDPRASVHNGFWFFKFAAAVGITVGAFFIPEGP-FTTVWFYVGMGGAFCFILIQLVLLIDFAHSWNESWVEKMEEGNSRCWYAALLSATGMNYVLSLVAIVLFYVYYTHPEGCAENKAFISVNMLLCIGASLMSVLPKIQESQPRSGLLQSSVITVYTMYLTWSAMTNEPDRKCNPSLLSIIGYNSTSTPGQVKVV--------QWWDAQGIVGLVLFLLCVLYSSIRTSNNSQVNKLTLTSDESTLIEDGGRSDGSMEDSDNAHRAVDNERDGVTYSYSFFHFMLFLASLYIMMTLTNWYSPDSSYEMMTSKWPSVWVKISSSWVCIVLYVWTLVAPLVLTNRDFD 458          
BLAST of Serine incorporator 3 vs. Ensembl Xenopus
Match: serinc1 (serine incorporator 1, gene 1 [Source:NCBI gene;Acc:496872])

HSP 1 Score: 401.749 bits (1031), Expect = 3.109e-135
Identity = 219/439 (49.89%), Postives = 286/439 (65.15%), Query Frame = 3
Query:  177 NSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTL--IINTYNTSRPNGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 1487
            NST TRL+Y  FL++G  ++C+ML PG +  L  I   C   + G+  +   I    +C ++ GY AVYRVCF MA FF LF +LMIKV SSQDPRA + NGFWFFK    +G+ VG F+IP    F T W  +GM G F +ILIQL+LL+DFAHSWNESW++  EE +++ +Y  L+  T   Y  SL  IVL Y+YY     CA NK FIS NM+LCI  S++S+LPKI E  PRSGLLQSS++T+YT+YLTWSAMTN  ++ CNP+L  II   +TS P  +           Q W    IVGLV+FLL V+YSSIR+S ++ V KLT+   E+ ++ D        +  +      DNE +GV Y YSFFHFM FL SLY+MMTLTNWY P+S+   + S   SVWVKI SSW+CI +Y+WTL+AP +  +R+F+
Sbjct:   34 NSTVTRLIYAFFLLIGVTVACVMLIPGMEEQLKKIPGFC---DGGMGSSIPGISGHVNCDVLVGYKAVYRVCFGMAMFFLLFSLLMIKVKSSQDPRASVHNGFWFFKFAAAVGITVGAFFIPEGP-FTTVWFYVGMGGAFCFILIQLVLLIDFAHSWNESWVEKMEEGNSRCWYAALLSATGMNYVLSLVAIVLFYVYYTHPEGCAENKAFISVNMLLCIGASLMSVLPKIQESQPRSGLLQSSVITVYTMYLTWSAMTNEPDRKCNPSLLSIIGYNSTSTPGQVKVV--------QWWDAQGIVGLVLFLLCVLYSSIRTSNNSQVNKLTLTSDESTLIEDGGRSDGSMEDSDNAHRAVDNERDGVTYSYSFFHFMLFLASLYIMMTLTNWYSPDSSYEMMTSKWPSVWVKISSSWVCIVLYVWTLVAPLVLTNRDFD 460          
BLAST of Serine incorporator 3 vs. Ensembl Mouse
Match: Serinc1 (serine incorporator 1 [Source:MGI Symbol;Acc:MGI:1926228])

HSP 1 Score: 384.415 bits (986), Expect = 1.286e-128
Identity = 210/439 (47.84%), Postives = 286/439 (65.15%), Query Frame = 3
Query:  177 NSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLI-INTYNTSRPNGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVS-KPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 1487
            NST TRL+Y LFL++G  ++C+ML PG +  L+ I   C   E G+ P          C+++ GY AVYR+CF +A F+ L  +LMIKV SS DPRA + NGFWFFK    + +++G F+IP  + F T W  +GM G F +ILIQL+LL+DFAHSWNESW++  EE +++ +Y  L+  T   Y  SL  +VL ++YY     CA NK FIS NM+LCI  S++SILPKI E  PRSGLLQSS++T+YT+YLTWSAMTN    NCNP+L+ I  +NT+RP      +     + Q W    I+GLV+FLL V YSSIR+S ++ V KLT+   E+ ++ D    +  S    +G     DNE +GV Y YSFFHFM FL SLY+MMTLTNWY+   +   + S   +VWVKI SSW+ + +Y+WTL+AP +  +R+F+
Sbjct:   34 NSTVTRLIYALFLLVGVCVACVMLIPGMEEQLNKIPGFCE-NEKGVVP----------CNILVGYKAVYRLCFGLAMFYLLLSLLMIKVKSSSDPRAAVHNGFWFFKFATAVAIIIGAFFIPEGT-FTTVWFYVGMAGAFCFILIQLVLLIDFAHSWNESWVEKMEEGNSRCWYAALLSATALNYLLSLVAVVLFFVYYTHPASCAENKAFISVNMLLCIGASVMSILPKIQESQPRSGLLQSSVITVYTMYLTWSAMTNEPETNCNPSLLSIIGFNTTRP------IPKDGQSVQWWHPQGIIGLVLFLLCVFYSSIRTSNNSQVNKLTLTSDESTLIEDGNGRSDGSLDDGDGIHRAVDNERDGVTYSYSFFHFMLFLASLYIMMTLTNWYRYEPS-REMKSQWTAVWVKISSSWIGLVLYVWTLVAPLVLTNRDFD 453          
BLAST of Serine incorporator 3 vs. Ensembl Mouse
Match: Serinc3 (serine incorporator 3 [Source:MGI Symbol;Acc:MGI:1349457])

HSP 1 Score: 355.525 bits (911), Expect = 3.707e-117
Identity = 215/447 (48.10%), Postives = 289/447 (64.65%), Query Frame = 3
Query:  174 KNSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLI-INTYNTS---RPNGIGTTVTSVTNNEQNWSW---TVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVSKPQEGGQ--SVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 1487
            KNST TRL+Y   L LGTI+SCIM+  G +  L  I   C   E G         +  DC ++ G+ AVYR+ FA+A FFF F +LM+KV +S+DPRA + NGFWFFKI   IG+M+G FYIP  S F   W + GM+G   +I+IQL+LLVD AHSWNE W++  EE + + +Y  L+ FT  FY  S+ F  LLY++Y    DC  NK FIS N+I C+ +SIVSILPK+ E+ PRSGLLQSSI+TLYT+YLTWSAMTN   ++CNP+L+ I T+ TS    P    T   +     Q+  +     I GL++F+  +IYSS R+S ++ V KLT+ GS++ IL D  +GA     +E GQ     DNE+EGV Y YSFFH M    SLY+MMT+T+WY P++    ++S   +VW K+ SSWLC+ +YLWTL+AP +   R+F+
Sbjct:   33 KNSTVTRLIYAFILFLGTIVSCIMMTEGIQTQLKKIPGFC---EGGFQIKMVDTKAEKDCDVLVGFKAVYRINFAVAIFFFAFFLLMLKVKTSKDPRAAVHNGFWFFKIAAIIGIMIGSFYIPGGS-FTEVWFVAGMLGASFFIIIQLVLLVDMAHSWNELWVNRMEEGNPRLWYAALLSFTSLFYILSIVFAALLYVFYTKPDDCTENKVFISLNLIFCVAVSIVSILPKVQEHQPRSGLLQSSIITLYTLYLTWSAMTNEPERSCNPSLMSIITHLTSPTVSPANSTTLAPAYAPPSQSGHFMNLDDIWGLIIFVFCLIYSSFRTSSNSQVNKLTLSGSDSVILGDTTNGA---NDEEDGQPRRAVDNEKEGVQYSYSFFHLMLCCASLYIMMTITSWYSPDAKFQKVSSKWLAVWFKMGSSWLCLLLYLWTLVAPLVLTGRDFS 472          
BLAST of Serine incorporator 3 vs. Ensembl Mouse
Match: Serinc2 (serine incorporator 2 [Source:MGI Symbol;Acc:MGI:1919132])

HSP 1 Score: 335.495 bits (859), Expect = 1.865e-109
Identity = 199/440 (45.23%), Postives = 269/440 (61.14%), Query Frame = 3
Query:  174 KNSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLIINTYNTSRPNGIGTTVTSVTNNEQNWSWTV--IVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 1487
            +NST +RL++  FL LG ++S IML+PG ++ L  +  +C             +    DC  + G+ AVYR+CFA A FFF F +LMI V SS+DPRA IQNGFWFFK LI +G+ VG FYIP  S F   W   G++G FL+ILIQLIL VDFAHSWN+ W+   EE D+ A+Y GL FFT  FY  S+  + L+++YY     C   K FIS N+  C+ +SI+++LPK+ +  P SGLLQ+S++TLYT+++TWSA++N  ++ CNP L         P   GT    + +    W W    IVGLV+F+L   + S+RSS H  V  L M   E      Q+    VS  +      +DNE++GV Y YSFFHF   L SL+VMMTLTNWY P      + S   SVWVKI +SW  + +YLWTL+AP + P+R+F+
Sbjct:   42 RNSTVSRLLFTSFLFLGVLVSIIMLSPGVESQLYKLPWVCEDRT----QQPLVLQGPLDCGSLLGFRAVYRMCFATAAFFFFFMLLMICVRSSRDPRAAIQNGFWFFKFLILVGITVGAFYIPDGS-FPKIWFYFGVVGSFLFILIQLILFVDFAHSWNQRWLCKAEECDSPAWYAGLFFFTFLFYLLSIAAVALMFVYYTESGACHEGKVFISLNLTFCVCVSIIAVLPKVQDAQPNSGLLQASVITLYTMFVTWSALSNVPDQKCNPHL---------PTKNGTGQVDLEDYSTVW-WDAPSIVGLVIFILCTFFISLRSSDHRQVNSL-MQTEECPAEMVQQQQVAVSDGR-----AYDNEQDGVTYSYSFFHFCLVLASLHVMMTLTNWYSPGET-RKMISTWTSVWVKICASWAGLFLYLWTLVAPLLLPNRDFS 459          
BLAST of Serine incorporator 3 vs. Ensembl Mouse
Match: Serinc2 (serine incorporator 2 [Source:MGI Symbol;Acc:MGI:1919132])

HSP 1 Score: 334.724 bits (857), Expect = 2.081e-109
Identity = 199/440 (45.23%), Postives = 269/440 (61.14%), Query Frame = 3
Query:  174 KNSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLIINTYNTSRPNGIGTTVTSVTNNEQNWSWTV--IVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 1487
            +NST +RL++  FL LG ++S IML+PG ++ L  +  +C             +    DC  + G+ AVYR+CFA A FFF F +LMI V SS+DPRA IQNGFWFFK LI +G+ VG FYIP  S F   W   G++G FL+ILIQLIL VDFAHSWN+ W+   EE D+ A+Y GL FFT  FY  S+  + L+++YY     C   K FIS N+  C+ +SI+++LPK+ +  P SGLLQ+S++TLYT+++TWSA++N  ++ CNP L         P   GT    + +    W W    IVGLV+F+L   + S+RSS H  V  L M   E      Q+    VS  +      +DNE++GV Y YSFFHF   L SL+VMMTLTNWY P      + S   SVWVKI +SW  + +YLWTL+AP + P+R+F+
Sbjct:   33 RNSTVSRLLFTSFLFLGVLVSIIMLSPGVESQLYKLPWVCEDRT----QQPLVLQGPLDCGSLLGFRAVYRMCFATAAFFFFFMLLMICVRSSRDPRAAIQNGFWFFKFLILVGITVGAFYIPDGS-FPKIWFYFGVVGSFLFILIQLILFVDFAHSWNQRWLCKAEECDSPAWYAGLFFFTFLFYLLSIAAVALMFVYYTESGACHEGKVFISLNLTFCVCVSIIAVLPKVQDAQPNSGLLQASVITLYTMFVTWSALSNVPDQKCNPHL---------PTKNGTGQVDLEDYSTVW-WDAPSIVGLVIFILCTFFISLRSSDHRQVNSL-MQTEECPAEMVQQQQVAVSDGR-----AYDNEQDGVTYSYSFFHFCLVLASLHVMMTLTNWYSPGET-RKMISTWTSVWVKICASWAGLFLYLWTLVAPLLLPNRDFS 450          
BLAST of Serine incorporator 3 vs. Ensembl Mouse
Match: Serinc2 (serine incorporator 2 [Source:MGI Symbol;Acc:MGI:1919132])

HSP 1 Score: 313.923 bits (803), Expect = 5.336e-102
Identity = 188/417 (45.08%), Postives = 252/417 (60.43%), Query Frame = 3
Query:  243 MLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLIINTYNTSRPNGIGTTVTSVTNNEQNWSWTV--IVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 1487
            ML+PG ++ L  +  +C             +    DC  + G+ AVYR+CFA A FFF F +LMI V SS+DPRA IQNGFWFFK LI +G+ VG FYIP  S F   W   G++G FL+ILIQLIL VDFAHSWN+ W+   EE D+ A+Y GL FFT  FY  S+  + L+++YY     C   K FIS N+  C+ +SI+++LPK+ +  P SGLLQ+S++TLYT+++TWSA++N  ++ CNP L         P   GT    + +    W W    IVGLV+F+L   + S+RSS H  V  L M   E      Q+    VS  +      +DNE++GV Y YSFFHF   L SL+VMMTLTNWY P      + S   SVWVKI +SW  + +YLWTL+AP + P+R+F+
Sbjct:    1 MLSPGVESQLYKLPWVCEDRT----QQPLVLQGPLDCGSLLGFRAVYRMCFATAAFFFFFMLLMICVRSSRDPRAAIQNGFWFFKFLILVGITVGAFYIPDGS-FPKIWFYFGVVGSFLFILIQLILFVDFAHSWNQRWLCKAEECDSPAWYAGLFFFTFLFYLLSIAAVALMFVYYTESGACHEGKVFISLNLTFCVCVSIIAVLPKVQDAQPNSGLLQASVITLYTMFVTWSALSNVPDQKCNPHL---------PTKNGTGQVDLEDYSTVW-WDAPSIVGLVIFILCTFFISLRSSDHRQVNSL-MQTEECPAEMVQQQQVAVSDGR-----AYDNEQDGVTYSYSFFHFCLVLASLHVMMTLTNWYSPGET-RKMISTWTSVWVKICASWAGLFLYLWTLVAPLLLPNRDFS 395          
BLAST of Serine incorporator 3 vs. UniProt/SwissProt
Match: sp|A4FUZ5|SERC3_BOVIN (Serine incorporator 3 OS=Bos taurus OX=9913 GN=SERINC3 PE=2 SV=1)

HSP 1 Score: 393.275 bits (1009), Expect = 5.567e-131
Identity = 217/450 (48.22%), Postives = 291/450 (64.67%), Query Frame = 3
Query:  174 KNSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTL--IINTYNTSRPNGIGTTVTSVTN----------NEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 1487
            KNST TRL+Y   L LGTI+ CIM   G +  L  I   C   + GL      I    +C ++  Y AVYR+ FA+A FFF F +LM+ V +S+DPRA I NGFWFFKI   +G+MVG FYIP    F T+W +IGM+G   +ILIQL+LLVDFAHSWNESW++  EE + K +Y  L+  T  FY  S+ F  LLY YY     C  NKFFISFN+ILC++IS++SI PKI E+ PRSGLLQSS++TLYT+YLTWSAM+N  +++CNP L  II    +S      TT  + T           N++N+     +GL+VF+L++ YSSIR+S ++ V KLT+ GS++ IL D  +     +     +   DNE EGV Y+YS FH M    SLY+MMTLTNWY P++N  ++ S   +VWVKI SSW+C+ +Y+WTL+AP +  +R+F+
Sbjct:   33 KNSTLTRLIYAFILFLGTIVCCIMFHEGMETQLKKIPGFC---DEGLSTRITDIMDK-ECDVLVRYKAVYRISFALAVFFFAFSLLMLNVKTSKDPRAAIHNGFWFFKIAAIVGVMVGSFYIP-GGHFNTAWFVIGMVGAAFFILIQLVLLVDFAHSWNESWVNRMEEGNPKCWYAALLSVTSLFYILSIIFAGLLYTYYTKPDGCTENKFFISFNLILCVVISVLSIHPKIQEHQPRSGLLQSSLITLYTMYLTWSAMSNEPDRSCNPGLLSIITHMTSSTLAPANTTAPAPTPAVPLQSGPSLNKENF-----IGLLVFVLSLSYSSIRNSSNSQVSKLTLSGSDSVILRDTAANGASDEEDGRPRRAVDNEREGVQYNYSMFHLMLCSASLYIMMTLTNWYSPDANFQSMTSKWPAVWVKISSSWVCLLLYVWTLVAPLVLTNRDFS 472          
BLAST of Serine incorporator 3 vs. UniProt/SwissProt
Match: sp|Q7TNK0|SERC1_RAT (Serine incorporator 1 OS=Rattus norvegicus OX=10116 GN=Serinc1 PE=1 SV=1)

HSP 1 Score: 385.956 bits (990), Expect = 1.753e-128
Identity = 212/439 (48.29%), Postives = 286/439 (65.15%), Query Frame = 3
Query:  177 NSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLI-INTYNTSRPNGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVS-KPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 1487
            NST TRL+Y LFL++G  ++C+ML PG +  L+ I   C   E G+ P          C+++ GY AVYR+CF +A F+ L  +LMIKV SS DPRA + NGFWFFK    + +++G F+IP  + F T W  +GM G F +ILIQL+LL+DFAHSWNESW++  EE +++ +Y  L+  T   Y  SL  I+L ++YY     C+ NK FIS NM+LCI  S++SILPKI E  PRSGLLQSS++T+YT+YLTWSAMTN    NCNP+L+ I  +NT+RP      V     + Q W    I+GLV+FLL V YSSIR+S ++ V KLT+   E+ ++ D    +  S    EG     DNE +GV Y YSFFHFM FL SLY+MMTLTNWY+   +   + S   +VWVKI SSW+ I +Y+WTL+AP +  +R+F+
Sbjct:   34 NSTVTRLIYALFLLVGVCVACVMLIPGMEEQLNKIPGFCE-NEKGVVP----------CNILVGYKAVYRLCFGLAMFYLLLSLLMIKVKSSSDPRAAVHNGFWFFKFATAVAIIIGAFFIPEGT-FTTVWFYVGMAGAFCFILIQLVLLIDFAHSWNESWVEKMEEGNSRCWYAALLSATALNYLLSLVAIILFFVYYTHPASCSENKAFISVNMLLCIGASVMSILPKIQESQPRSGLLQSSVITIYTMYLTWSAMTNEPETNCNPSLLSIIGFNTTRP------VPKDGQSVQWWHPQGIIGLVLFLLCVFYSSIRTSNNSQVNKLTLTSDESTLIEDGNGRSDGSLDDGEGVHRAVDNERDGVTYSYSFFHFMLFLASLYIMMTLTNWYRYEPS-REMKSQWTAVWVKISSSWIGIVLYVWTLVAPLVLTNRDFD 453          
BLAST of Serine incorporator 3 vs. UniProt/SwissProt
Match: sp|Q9QZI8|SERC1_MOUSE (Serine incorporator 1 OS=Mus musculus OX=10090 GN=Serinc1 PE=1 SV=1)

HSP 1 Score: 384.415 bits (986), Expect = 8.994e-128
Identity = 210/439 (47.84%), Postives = 286/439 (65.15%), Query Frame = 3
Query:  177 NSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLI-INTYNTSRPNGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVS-KPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 1487
            NST TRL+Y LFL++G  ++C+ML PG +  L+ I   C   E G+ P          C+++ GY AVYR+CF +A F+ L  +LMIKV SS DPRA + NGFWFFK    + +++G F+IP  + F T W  +GM G F +ILIQL+LL+DFAHSWNESW++  EE +++ +Y  L+  T   Y  SL  +VL ++YY     CA NK FIS NM+LCI  S++SILPKI E  PRSGLLQSS++T+YT+YLTWSAMTN    NCNP+L+ I  +NT+RP      +     + Q W    I+GLV+FLL V YSSIR+S ++ V KLT+   E+ ++ D    +  S    +G     DNE +GV Y YSFFHFM FL SLY+MMTLTNWY+   +   + S   +VWVKI SSW+ + +Y+WTL+AP +  +R+F+
Sbjct:   34 NSTVTRLIYALFLLVGVCVACVMLIPGMEEQLNKIPGFCE-NEKGVVP----------CNILVGYKAVYRLCFGLAMFYLLLSLLMIKVKSSSDPRAAVHNGFWFFKFATAVAIIIGAFFIPEGT-FTTVWFYVGMAGAFCFILIQLVLLIDFAHSWNESWVEKMEEGNSRCWYAALLSATALNYLLSLVAVVLFFVYYTHPASCAENKAFISVNMLLCIGASVMSILPKIQESQPRSGLLQSSVITVYTMYLTWSAMTNEPETNCNPSLLSIIGFNTTRP------IPKDGQSVQWWHPQGIIGLVLFLLCVFYSSIRTSNNSQVNKLTLTSDESTLIEDGNGRSDGSLDDGDGIHRAVDNERDGVTYSYSFFHFMLFLASLYIMMTLTNWYRYEPS-REMKSQWTAVWVKISSSWIGLVLYVWTLVAPLVLTNRDFD 453          
BLAST of Serine incorporator 3 vs. UniProt/SwissProt
Match: sp|Q5R533|SERC3_PONAB (Serine incorporator 3 OS=Pongo abelii OX=9601 GN=SERINC3 PE=2 SV=1)

HSP 1 Score: 384.8 bits (987), Expect = 1.019e-127
Identity = 212/445 (47.64%), Postives = 288/445 (64.72%), Query Frame = 3
Query:  174 KNSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLIINTYNTSRPNGIGTTVTSV--TNNEQNWSWTVI-----VGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 1487
            KNST TRL+Y   L+L T++S IM     +  L  I   C   E G       I +  DC ++ GY AVYR+ FAMA FFF+F +LM KV +S+DPRA + NGFWFFKI   IG+MVG FYIP    F + W ++GMIG  L+ILIQL+LLVDFAHSWNESW++  EE + + +Y  L+ FT  FY  S+  + LLY YY     C  NKFFIS N+ILC++ SI+SI PKI E+ PRSGLLQSS++TLYT+YLTWSAM+N  +++CNP L+      + P       T+V  T    + S +++     +GL VF+L ++YSSIR+S ++ V KLT+ GS++ IL D  +     +     +   DNE+EGV Y YS FH M  L SLY+MMTLT+WY P++   ++ S   +VWVKI SSW+C+ +Y+WTL+AP +   R+F+
Sbjct:   33 KNSTVTRLIYAFILLLSTVVSYIMQRKEMETYLKKIPGFC---EGGFKIHEADINADKDCDVLVGYKAVYRISFAMAIFFFVFSLLMFKVKTSKDPRAAVHNGFWFFKIAALIGIMVGSFYIP-GGYFSSVWFVVGMIGAALFILIQLVLLVDFAHSWNESWVNRMEEGNPRLWYAALLSFTSAFYILSIICVGLLYTYYTKPDGCTENKFFISINLILCVVASIISIHPKIQEHQPRSGLLQSSVITLYTMYLTWSAMSNEPDRSCNPNLMSFITRITAPTLAPGNSTAVVPTPTPPSKSGSLLDSDNFIGLFVFVLCLLYSSIRTSTNSQVDKLTLSGSDSVILGDTTTSGASDEEDGQPRRAVDNEKEGVQYSYSLFHLMLCLASLYIMMTLTSWYSPDAKFQSMTSKWPAVWVKISSSWVCLLLYVWTLVAPLVLTSRDFS 473          
BLAST of Serine incorporator 3 vs. UniProt/SwissProt
Match: sp|Q13530|SERC3_HUMAN (Serine incorporator 3 OS=Homo sapiens OX=9606 GN=SERINC3 PE=2 SV=2)

HSP 1 Score: 380.563 bits (976), Expect = 5.462e-126
Identity = 211/445 (47.42%), Postives = 287/445 (64.49%), Query Frame = 3
Query:  174 KNSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLIINTYNTSRPNGIGTTVTSV--TNNEQNWSWTVI-----VGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 1487
            KNST TRL+Y   L+L T++S IM     +  L  I   C   E G       I +  DC ++ GY AVYR+ FAMA FFF+F +LM KV +S+D RA + NGFWFFKI   IG+MVG FYIP    F + W ++GMIG  L+ILIQL+LLVDFAHSWNESW++  EE + + +Y  L+ FT  FY  S+  + LLY YY     C  NKFFIS N+ILC++ SI+SI PKI E+ PRSGLLQSS++TLYT+YLTWSAM+N  +++CNP L+      + P       T+V  T    + S +++     +GL VF+L ++YSSIR+S ++ V KLT+ GS++ IL D  +     +     +   DNE+EGV Y YS FH M  L SLY+MMTLT+WY P++   ++ S   +VWVKI SSW+C+ +Y+WTL+AP +   R+F+
Sbjct:   33 KNSTVTRLIYAFILLLSTVVSYIMQRKEMETYLKKIPGFC---EGGFKIHEADINADKDCDVLVGYKAVYRISFAMAIFFFVFSLLMFKVKTSKDLRAAVHNGFWFFKIAALIGIMVGSFYIP-GGYFSSVWFVVGMIGAALFILIQLVLLVDFAHSWNESWVNRMEEGNPRLWYAALLSFTSAFYILSIICVGLLYTYYTKPDGCTENKFFISINLILCVVASIISIHPKIQEHQPRSGLLQSSLITLYTMYLTWSAMSNEPDRSCNPNLMSFITRITAPTLAPGNSTAVVPTPTPPSKSGSLLDSDNFIGLFVFVLCLLYSSIRTSTNSQVDKLTLSGSDSVILGDTTTSGASDEEDGQPRRAVDNEKEGVQYSYSLFHLMLCLASLYIMMTLTSWYSPDAKFQSMTSKWPAVWVKISSSWVCLLLYVWTLVAPLVLTSRDFS 473          
BLAST of Serine incorporator 3 vs. TrEMBL
Match: A0A1I8H719 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017964g1 PE=4 SV=1)

HSP 1 Score: 447.588 bits (1150), Expect = 7.726e-150
Identity = 257/473 (54.33%), Postives = 329/473 (69.56%), Query Frame = 3
Query:   93 MGCIIGXXXXXXXXXXXXXXXXXXXXXKNSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIG--LYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLIINTYNTSRP----NGIGTTVTSVTNNE--QNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 1487
            MGC I ++ACCFCSSAASLCC CLPSCK+STS+R++Y L  +LG  L CIML P    TL  I ALC  Y+I   +      IYSGF C L+ GYGAVYRV F M CFF LF +LMIKV SS+DPR+KIQNGFWFFK+LI IGL VG F+IP  S F+  W++IGMIGGFL+ILIQL+LL+DFAH WNE+W   YEE++N+ YY GL+ F+I F+  +L   +LLY++Y     C ++K F+S N+ILCI+++ +S+LPK+ ++  RSG+LQS +++LY +YLTWSA+T+   K CNPTL +  Y    P        T    VT +     ++W   V L +FL+ VIYSSIR++ H++VGKL +    T I      G      + GGQ+V D+EE+G  Y Y+ FH MF + SLYVMMTLTNW+ P+SNL TL SN ASVW+KI SSWLCI IY WTLLAP MFPDR+F 
Sbjct:    1 MGCCISAIACCFCSSAASLCCTCLPSCKSSTSSRIMYSLIFLLGAALCCIMLIPDLDKTLQKIPALCDNYKIDTQIGQIDTKIYSGFKCYLVIGYGAVYRVAFGMTCFFVLFALLMIKVESSKDPRSKIQNGFWFFKLLILIGLWVGAFFIPAESAFINVWMVIGMIGGFLFILIQLVLLIDFAHCWNEAWTKSYEESENRCYYIGLLIFSILFFVLALALTILLYVFYASDASCHMSKAFVSVNLILCILVTGLSVLPKVQDHQ-RSGILQSGLISLYVMYLTWSAVTSVPEKACNPTLEMVNYTMVPPTSSSGSTTTAAPPVTGDSVVAQFNWETGVSLAIFLILVIYSSIRTAAHSNVGKLGLQSESTTIADTDLGGGTGGGAESGGQAVVDDEEDGTTYSYTAFHVMFAMASLYVMMTLTNWFMPSSNLQTLQSNYASVWIKIASSWLCIFIYAWTLLAPVMFPDRDFT 472          
BLAST of Serine incorporator 3 vs. TrEMBL
Match: A0A433TPH2 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_008774 PE=4 SV=1)

HSP 1 Score: 438.343 bits (1126), Expect = 4.459e-146
Identity = 256/482 (53.11%), Postives = 344/482 (71.37%), Query Frame = 3
Query:   93 MGCIIGXXXXXXXXXXXXXXXXXXXXXKNSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYT-IYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTL--II---NTYNTSRPNGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTD--QESGAPV-----SKPQEG----GQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 1487
            MGCIIG+ ACCF S+A SLCC   PSCKNST++R+ Y L L++G+I++  ML PG ++ L  I  LC       Y  + T  +S   C  + G+ AVYRVCFAMA FF LF V+MIKV SS+DPR+KIQNGFWFFK++I +G+ VG F+IP  S F   W++IGM+G FL+ILIQL+L+VDFAH W E+W+D YEE ++KAYY GL FFTI FY  S+  +VL YIYY    DC+L+KFF+SFN+ILC+ +S+V+ILP++ E+ PRSGLLQSSI++ Y +YLTWSAM+N  +K+CNP L  II   + +N +  +G+ +T TS    +  + W  I+ L ++L  V+YSSIR+S ++ VGKLTM   +T + TD  + +G+       S   EG    GQ VWDNEE+ VAY YSF+HFM FL SLYVMMTLTNW+ P+S++  LN+N ASVWVK+ SSW+ I +Y+WTL+AP +  DR+F+
Sbjct:    1 MGCIIGTAACCFGSAACSLCCAACPSCKNSTASRIGYALMLLVGSIVAVFMLIPGIRHKLDEIPGLCRDIIKNDYVDTKTQAFSKEQCDSVVGFLAVYRVCFAMAMFFILFAVIMIKVDSSKDPRSKIQNGFWFFKVIIMVGIAVGAFFIPGGS-FGEVWMVIGMMGAFLFILIQLVLIVDFAHGWAENWVDKYEETESKAYYVGLFFFTILFYLISIVAVVLFYIYYA-TGDCSLHKFFVSFNLILCVGMSVVAILPRVQEHQPRSGLLQSSIISCYVMYLTWSAMSNNPDKSCNPGLKEIIAPSDIHNNTGVSGVDSTGTS----DGTFDWQSILALGIWLFAVLYSSIRTSTNSQVGKLTMT-EKTLLQTDTGRRAGSDENLMGGSSDSEGDAETGQKVWDNEEDAVAYSYSFYHFMLFLASLYVMMTLTNWFSPSSDVKKLNANMASVWVKMASSWVSIVLYVWTLVAPVILQDRDFS 475          
BLAST of Serine incorporator 3 vs. TrEMBL
Match: A0A0N7ZRP4 (Serine incorporator OS=Daphnia magna OX=35525 PE=4 SV=1)

HSP 1 Score: 436.032 bits (1120), Expect = 2.290e-145
Identity = 228/446 (51.12%), Postives = 305/446 (68.39%), Query Frame = 3
Query:  174 KNSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSG--FVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTL--IINTYNTSRPNGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQE----SGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 1487
            KNS+STR++Y + L+LGTI++CIML+PG  + +  +   C   E G+           DC + AGY AVYR+CF M  FF    ++MI V SS+DPRA IQNGFW  K L+ IG +VG F+IP +    F T+W+  G+IGGF +ILIQL+L+VDFAH W ESW+D YEE  +KA+Y  L+FFT F YA  +T + L ++YY    DCALNKFFIS N+ILCI++S+V++LPK+ EY PRSGLLQSSI++LYT+YLTWSAM+N  + NC P    IIN          G T  S    +  +    IVGLV++   V+YSSIR++ +    +L   GS+  +    +    SGA V + + GG+ VWDNE +GVAY +SFFH MF L +LYVMMT+TNWY+P S+L TL+SN+ASVWVKIISSWLC+ +YLW+L+AP + PDR+F+
Sbjct:   39 KNSSSTRIMYAIMLLLGTIVACIMLSPGLASAMQKVP-FCDGSESGVPDLIVPNAIKIDCGIAAGYLAVYRLCFGMTLFFLFMALIMIGVRSSKDPRAGIQNGFWAIKYLVLIGAIVGAFFIPEDEAGTFGTTWMYFGLIGGFCFILIQLVLVVDFAHRWAESWVDKYEETSSKAWYCALVFFTFFQYALCITAVSLFFVYYTTSDDCALNKFFISINLILCILVSVVAVLPKVQEYQPRSGLLQSSIVSLYTLYLTWSAMSNNPDANCKPNFSDIIN----------GQTGPSTQEQKTTFDAESIVGLVIWFCCVLYSSIRTASNKQTERLI--GSDKVLAKTDDGSTGSGADVHEVESGGK-VWDNEADGVAYSWSFFHLMFALATLYVMMTITNWYKPTSDLSTLSSNEASVWVKIISSWLCLGLYLWSLIAPAVLPDRDFS 470          
BLAST of Serine incorporator 3 vs. TrEMBL
Match: A0A0P6E686 (EOG090X07ET OS=Daphnia magna OX=35525 GN=EOG090X07ET PE=2 SV=1)

HSP 1 Score: 435.647 bits (1119), Expect = 3.519e-145
Identity = 228/446 (51.12%), Postives = 305/446 (68.39%), Query Frame = 3
Query:  174 KNSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSG--FVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTL--IINTYNTSRPNGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQE----SGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 1487
            KNS+STR++Y + L+LGTI++CIML+PG  + +  +   C   E G+           DC + AGY AVYR+CF M  FF    ++MI V SS+DPRA IQNGFW  K L+ IG +VG F+IP +    F T+W+  G+IGGF +ILIQL+L+VDFAH W ESW+D YEE  +KA+Y  L+FFT F YA  +T + L ++YY    DCALNKFFIS N+ILCI++S+V++LPK+ EY PRSGLLQSSI++LYT+YLTWSAM+N  + NC P    IIN          G T  S    +  +    IVGLV++   V+YSSIR++ +    +L   GS+  +    +    SGA V + + GG+ VWDNE +GVAY +SFFH MF L +LYVMMT+TNWY+P S+L TL+SN+ASVWVKIISSWLC+ +YLW+L+AP + PDR+F+
Sbjct:   33 KNSSSTRIMYAIMLLLGTIVACIMLSPGLASAMQKVP-FCDGSESGVPDLIVPNAIKIDCGIAAGYLAVYRLCFGMTLFFLFMALIMIGVRSSKDPRAGIQNGFWAIKYLVLIGAIVGAFFIPEDEAGTFGTTWMYFGLIGGFCFILIQLVLVVDFAHRWAESWVDKYEETSSKAWYCALVFFTFFQYALCITAVSLFFVYYTTSDDCALNKFFISINLILCILVSVVAVLPKVQEYQPRSGLLQSSIVSLYTLYLTWSAMSNNPDANCKPNFSDIIN----------GQTGPSTQEQKTTFDAESIVGLVIWFCCVLYSSIRTASNKQTERLI--GSDKVLAKTDDGSTGSGADVHEVESGGK-VWDNEADGVAYSWSFFHLMFALATLYVMMTITNWYKPTSDLSTLSSNEASVWVKIISSWLCLGLYLWSLIAPAVLPDRDFS 464          
BLAST of Serine incorporator 3 vs. TrEMBL
Match: A0A2T7PEM8 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_07301 PE=4 SV=1)

HSP 1 Score: 435.261 bits (1118), Expect = 3.693e-145
Identity = 226/439 (51.48%), Postives = 299/439 (68.11%), Query Frame = 3
Query:  174 KNSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPY-EIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLIINTYNTSRPNGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 1487
            KNST+ R+ Y L L++GTI++ IML P  +  L  I  LC  +  + +     ++     C  + G+ AVYRVCFAMA FF LF ++MIKV+SS+DPR+KIQNGFW  K LI I L VG F+IP  S F  +W++IG+IG F++I IQLILL+DFAH W E+W+  YEE  +K YY GL+FFTI FY  S+T +VL Y++Y     C L+KFF+SFN+ILC+  S++SILPKI E  PRSGLLQ+S++T Y +YLTWSAMTN  +K CNP+L  N       N   + V +    +  +    I+ L+++L  V+Y+SIR+S ++ VGKLT+  SE  IL            ++G Q VWDNEEEGVAY YSFFHFM  L SLYVMMTLTNW+ P+S+  TLN+N ASVWVK+ SSWLC+ +Y+WTL AP + P R+FN
Sbjct:   24 KNSTAARIGYSLMLLIGTIVAAIMLVPDIREQLDKIPGLCKNFINVDIDLPQNSLLKAQQCDNVVGFLAVYRVCFAMAAFFVLFALIMIKVNSSKDPRSKIQNGFWAIKALIMIALCVGAFFIPRGS-FGQAWMVIGLIGAFIFIFIQLILLIDFAHGWAENWVGQYEETGSKTYYVGLLFFTIVFYVVSITAVVLFYVFYANGGSCGLHKFFVSFNLILCVGFSLLSILPKIQEAQPRSGLLQASVITAYVMYLTWSAMTNNPDKTCNPSL--NQITNPDYNSTSSRVDTGDFTKTQFDAQSIIALIIWLFAVLYASIRTSSNSQVGKLTL--SEKTILQTDTGSTGSEDEEKGRQKVWDNEEEGVAYSYSFFHFMLCLASLYVMMTLTNWFSPSSDFRTLNANMASVWVKMASSWLCVILYVWTLAAPIILPGRDFN 457          
BLAST of Serine incorporator 3 vs. Ensembl Cavefish
Match: serinc1 (serine incorporator 1 [Source:NCBI gene;Acc:103046087])

HSP 1 Score: 404.06 bits (1037), Expect = 2.069e-136
Identity = 219/439 (49.89%), Postives = 289/439 (65.83%), Query Frame = 3
Query:  174 KNSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLI-INTYNTSRPNGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 1487
             NST TRL+Y  F+++G  ++CIML PG +  L  I   C   E G+  +   +    +C ++ GY AVYRVCF MA FF LF +LMIKV SSQDPRA + NGFWFFK      + VG F+IP    F T W  IGM G F +ILIQL+LL+DFAHSWNESW++  EE +++ +Y  L+  T   YA SL  +V+ Y+YY     C  NK FIS NM+LC+  S++SILPKI E  PRSGLLQSSI+TLYT+YLTWSAMTN  ++ CNP+L+ I   N++   G    V       Q W    IVGL++FL+ V+YSSIR+S +T V KLT+   E+A++ D  +     +     +++ DNE +GV Y YSFFHFM FL SLY+MMTLTNWY P+SN   + S   SVWVK+ SSW+CIC+Y+WTL+AP +  +R+F+
Sbjct:   33 NNSTVTRLIYAFFMLMGVGIACIMLMPGMEGQLKKIPGFC---EGGMGSSIPGVEGHVNCDVLVGYKAVYRVCFGMAMFFLLFSLLMIKVKSSQDPRAAVHNGFWFFKFAAATAITVGAFFIPEGP-FTTVWFYIGMAGAFCFILIQLVLLIDFAHSWNESWVEKMEEGNSRCWYAALLSATTLNYALSLVSLVMFYVYYTHSGGCTENKAFISVNMLLCVGASVMSILPKIQESQPRSGLLQSSIVTLYTMYLTWSAMTNEPDRKCNPSLLGIIGLNSTSSAGKDQVV-------QWWDAQGIVGLILFLMCVLYSSIRNSNNTQVNKLTLTSDESALIEDGPAPENFDEGDNSNRAI-DNERDGVTYSYSFFHFMLFLASLYIMMTLTNWYSPDSNYEMMTSKWPSVWVKMSSSWICICLYVWTLVAPLVLTNRDFD 459          
BLAST of Serine incorporator 3 vs. Ensembl Cavefish
Match: si:ch73-267c23.10 (serine incorporator 1-like [Source:NCBI gene;Acc:103041453])

HSP 1 Score: 396.356 bits (1017), Expect = 5.111e-133
Identity = 217/452 (48.01%), Postives = 293/452 (64.82%), Query Frame = 3
Query:  174 KNSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLIINTYNTSRPN------GIGTTVTSVTNNE--------QNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVS-KPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREF 1484
            KNS  TR++Y   L++GTI++CIML+PG +  L  I   C   E G   +   + +   C +  GY AVYRVCF M+  F  F +LMI V +S+DPRA + NGFWFFKI + IG+ VG FYIP    F  +W ++GM G F++ILIQL+ LVDFAHSWNESW+D  E  +++ +Y  L+      YA S+T IVL+Y++Y    +C LNKFFISFNMILCI  S+VSILPK+ +  PRSGLLQSS++TLYT+YLTWSA+TN  ++ CNP L+      + P          T V  +  +E        Q W    IVGL +F+L ++YSSIRSS  + + KLT+   ET ++ D   G+    +   G + V DNE E V Y YSFFHFM FL SLY+MMTLTNWY P+++  T++S   +VWVKI SSW+C+ +Y+WTL+AP +F +R+F
Sbjct:   33 KNSIVTRVIYAFILLIGTIIACIMLSPGVERQLKRIPGFC---EGGAGSSVPGMEANVQCEIFVGYKAVYRVCFGMSVCFLAFSLLMINVKNSRDPRAAVHNGFWFFKIALIIGVTVGAFYIPEGP-FTRTWFVVGMAGAFVFILIQLVFLVDFAHSWNESWMDRMENGNSRRWYCALLSVMGLNYALSITAIVLMYLFYTQSEECGLNKFFISFNMILCITASVVSILPKVQDSQPRSGLLQSSVITLYTMYLTWSAITNEPDRTCNPRLLTIFQQIAEPTLPPVEMENQTFVIVINEDEPELSSPYLQWWDAQSIVGLGIFILCILYSSIRSSSTSQMNKLTLAAKETIVMEDSSPGSSCEVEDGSGPKRVEDNEREIVQYSYSFFHFMLFLASLYIMMTLTNWYSPDADYSTMSSKWPAVWVKISSSWVCLSMYVWTLIAPMIFTNRDF 480          
BLAST of Serine incorporator 3 vs. Ensembl Cavefish
Match: serinc2l (serine incorporator 2-like [Source:NCBI gene;Acc:103041278])

HSP 1 Score: 394.045 bits (1011), Expect = 1.900e-132
Identity = 224/440 (50.91%), Postives = 301/440 (68.41%), Query Frame = 3
Query:  174 KNSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLIINTYNTSRPNGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPV-SKPQEGG-QSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 1487
             NST TRLV+  FL+LGT++S IM+ PG +  L  I   C        P    + +  +C +I GY +VYR+CFAMACFFFLF  +MI+V +S+DPRA IQNGFWFFK LI +G+ VG F+IP  + F   W   G++G F++ILIQLILL+DFAHSWNE W+   EE ++K ++FGL+FFTI  YA + T +VL Y+YY    DC  +K FIS N+I C++IS+VSILPK+ +  P+SGLLQSS++TLYT+Y+TWSAMTN  N++CNP+L+    N S  +    T T+     Q W    IVGL++FL   +Y+SIRSS +T V +L        + T++  G+ V SK +EGG Q V DNEEEGV Y YSFFHF  FL SLY+MMTLTNWY+P++    + S+  +VWVKI SSWL + +YLWTL+ P + P+R+F+
Sbjct:   33 SNSTVTRLVFSFFLLLGTVVSIIMILPGMETQLRKIPGFCQGGTT--IPG---VENHVNCDVIVGYKSVYRMCFAMACFFFLFAAIMIRVKTSKDPRAPIQNGFWFFKFLILVGITVGAFFIPDGT-FNDVWFYFGIVGSFMFILIQLILLIDFAHSWNEVWVRNAEEGNSKGWFFGLLFFTILHYALAFTAVVLFYLYYTKPDDCTEHKVFISLNLIFCVIISVVSILPKVQDASPQSGLLQSSLITLYTMYVTWSAMTNNPNRDCNPSLLSLVSNVSSTH---PTPTTAPGTVQWWDAQGIVGLIIFLFCTLYASIRSSSNTQVNRL--------MQTEEGKGSEVESKVEEGGMQRVVDNEEEGVTYSYSFFHFHLFLASLYIMMTLTNWYKPDTTTQAMASSMPAVWVKICSSWLSLALYLWTLIGPVILPNRDFS 455          
BLAST of Serine incorporator 3 vs. Ensembl Cavefish
Match: serinc2 (serine incorporator 2 [Source:NCBI gene;Acc:103046493])

HSP 1 Score: 368.237 bits (944), Expect = 2.347e-122
Identity = 213/437 (48.74%), Postives = 285/437 (65.22%), Query Frame = 3
Query:  177 NSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLIINTYNTSRPNGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 1487
            NST TRL +   ++LGT++S IM+ PG +  L  I   C   E G+    +      +C +I GY +VYR+CFAM CFFFLF  +MI+V SS+DPR  IQNGFWFFK LI +G+ VG F+IP  + F T W   G++G F++ILIQLILLVDFAH+WN+ W++   EN ++ +Y  L+ FTI  YA + T +VL Y+YY     C  +K FIS N+I CI++SIVSILPK+ E  P SGLLQSS+++LYT+YLTWSAM+N  N+ CNP+L+    NT  P+    + T      Q W    IVGLV+FL   +Y+SIRSS ++ V KL        +  D E+ A     ++G     DNEE+GV Y YSFFHF   L SLY+MMTLTNWYQP+++   + S   +VWVKI SSWL + +YLWTL+AP +  +R+FN
Sbjct:   34 NSTVTRLAFSFLMLLGTLVSIIMIMPGMETQLEKIPGFC---EKGMSIPGFQ--GKVNCEVIVGYKSVYRMCFAMTCFFFLFSFIMIRVRSSKDPRGAIQNGFWFFKFLILVGITVGAFFIPDGT-FNTVWYYFGVVGSFIFILIQLILLVDFAHNWNQRWVEN-AENGSRCWYGALLSFTILHYACAFTAMVLFYVYYTQPDGCTEHKVFISLNLIFCIIVSIVSILPKVQEAQPSSGLLQSSLISLYTMYLTWSAMSNNPNRKCNPSLLQLVSNT--PSSSEPSPTIAPGQVQWWDAQGIVGLVIFLFCTLYASIRSSNNSQVNKLMQTEESQGLAADTEAMA----GEDGVHRAVDNEEDGVTYSYSFFHFCLVLASLYIMMTLTNWYQPDTDYQAMQSTMPAVWVKISSSWLVLALYLWTLVAPLILSNRDFN 457          
BLAST of Serine incorporator 3 vs. Ensembl Cavefish
Match: si:ch73-267c23.10 (serine incorporator 1-like [Source:NCBI gene;Acc:103041453])

HSP 1 Score: 350.517 bits (898), Expect = 7.506e-116
Identity = 196/408 (48.04%), Postives = 259/408 (63.48%), Query Frame = 3
Query:  174 KNSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLIINTYNTSRPN------GIGTTVTSVTNNE--------QNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVS-KPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQ 1352
            KNS  TR++Y   L++GTI++CIML+PG +  L  I   C   E G   +   + +   C +  GY AVYRVCF M+  F  F +LMI V +S+DPRA + NGFWFFKI + IG+ VG FYIP    F  +W ++GM G F++ILIQL+ LVDFAHSWNESW+D  E  +++ +Y  L+      YA S+T IVL+Y++Y    +C LNKFFISFNMILCI  S+VSILPK+ +  PRSGLLQSS++TLYT+YLTWSA+TN  ++ CNP L+      + P          T V  +  +E        Q W    IVGL +F+L ++YSSIRSS  + + KLT+   ET ++ D   G+    +   G + V DNE E V Y YSFFHFM FL SLY+MMTLTNWY+
Sbjct:   33 KNSIVTRVIYAFILLIGTIIACIMLSPGVERQLKRIPGFC---EGGAGSSVPGMEANVQCEIFVGYKAVYRVCFGMSVCFLAFSLLMINVKNSRDPRAAVHNGFWFFKIALIIGVTVGAFYIPEGP-FTRTWFVVGMAGAFVFILIQLVFLVDFAHSWNESWMDRMENGNSRRWYCALLSVMGLNYALSITAIVLMYLFYTQSEECGLNKFFISFNMILCITASVVSILPKVQDSQPRSGLLQSSVITLYTMYLTWSAITNEPDRTCNPRLLTIFQQIAEPTLPPVEMENQTFVIVINEDEPELSSPYLQWWDAQSIVGLGIFILCILYSSIRSSSTSQMNKLTLAAKETIVMEDSSPGSSCEVEDGSGPKRVEDNEREIVQYSYSFFHFMLFLASLYIMMTLTNWYR 436          
BLAST of Serine incorporator 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006270.1 (pep scaffold:Pmarinus_7.0:GL482447:5290:18448:-1 gene:ENSPMAG00000005646.1 transcript:ENSPMAT00000006270.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 417.542 bits (1072), Expect = 7.242e-142
Identity = 222/445 (49.89%), Postives = 296/445 (66.52%), Query Frame = 3
Query:  174 KNSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLIINTYNTSRP---NGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVSKPQEGG----QSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 1487
             NST TRLVY + L+LGT ++CIML+PG +  L  I   C   E G+      ++   +C ++ G+ AVYRVCF MA FF LFC++ + V SS+DPRA + NGFWFFK    + + VG FYIP  S F + W  +GM G F +ILIQL+LL+DFAHSWNESW++  EE +++ +Y  L+  T   Y  SLT IVL YI+Y     CA+NKFFISFN+ILCI+ S VSILP++ E  PRSGLLQSSI+TLYT+YLTWSAMTN   + CNP+L+     +  P   NG   T T+     Q W    IVGL ++LL ++YSSIR+S ++ V KLT+   +  ++ D  SG+     +EGG    +   DNE +GV Y YSFFHFM FL SLY+MMTLTNWY P+S+  TL S   +VWVK+ SSW+C+ +Y+WTL+AP +  +R+F+
Sbjct:   49 NNSTITRLVYAMLLLLGTAVACIMLSPGVEVRLKQIPGFC---EGGMGTQVPGVHGYVNCDVLVGFKAVYRVCFGMAMFFLLFCLITVGVRSSRDPRAPLHNGFWFFKFAAMVAITVGAFYIPEGS-FTSVWFYMGMSGAFCFILIQLVLLIDFAHSWNESWVERMEEGNSRCWYAALLSVTGINYMLSLTAIVLFYIFYTTSDACAMNKFFISFNLILCIIASTVSILPRVQEVQPRSGLLQSSIITLYTMYLTWSAMTNEPERKCNPSLLNFLQQSLVPVSTNG-SVTPTAPAPTAQWWDAQSIVGLAIYLLCILYSSIRTSNNSQVSKLTLSSGDATLIDDASSGSSAEDGREGGGAGSRRALDNERDGVQYSYSFFHFMLFLASLYIMMTLTNWYSPDSDFKTLTSKWPAVWVKVCSSWVCLSLYIWTLVAPLVLSNRDFD 488          
BLAST of Serine incorporator 3 vs. Ensembl Sea Lamprey
Match: serinc4 (serine incorporator 4 [Source:ZFIN;Acc:ZDB-GENE-121031-1])

HSP 1 Score: 288.5 bits (737), Expect = 3.872e-92
Identity = 189/445 (42.47%), Postives = 274/445 (61.57%), Query Frame = 3
Query:  174 KNSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNG-SNKNCNPTLIINTYNTSRPNGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTD---QESGAPVSKPQE-GGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQ-PNSNLLTLNSND--ASVWVKIISSWLCICIYLWTLLAPCMFPDREF 1484
            K ST +R++Y  + ILGTI+ C+MLAP    +L N      P+      A   I +G DC  + GY AVY+VCF MA FFF+F +++I V +S+D R+ I NGFWF K L+  G   G F+IP  + F+  W  IGM+GGFL+ILIQLILL++FAHSWN++W+ G E+  NKA+Y  LI  T+ FYAA++    L+ ++Y     CALNK  +S N++LC+ +S++++ P + +  PRSGLLQ+SI++ Y +YLT+SA+T+  +  +C P          +   + T + S  +  Q W    IVG ++    V+++ + S   +SV  L +   E    TD    E GA   +P++ GGQ V  NE +GV Y YSFFHF++FL SLY+MMTLTNW+   N+ L T  +    ++ WVK+ S W+C+ IY WTLLAP   P R+F
Sbjct:   34 KESTGSRIMYTFYHILGTIVCCLMLAPTISESLKNN----VPFYSDFCNA---IQAGVDCEKLVGYSAVYKVCFGMAAFFFIFAIILINVKTSRDCRSYIHNGFWFLKFLMLAGFCAGAFFIPDQNTFLKVWQYIGMVGGFLFILIQLILLIEFAHSWNKNWLTGAEQ--NKAWYAALITVTLIFYAAAIAAFALMIVFYTNPLGCALNKGLLSLNLVLCVAVSLLAVSPCVQKRQPRSGLLQASIISCYVMYLTFSAVTSRPAETDCTP----------KTREMTTQMVS-KSIMQWWEVVAIVGSIIMYGCVLFACVGSPVRSSVAALGISSDERPSATDGGQNEQGAVYEEPEDGGGQKVVFNERDGVVYSYSFFHFVYFLASLYIMMTLTNWFSYENARLDTAFTQGSWSTFWVKMASCWVCLSIYTWTLLAPLCCPGRDF 458          
BLAST of Serine incorporator 3 vs. Ensembl Sea Lamprey
Match: serinc5 (serine incorporator 5 [Source:NCBI gene;Acc:406835])

HSP 1 Score: 220.32 bits (560), Expect = 1.882e-66
Identity = 160/429 (37.30%), Postives = 240/429 (55.94%), Query Frame = 3
Query:  240 IMLAPG-FKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLIINTYNTSRPNGIGTTVTSVTNNEQNWSWTVI--VGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAI----LTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYS---FFHFMFFLGSLYVMMTLTNWYQPNSNLLT---LNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 1487
            I+LAP   +  L   +    P+   L    ++I +G DC  + GY AVY+VCF MA FFFLF + +I V  S D RA + NGFWF K+++ I +  G F+IP    F+  ++ +G++GGFL+I+IQLILLVDF HSWN++W  G E   NK +Y  L   T+ FY+ ++   +L+ +YY     C  NK  I  N+ LC + S ++I P + ++   SGLLQ+SI++ Y +YLT+SA+++   +        NT        +   + SVT +    S   +  VG ++    V+++ I +S + S   L       A     + D E   PV++ Q+GGQ V  NE + V Y YS   F  F+FFL SLYVMMTLTNW+  ++  L    ++ + ++ WVK  S WLC+ +Y WTL+AP     R+F 
Sbjct:   10 ILLAPTPSRAVLRCRRCPQVPFYADL---CHSINAGNDCERLVGYSAVYKVCFGMAVFFFLFSLFLINVKKSSDCRASVHNGFWFIKLVVLIAICAGAFFIPDQDNFIKVFMYVGVVGGFLFIIIQLILLVDFTHSWNKNWTSGIER--NKCWYLALGSVTLVFYSVAVVSSILMLVYYTHWDGCTFNKMLIGLNVTLCTLASALAISPCVQKHQSNSGLLQASIISCYVMYLTFSAISSRPAE--------NTAVVVDGQIVKICLPSVTESGLKVSDAAVAGVGAIIMYGCVLFACIVTSSYNSTTYLECENERAACCFCFIDDDE--VPVNEVQQGGQKVIQNECDAVVYSYSFFHFIFFIFFLASLYVMMTLTNWFSYDNARLEVTFVHGSWSTFWVKAGSCWLCLALYTWTLVAPICCSKRDFQ 423          
BLAST of Serine incorporator 3 vs. Ensembl Yeast
Match: TMS1 (Vacuolar membrane protein of unknown function; is conserved in mammals; predicted to contain eleven transmembrane helices; interacts with Pdr5p, a protein involved in multidrug resistance [Source:SGD;Acc:S000002512])

HSP 1 Score: 167.933 bits (424), Expect = 1.501e-46
Identity = 128/469 (27.29%), Postives = 234/469 (49.89%), Query Frame = 3
Query:  189 TRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTN-SGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFG--LIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNG-SNKNCNPTLIINTYNTSRPNGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGS----------------------ETAILTDQESGAP-----------VSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLT-NWYQPN-SNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDR 1478
            TRL+Y ++L+L +++S +        + S  K++       L+P      +G +C    G+  V+R+ FA+ C   +  +++  V S+ D RA +QN +W  K ++++ L+V  F IP +   F + W  + +  G ++IL+ LILLVDFAH W E+ I   E  D  + ++   L+  T   Y AS+   V++Y+ +  H  C +N+  ++ N+IL ++  ++S+ PKI E  P+SGL QSS++++Y  YLT SAM++   +K CNP  ++ +  T +                   +++I+G +   + + Y++ R++ +++      +G+                      E      +E   P            S P     +  D+E  G  Y+Y+ FH +FFL + ++ + LT N  Q +  + + +       WVKI+S+W+C  +Y WT++AP + PDR
Sbjct:   42 TRLLYAVWLLLNSLISWV--------SYSANKSI-------LWPGKTCTGTG-EC----GFFTVHRLNFALGCLHLILALVLTGVKSTNDVRAALQNSWWSLKFILYLCLIVLSFVIPNDFYIFFSKW--VSVPSGAIFILVGLILLVDFAHEWAETCISHVESEDEDSSFWQRFLVLGTTSMYTASIIMTVVMYVMFC-HQQCNMNQTAVTVNLILTVITLVLSVNPKIQEANPKSGLAQSSMVSVYCTYLTMSAMSSEPDDKMCNP--LVRSSGTRK-------------------FSIILGSLFTFIAIAYTTTRAAANSAFQGTNTNGAIYLGNDIEYEGLGGQTRNQLRYEAIKQAVEEGSLPESALYDTAWLGTSSPTGAMDNQNDDERTGTKYNYTLFHVIFFLATQWIAILLTINVTQDDVGDFIPVGRTYFYSWVKIVSAWICYALYGWTVVAPAIMPDR 466          
BLAST of Serine incorporator 3 vs. Ensembl Nematostella
Match: SERINC (Probable serine incorporator [Source:UniProtKB/Swiss-Prot;Acc:A7S4N4])

HSP 1 Score: 365.54 bits (937), Expect = 7.212e-122
Identity = 213/452 (47.12%), Postives = 292/452 (64.60%), Query Frame = 3
Query:  174 KNSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIY--YGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLIINTYNTSRPNGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTM----HGS----ETAILTD-QESGAPVSKPQEGGQ--SVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQP-NSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 1487
            KNSTSTR+VY +FL+ G ++SCI+LAPG ++ L+ I  LC              ++   C  I GY AVYRVCF +A FF LFC+LM  V SS+D R+KIQNGFW  KIL+F+G +V  F+IP    F   W+  G+IG FL+ILIQL+LLVDFAH+WN SW+   EE+ +K +   L+  T   Y   +  IV LY+Y  Y     C  NKFFISFN+ILCI+ S+++I PK+ E +P SGLLQ+S+++LYTVYLTWSA++   +KNCN       Y T         +T    + Q      I+G+++  + V+Y+S+R++  + VGKL M    H S    ET +L++  E+ + V   +EGG+   V+D+E+ GVAY YSF+HFM  L SLY+MMTLTNWY+P  S+   L  ++ +VWVKI SSWLC  IY+WTLLAP +FPDR+F+
Sbjct:   37 KNSTSTRIVYSIFLLFGLVVSCIVLAPGIRHKLNQIPYLCE-------------HASETCDSIVGYLAVYRVCFGLAAFFLLFCLLMYGVTSSRDVRSKIQNGFWGIKILLFLGAIVAAFFIPQGK-FSEVWMYFGLIGSFLFILIQLVLLVDFAHTWNSSWVGRMEESGSKVWAVLLLCATFLMYGFCVAGIVCLYVYFTYSQESSCHTNKFFISFNLILCIIASVLAIHPKVQERLPTSGLLQASVISLYTVYLTWSALSFQPDKNCN-----GFYETH--------ITLAGMDSQ-----AIIGVILMFVMVVYASVRTASSSQVGKLGMSSPKHSSALDKETTVLSEGDETRSDVGLVEEGGEGRRVYDDEDGGVAYSYSFYHFMLMLASLYIMMTLTNWYKPVGSDFSKLQYSETAVWVKIASSWLCQLIYIWTLLAPALFPDRDFS 456          
BLAST of Serine incorporator 3 vs. Ensembl Nematostella
Match: EDO33431 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS72])

HSP 1 Score: 322.398 bits (825), Expect = 3.498e-105
Identity = 196/450 (43.56%), Postives = 275/450 (61.11%), Query Frame = 3
Query:  174 KNSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALC--TPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYA-----ASLTFI----VLLYIYYGGHPD-CALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLIINTYNTSRPNGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPN-SNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREF 1484
            KNST++R+VY L L LGT++S +MLAPG +  L +I   C   P++               C  + GY AVYRVCF MA FF L  ++M KV SS+DPRAK QNGFWF KI + IGL+V  F+IP    F  +W+ +GMIGG+L+I++QLILL+DFA+SW+ESW           + FGLIF  + F A     + +  I    V+ + Y+   PD C  NKF+IS N+ LCI++S+++I+PK+ E  P SGLLQ++++TLYT+YLTWSAM+N  +  CNP+        +  NG  T +T   +     +  ++  +V     + Y S+R+S  + +G     G       D E+     + +   Q V+D+E   V+Y+YSFFHF FFL SLY+MMTLTNWY P  S+   L SN A+VWVKI +SW+C+ +Y WTLLAP + PDR+F
Sbjct:   26 KNSTASRIVYTLLLFLGTLVSAVMLAPGIRAKLDDIPHFCQAVPHDA--------------CDSLVGYLAVYRVCFGMAGFFLLMALMMFKVRSSRDPRAKFQNGFWFVKIALLIGLVVAAFFIPKGD-FGKAWMYVGMIGGYLFIILQLILLIDFAYSWSESWY----------HVFGLIFLIVIFSALVVVTSGMYLISIASVVCFFYFFTQPDGCKTNKFYISLNLCLCIVVSVLAIIPKVQEVQPSSGLLQAAVITLYTMYLTWSAMSNEPDAVCNPS-------GTLLNGSNTNLTPTMSGHSIVAAALMFAMVFHYPVLPYCSLRTSSTSQIGVQFPVGLLYIFTPDAEAAKDDDEDKPKHQKVYDDESTSVSYNYSFFHFTFFLASLYIMMTLTNWYSPQGSDFSKLTSNWATVWVKISTSWVCLALYAWTLLAPVLMPDRDF 443          
BLAST of Serine incorporator 3 vs. Ensembl Nematostella
Match: EDO43486 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYM3])

HSP 1 Score: 236.884 bits (603), Expect = 1.341e-72
Identity = 158/435 (36.32%), Postives = 246/435 (56.55%), Query Frame = 3
Query:  174 KNSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKA---YYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLIINTYNTSRPNGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQP---NSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAP 1460
            + ST TR+ Y +FL L T+L  +++ P     L++I  +CT            ++    C    GY AVYRVCFAMA F+FL   ++I V + +D RAK  NGFW+ KIL+ +GL  G F+IP +  F   W+ IG+ GGFL+ILIQL+LL+DFAH WNESW++  E ++ K     Y  L+  TI  YA SL  ++  Y  +     C  N FF++F++  C+  S++S+LP + +    +GLL+++++T Y++ LTWSA+++  +  CNP                +T+ S  +     S   +   ++  + +IY+S  S+  T+      +G   A+L    S   ++      +      +E   Y+YSFFHF+ FL SL++MMTLTNWY P   NS+LL L+ +  +VW+K+ SS  C+ +Y+WTL+AP
Sbjct:   10 RRSTVTRINYTVFLFLWTMLCVVLMLPSISKRLAHIHGICTE-----------VFQVESCDAFLGYSAVYRVCFAMAMFYFLMAFVLIGVRNEEDVRAKFHNGFWYIKILLLLGLTAGSFFIPRHGQFHAFWMYIGLAGGFLFILIQLLLLIDFAHCWNESWVEKTETSETKCGSRAYIALLAATILLYALSLAAVISFYSLFARDSSCKTNLFFVTFHLCHCVFASVISVLPAVQKAQSGTGLLKAAVVTSYSMLLTWSALSHEPDDTCNPR---------------STLLSGYDELTGLSLQAVFSGILMFVMLIYASF-STAMTASKLSKRNGVAAALLFLHNSRNTLTYNFNFTRKSCATSDE---YNYSFFHFVLFLASLHIMMTLTNWYSPNEGNSSLLRLSRSWPAVWIKMGSSSACVWLYIWTLIAP 414          
BLAST of Serine incorporator 3 vs. Ensembl Nematostella
Match: EDO32925 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STR9])

HSP 1 Score: 228.409 bits (581), Expect = 6.600e-69
Identity = 150/438 (34.25%), Postives = 236/438 (53.88%), Query Frame = 3
Query:  177 NSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPD---CALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNP--TLIINTYNTSRPNGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESG---APVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPN--SNLLTLNSNDASVWVKIISSWLCICIYLWTLLAP 1460
                +R  Y LFL +G +LS I L P  +  +  I  LC            T+ S   C  + GY A YR+ FAM  F+FL  +L   V S++  RA+I NGFW+ K+     L++  FYIP    F   W+ +G+ GGF++IL+Q++L++DF HSW+ SW +  +  + K ++F L F T   Y  SL     L++ +    D   C  N F+ISFN+  C + S++SILP++      SGLLQSS++T+YT+YLTW+ +++  ++ CNP   +I+     S  NG                  V   ++ F L     ++R+S  + +GKL M  ++         G       K +   ++  + E+E +AY YS FHF+ FL SL++MM LTNW+ P+  ++   L  N A+VWV++ SS++C  +++WTL+AP
Sbjct:   37 QGARSRFFYVLFLCVGNLLSFITLVPDMRYYIGKIPYLCD-----------TVTSPRMCDSLVGYSAAYRIYFAMTVFYFLLSILTYNVSSTKQFRARIHNGFWYIKLSFLSLLLIVAFYIPFTKMFGMVWMYVGLTGGFMFILLQIVLVIDFGHSWSASWAEKIDVLNTKCWFFALAFATALMYCISLGCASFLFMSFTNPTDMAQCKANTFYISFNVAHCGLASVISILPQVQREATGSGLLQSSVVTIYTMYLTWNTLSSQPDRTCNPLGDVILEYDKASGVNG----------------QAVFGSILTFALLTFACTVRAST-SQLGKLGMSLADNPEHLRHSIGLNRKRRKKAKRDVEAEGEEEDEDIAYSYSVFHFILFLASLHLMMVLTNWHSPDESADFKKLIKNWAAVWVQMASSFICCLVFIWTLVAP 446          
BLAST of Serine incorporator 3 vs. Ensembl Nematostella
Match: EDO48792 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RID6])

HSP 1 Score: 214.157 bits (544), Expect = 4.907e-63
Identity = 147/446 (32.96%), Postives = 228/446 (51.12%), Query Frame = 3
Query:  174 KNSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEE----NDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLIINTYNTSRPNGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTM-HGSETAILTDQESGAPVSKPQ----EGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNL---LTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPD 1475
            + S  TR+ Y  FL+ G ++SC MLAP     L +       Y              F C  + GY AVYRV  A+A FFF+  +LM  + SS+  RA+  NG W  KIL+   L     +IP +      W+  G+ GGF +I++Q +LL+D  H WN S ++  +     +  +  Y  L   TI  + AS+  +VL +  Y G   C  N FFI FN+ +C+  + +S+ P + E  PRSGLLQ+++ T Y  Y+TW A++N  +K CNP+                +     +  QN    + +G + F+L     S+R       GK+ +  G +  ++ D E  +P S+P     +GG+ + ++E  GV Y YSFFH +  L +LY MMT+T+WY+P       + L S   +VW+++ +    + IY+WTL+AP MFP+
Sbjct:   68 RQSAFTRVAYIGFLLGGCLISCFMLAPQTHLLLGDRFCQRITY--------------FACDTLRGYSAVYRVLSAIAVFFFILALLMFGLTSSRGWRARANNGLWAIKILLLSILTFAFLFIPHSEYTGEIWMFFGLNGGFTFIILQFMLLIDLVHCWNTSCVERLDSCSSYSRARVLYCVLWIPTILLFTASVISVVLFFHLYAGT-GCRNNTFFICFNVYICLAATYISVNPVVQEARPRSGLLQAAVTTSYNTYVTWLALSNAPDKVCNPS---------------ESYLYPGSPFQNLQLLIGLGFMFFILLCF--SLRRVKPPQYGKIKLFSGKQKEVVPDTEGCSP-SRPHPRQGDGGKLLIEDELNGVEYSYSFFHTLLCLAALYSMMTITDWYRPEEGEHLSVKLISGWGAVWIRLSAGIFSVFIYIWTLVAPVMFPN 480          
BLAST of Serine incorporator 3 vs. Ensembl Medaka
Match: si:ch73-267c23.10 (serine incorporator 1 [Source:NCBI gene;Acc:101159430])

HSP 1 Score: 391.734 bits (1005), Expect = 2.590e-131
Identity = 211/452 (46.68%), Postives = 284/452 (62.83%), Query Frame = 3
Query:  174 KNSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTL--IINTYNTSRPNGI----GTTVTSVTNNE--------QNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 1487
            +NS+ TR+VY   L+LGT++SCIML+PG    L  I   C   E G  P      +   C ++ GY AVYRVC  M+ +F   C+LM+ + +S+D RA I NGFWFFK +  + +MV  FYIP +  F  +W +IG  G F +ILIQL+LLVDFAHSWNESW+   E    + +Y  L+  T+  YA SLT + L +++Y     C +NKFFISFN+ LCIM S+VS+L K+ E+ PRSGLLQSS +TLYT++LTWSAMTN  ++ CNP+L  I     +  P  +     T V  +   E        Q W    IVGL++F+L ++YSSIRSS  T V KLTM   ++AIL +      +S      + V DNE E V Y YSFFHFM FL SLY+MM LTNWY P+++  T+ S   +VWVKI SSWLC+ +Y+WTL+AP +  +R+F+
Sbjct:   31 RNSSVTRIVYAFILLLGTLVSCIMLSPGVDQQLKRIPGFC---EDGASPHLPVFQAHLRCEMLVGYKAVYRVCCGMSLWFLGLCILMVNIKTSRDLRASIHNGFWFFKFVALVAIMVSAFYIP-DRPFTYAWFVIGSCGAFFFILIQLVLLVDFAHSWNESWMQKMESGSFRGWYAALLTVTMLNYALSLTAVGLFFVFYTKPDQCFINKFFISFNLFLCIMASVVSVLRKVQEFQPRSGLLQSSFITLYTMFLTWSAMTNEPDRECNPSLLSIFQQIASPTPPTLEIENQTAVVILLTEEPVPTSPYLQWWDGQSIVGLIIFVLCILYSSIRSSNTTQVNKLTMASKDSAILAEGGGSGELSDESMSLRRVEDNEREMVQYSYSFFHFMLFLASLYIMMILTNWYSPDAD-YTITSKWPTVWVKISSSWLCLALYIWTLVAPMILTNRDFS 477          
BLAST of Serine incorporator 3 vs. Ensembl Medaka
Match: serinc1 (serine incorporator 1 [Source:NCBI gene;Acc:101170387])

HSP 1 Score: 389.423 bits (999), Expect = 3.668e-130
Identity = 220/440 (50.00%), Postives = 288/440 (65.45%), Query Frame = 3
Query:  177 NSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLI-INTYNTSRPNGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVSKPQEGG--QSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 1487
            NST TRL+Y  FL+LG  ++CIML PG +  L  I   C   E G+  +   +    +C ++ GY AVYRVCF MA FF LF +LMIKV SSQDPRA + NGFWFFK    + + VG F+I +   F T W  +GM G F +ILIQL+LL+DFAHSWNESW++  EE +++ +Y  L+  T   Y  SL  +VL Y+YY     C  NK FIS NM+LC+ +S+VS+LP I E  PRSGLLQSS++TLYT+YLTWSAMTN  ++ CNP+L+ I   N++ P G    V       Q W    IVGL++FL+ V+YSSIR+S  T V KLT+   E+A++ D   G      +EGG      DNE++GV Y YSFFHFM FL SLY+MMTLTNWY P+S    + S   SVWVKI SSW+C+ +Y+WTL+AP +  +R+F+
Sbjct:   73 NSTVTRLIYAFFLLLGVGVACIMLMPGMEVQLKKIPGFC---EGGMGSSIPGVEGRVNCDVLVGYRAVYRVCFGMAMFFLLFSLLMIKVRSSQDPRAALHNGFWFFKCAAAVAITVGSFFI-SEGPFTTVWFYVGMAGAFCFILIQLVLLIDFAHSWNESWVEKMEEGNSRCWYAALLSVTALNYLLSLVSLVLFYVYYTHSDGCTENKVFISINMLLCLGVSVVSVLPHIQESQPRSGLLQSSLVTLYTMYLTWSAMTNEPDRKCNPSLLGIIGLNSTTPAGKDQVV-------QWWDAQGIVGLILFLMCVLYSSIRNSSTTQVNKLTLTTDESALIED---GPQSDSFEEGGGPNRALDNEKDGVTYSYSFFHFMLFLASLYIMMTLTNWYSPDSANEAMTSRWPSVWVKISSSWICLGLYVWTLVAPLVLVNRDFD 498          
BLAST of Serine incorporator 3 vs. Ensembl Medaka
Match: serinc2 (serine incorporator 1-like [Source:NCBI gene;Acc:101156750])

HSP 1 Score: 365.925 bits (938), Expect = 1.835e-121
Identity = 209/437 (47.83%), Postives = 285/437 (65.22%), Query Frame = 3
Query:  177 NSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLIINTYNTSRPNGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 1487
            NST +RL +   L+LGT++S IM+ PG +  L  I   C     GL P    I +  +C +I GY +VYR+CFAMACFFFLF ++MI+V +S+DPRA IQNGFWFFK L+ +G+ VG FYIP  S F   W   G++G F++I+IQLILL+DFAHSWN+SW++  E  + K ++  L+ FT   YA + T +VL Y++Y    DC  +K FIS N++ CI +S+VSILPK+ E  P SGLLQ+S+++LYT+Y+TWSAMTN  NK CNP+L+    +       G   T      Q W    IVGL++FL   +Y+SIRSS +  V +L        +  D    A  S  ++G +   DNEE+GV Y YSFFHF  FL SLY+MMTLTNWY PN++  ++ +   +VWVKI SSW+ + +YLWTL+AP + PDR+FN
Sbjct:   34 NSTISRLAFSFLLLLGTLVSIIMILPGMEEHLKKIPGFCVGGS-GL-PG---IQNKMNCDIIVGYKSVYRMCFAMACFFFLFSIIMIRVRTSKDPRAAIQNGFWFFKFLLLVGITVGAFYIPDGS-FNMVWYYFGVVGSFVFIIIQLILLIDFAHSWNQSWLERAENGNRKCWFGALLSFTFIHYALAFTAVVLFYVFYTQTDDCTEHKVFISLNLLFCIALSVVSILPKVQEAQPTSGLLQASLISLYTMYVTWSAMTNNPNKRCNPSLLSLVQHPGATPPPGPAPTEAPGKAQWWDAQGIVGLIIFLFCTLYASIRSSNNAQVNRLMQTEEGEGLTVD----AGDSTDEKGVRRAVDNEEDGVTYSYSFFHFSLFLASLYIMMTLTNWYMPNTDYESMQTAMPAVWVKISSSWIGLALYLWTLVAPLVLPDRDFN 460          
BLAST of Serine incorporator 3 vs. Ensembl Medaka
Match: serinc2l (serine incorporator 1 [Source:NCBI gene;Acc:101173834])

HSP 1 Score: 362.459 bits (929), Expect = 3.672e-120
Identity = 212/438 (48.40%), Postives = 284/438 (64.84%), Query Frame = 3
Query:  174 KNSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLIINTYNTSRPNGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 1487
             +ST TRLV+  FL+LGT++S IM+ PG +  L  I   C        P    + +  +C +I GY +VY +CFAM CFFFLF  +MI V +S+DPRA +QNGFWFFK LI +G+ VG F+IP  + F T W   G +G F++ILIQLILL+DFAHSWN++W++  EE DNK ++ GL+ FT   YA +L  +VL Y++Y     C  +K FIS N+I C++IS+VSILPKI E  P SGLLQ+S+++LYT+Y+TWSAMTN  N+ CNP+L+    N S  N  G          Q W    IVGL++FL   +Y+SIRSS +T V KL      T    +   G      ++G +   DNEEEGV Y YSFFHF   L SLY+MMTLTNWYQP++    + S+  +VWVK+ SSWL + +YLWTL+AP +F DR+F+
Sbjct:   33 NSSTITRLVFSFFLLLGTLVSVIMILPGMEAQLRKIPGFCKGGSF-FIPG---VENQVNCDVIVGYKSVYCMCFAMTCFFFLFSAIMIGVRNSKDPRAAVQNGFWFFKFLILVGITVGAFFIPDGT-FHTVWFYFGAVGSFIFILIQLILLIDFAHSWNKTWVENAEETDNKCWFAGLLSFTGLHYALALVAVVLFYMHYTQPDGCTEHKVFISLNLIFCVIISVVSILPKIQEVQPHSGLLQASLISLYTMYVTWSAMTNNPNRRCNPSLLSLVSNVSTSNQAG---QEGPGQVQWWDAQGIVGLIIFLFCTLYASIRSSSNTQVNKLMQTEGGTGAAVEDNVG------EDGVRRSVDNEEEGVTYSYSFFHFHLSLASLYIMMTLTNWYQPDTTTNAMQSSMPAVWVKMSSSWLGLGLYLWTLIAPLIFRDRDFS 456          
BLAST of Serine incorporator 3 vs. Ensembl Medaka
Match: serinc5 (serine incorporator 5 [Source:NCBI gene;Acc:101155440])

HSP 1 Score: 223.016 bits (567), Expect = 7.620e-67
Identity = 147/453 (32.45%), Postives = 241/453 (53.20%), Query Frame = 3
Query:  198 VYGLFLILGTILSCIMLAPGFKNTLSN----IKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPD-CALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLIINTYNTSRPNGIGTTVTSV---TNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMH----------------GSETAILTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLT--LNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDR 1478
            +Y L+ +L T +   M++P  +  L         LC   +           +G +CS + G+ AVY++CF MACFF  FC+L I+V +S   R+ I NGFW  K  + +G     F++P    F+  W  IG  GG  ++ IQL++LV+FAH WN +W  G E   N+ +Y  L F T+  +  ++  +  + +YY  HP+ C  NK F+  N  LC+++S+++I P I +  P+SGLLQ +++++Y +YLT+SA ++       P  ++        +G  TTV      T +E +     +VG    +  +IYS + S+   S   L ++                G +T    ++++G+        GQ V  +E+E   Y+YS+FHF+FFLGSLYVMM +TNW+  + + +   L+ + +  W+K+ S W+C+ +YL TL+AP M P R
Sbjct:    1 MYALYFLLVTFICAAMMSPTVEEELRKKIPFFSELCVKMK-----------AGENCSTLVGFSAVYKMCFGMACFFLFFCILTIRVRNSTGWRSAIHNGFWLLKFALLVGCCAAAFFLPDEDNFLKVWRCIGATGGVFFLFIQLLMLVEFAHRWNTNWSSGVEY--NRLWYAALAFVTLVLFTIAVGALAFMGMYY-THPEACLYNKIFLGINGSLCLVVSMLAISPFIQKLQPKSGLLQPAVISVYVMYLTFSAFSS------KPKEVVEI------DGGNTTVCVFPFNTGSESDKKIVTVVGGFFLVGCIIYSCLTSTTRRSSAALRVYRNSEPEAERARCFFCCGDDTEDYDEEKTGS--------GQDVIYDEKETTIYNYSYFHFVFFLGSLYVMMAVTNWFHYDGHRIEKLLDGSWSVFWLKMASCWVCLFLYLMTLIAPLMCPKR 419          
BLAST of Serine incorporator 3 vs. Planmine SMEST
Match: SMESG000020805.1 (SMESG000020805.1)

HSP 1 Score: 835.484 bits (2157), Expect = 0.000e+0
Identity = 465/465 (100.00%), Postives = 465/465 (100.00%), Query Frame = 3
Query:   93 MGCIIGXXXXXXXXXXXXXXXXXXXXXKNSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLIINTYNTSRPNGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 1487
            MGCIIGSLACCFCSSAASLCCGCLPSCKNSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRVCFAMACFFFLFCVLMIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLIINTYNTSRPNGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN
Sbjct:    1 MGCIIGSLACCFCSSAASLCCGCLPSCKNSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRVCFAMACFFFLFCVLMIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLIINTYNTSRPNGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 465          
BLAST of Serine incorporator 3 vs. Planmine SMEST
Match: SMESG000020805.1 (SMESG000020805.1)

HSP 1 Score: 809.29 bits (2089), Expect = 0.000e+0
Identity = 415/415 (100.00%), Postives = 415/415 (100.00%), Query Frame = 3
Query:  243 MLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLIINTYNTSRPNGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 1487
            MLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRVCFAMACFFFLFCVLMIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLIINTYNTSRPNGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN
Sbjct:    1 MLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRVCFAMACFFFLFCVLMIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLIINTYNTSRPNGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMHGSETAILTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 415          
BLAST of Serine incorporator 3 vs. Planmine SMEST
Match: SMESG000001436.1 (SMESG000001436.1)

HSP 1 Score: 311.227 bits (796), Expect = 2.070e-100
Identity = 170/440 (38.64%), Postives = 268/440 (60.91%), Query Frame = 3
Query:  174 KNSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLIINTYNTSRPNGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGHTSVGKLTMH--GSETAILTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDREFN 1487
             +STS+RL+Y L+  L  I + +ML     + L  I  LC P +  ++  +      F+C+  + +G + R CF ++ FFF   + MIKV +S + R K+ NGFWF+K++    ++     +  +  F + W + G+IGGFLYILIQL+L+VDFAH WNE W+D +E +++  YY+ LI FTI FY+ S++ I ++  Y+G +  C L++FFI F+++L I+ + +S+ PK+ E+  RSGLLQ+S++T+Y   LTW A+ +  +  CNPTL        +P           N +  WS+ +IV LV + + +IY S+R S   S  + +MH   +E   ++ Q +G   +   +G Q V +NE++ V YDYS FHF++ LG++Y+ MTLTNW    S++  L  N  ++W+KI  SW+ + +Y+WTLLAP MFPDR FN
Sbjct:   32 NSSTSSRLMYLLYFTLRIITAIVMLNSDVGSWLRKIPVLCPPSDTDIHNVALNF--NFNCTFSSNFGGINRCCFGLSIFFFFLSITMIKVKTSMEIRGKLNNGFWFWKLMALALIVTCSMLLLPDPYFSSIWFVFGLIGGFLYILIQLVLIVDFAHIWNEKWVDKFEIDNSNVYYYALIVFTITFYSISVSLISIMIYYFGSNSSCHLHRFFILFDVVLSILATGISVSPKVQEHTQRSGLLQASLITIYIAILTWGALISSPDPVCNPTL--------KPAD--------NNYKLEWSFYLIVSLVFYYVFIIYFSVRDSFAES-RRTSMHEQNNEITAVSPQRNGNNNANKYKGQQIV-ENEKDSVKYDYSLFHFIYCLGAIYLQMTLTNWLNLQSDIRVLKINSMAMWIKISGSWISVLLYIWTLLAPVMFPDRNFN 451          
BLAST of Serine incorporator 3 vs. Planmine SMEST
Match: SMESG000038788.1 (SMESG000038788.1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.437e-18
Identity = 88/337 (26.11%), Postives = 158/337 (46.88%), Query Frame = 3
Query:  174 KNSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPY--EIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIF-FTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHE----YMPRSGLLQSSILTLYTVYLTWSAMTNG-------SNKNCNPTLIINTYNTSRPNGIGTTVTSVTNNEQNWSWTV--IVGLVVFLLTVIYSSIRSS 1136
            ++S +TR++Y + LI   I+ C ++    K +L  +    +P+  E  +Y     + +G  C+ + GY A+YR+ +A   F     VL I++ SSQ+ RA + NGFWFFK+++ + +    F  P    +V    IIG++   ++I+IQ + L+D A+  N S++   E+      Y  L++   +F Y  +++  VLLY  +     C  N+  I  N     +I + S     H     Y+P       ++ T++  +LTW+A+ +          K  +P          + N I          E  +   +   +G+V+ L + +Y SIRSS
Sbjct:   27 RHSYTTRIMYCIMLIFVPIM-CALIHE--KTSLDYLIKKFSPFLNETCIY-----LQAGVSCNRLLGYKAIYRITYACFIFHLFMSVLCIRISSSQEWRATLHNGFWFFKLVLILTIWTILFLFPVVDDYVQILTIIGIVSALIFIIIQDVSLIDCAYELN-SYLR--EKGSKNCCYDKLLYIIALFLYMLAVSGYVLLYFNFAMPRKCFKNRIIIIINATASFIIVLFSFFVGKHNKNKLYIP------GAVTTVFVTFLTWTAIKSAPYEMVAFDFKPKDPYEARFLIRHDKKNKIYKCQLDHKFYEFEFGRELDNYLGMVLMLGSAVYCSIRSS 346          

HSP 2 Score: 69.3218 bits (168), Expect = 3.602e-12
Identity = 34/76 (44.74%), Postives = 47/76 (61.84%), Query Frame = 3
Query: 1254 NEEEGVAYDYSFFHFMFFLGSLYVMMTLTNWYQPN-SNLLTLNSNDASVWVKIISSWLCICIYLWTLLAPCMFPDR 1478
            +E  GV Y YS+FHF+F L  L+VM+ LTNWY P  S +L  + +  S W+KI  SW+ + ++ WTLL P     R
Sbjct:  469 DEYYGVKYSYSWFHFVFSLAYLFVMVQLTNWYSPQTSRILNFDKSWPSFWMKITISWVALILFCWTLLCPAFCKGR 544          
BLAST of Serine incorporator 3 vs. Planmine SMEST
Match: SMESG000038788.1 (SMESG000038788.1)

HSP 1 Score: 87.8113 bits (216), Expect = 2.219e-18
Identity = 88/337 (26.11%), Postives = 158/337 (46.88%), Query Frame = 3
Query:  174 KNSTSTRLVYGLFLILGTILSCIMLAPGFKNTLSNIKALCTPY--EIGLYPASYTIYSGFDCSLIAGYGAVYRXXXXXXXXXXXXXXXXIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIPTNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKAYYFGLIF-FTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMISIVSILPKIHE----YMPRSGLLQSSILTLYTVYLTWSAMTNG-------SNKNCNPTLIINTYNTSRPNGIGTTVTSVTNNEQNWSWTV--IVGLVVFLLTVIYSSIRSS 1136
            ++S +TR++Y + LI   I+ C ++    K +L  +    +P+  E  +Y     + +G  C+ + GY A+YR+ +A   F     VL I++ SSQ+ RA + NGFWFFK+++ + +    F  P    +V    IIG++   ++I+IQ + L+D A+  N S++   E+      Y  L++   +F Y  +++  VLLY  +     C  N+  I  N     +I + S     H     Y+P       ++ T++  +LTW+A+ +          K  +P          + N I          E  +   +   +G+V+ L + +Y SIRSS
Sbjct:   27 RHSYTTRIMYCIMLIFVPIM-CALIHE--KTSLDYLIKKFSPFLNETCIY-----LQAGVSCNRLLGYKAIYRITYACFIFHLFMSVLCIRISSSQEWRATLHNGFWFFKLVLILTIWTILFLFPVVDDYVQILTIIGIVSALIFIIIQDVSLIDCAYELN-SYLR--EKGSKNCCYDKLLYIIALFLYMLAVSGYVLLYFNFAMPRKCFKNRIIIIINATASFIIVLFSFFVGKHNKNKLYIP------GAVTTVFVTFLTWTAIKSAPYEMVAFDFKPKDPYEARFLIRHDKKNKIYKCQLDHKFYEFEFGRELDNYLGMVLMLGSAVYCSIRSS 346          
The following BLAST results are available for this feature:
BLAST of Serine incorporator 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SERINC31.137e-12647.42serine incorporator 3 [Source:HGNC Symbol;Acc:HGNC... [more]
SERINC31.137e-12647.42serine incorporator 3 [Source:HGNC Symbol;Acc:HGNC... [more]
SERINC12.892e-12048.53serine incorporator 1 [Source:HGNC Symbol;Acc:HGNC... [more]
SERINC28.215e-11045.48serine incorporator 2 [Source:HGNC Symbol;Acc:HGNC... [more]
SERINC28.352e-11045.48serine incorporator 2 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of Serine incorporator 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Y57E12AL.13.614e-12247.19pep chromosome:WBcel235:V:7060811:7062695:1 gene:W... [more]
Y57E12AL.12.353e-12146.97pep chromosome:WBcel235:V:7060811:7062695:1 gene:W... [more]
R11H6.25.564e-10447.60pep chromosome:WBcel235:V:14597939:14600091:1 gene... [more]
R11H6.25.564e-10447.60pep chromosome:WBcel235:V:14598006:14600092:1 gene... [more]
back to top
BLAST of Serine incorporator 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TMS12.405e-10744.44gene:FBgn0028399 transcript:FBtr0310552[more]
TMS11.137e-10644.22gene:FBgn0028399 transcript:FBtr0075389[more]
TMS11.464e-10544.34gene:FBgn0028399 transcript:FBtr0310550[more]
TMS11.090e-10444.22gene:FBgn0028399 transcript:FBtr0310551[more]
TMS13.979e-10443.76gene:FBgn0028399 transcript:FBtr0310553[more]
back to top
BLAST of Serine incorporator 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
serinc11.677e-13750.91serine incorporator 1 [Source:ZFIN;Acc:ZDB-GENE-03... [more]
serinc22.794e-12449.89serine incorporator 2 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
serinc2l3.443e-12249.43serine incorporator 2, like [Source:ZFIN;Acc:ZDB-G... [more]
serinc58.292e-8137.69serine incorporator 5 [Source:NCBI gene;Acc:406835... [more]
si:ch73-267c23.104.487e-7345.52si:ch73-267c23.10 [Source:ZFIN;Acc:ZDB-GENE-160114... [more]
back to top
BLAST of Serine incorporator 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
serinc11.587e-13549.89serine incorporator 1, gene 1 [Source:NCBI gene;Ac... [more]
serinc12.058e-13549.89serine incorporator 1, gene 1 [Source:NCBI gene;Ac... [more]
serinc12.344e-13549.89serine incorporator 1, gene 1 [Source:NCBI gene;Ac... [more]
serinc13.108e-13549.89serine incorporator 1, gene 1 [Source:NCBI gene;Ac... [more]
serinc13.109e-13549.89serine incorporator 1, gene 1 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Serine incorporator 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Serinc11.286e-12847.84serine incorporator 1 [Source:MGI Symbol;Acc:MGI:1... [more]
Serinc33.707e-11748.10serine incorporator 3 [Source:MGI Symbol;Acc:MGI:1... [more]
Serinc21.865e-10945.23serine incorporator 2 [Source:MGI Symbol;Acc:MGI:1... [more]
Serinc22.081e-10945.23serine incorporator 2 [Source:MGI Symbol;Acc:MGI:1... [more]
Serinc25.336e-10245.08serine incorporator 2 [Source:MGI Symbol;Acc:MGI:1... [more]
back to top
BLAST of Serine incorporator 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A4FUZ5|SERC3_BOVIN5.567e-13148.22Serine incorporator 3 OS=Bos taurus OX=9913 GN=SER... [more]
sp|Q7TNK0|SERC1_RAT1.753e-12848.29Serine incorporator 1 OS=Rattus norvegicus OX=1011... [more]
sp|Q9QZI8|SERC1_MOUSE8.994e-12847.84Serine incorporator 1 OS=Mus musculus OX=10090 GN=... [more]
sp|Q5R533|SERC3_PONAB1.019e-12747.64Serine incorporator 3 OS=Pongo abelii OX=9601 GN=S... [more]
sp|Q13530|SERC3_HUMAN5.462e-12647.42Serine incorporator 3 OS=Homo sapiens OX=9606 GN=S... [more]
back to top
BLAST of Serine incorporator 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8H7197.726e-15054.33Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A433TPH24.459e-14653.11Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A0N7ZRP42.290e-14551.12Serine incorporator OS=Daphnia magna OX=35525 PE=4... [more]
A0A0P6E6863.519e-14551.12EOG090X07ET OS=Daphnia magna OX=35525 GN=EOG090X07... [more]
A0A2T7PEM83.693e-14551.48Uncharacterized protein OS=Pomacea canaliculata OX... [more]
back to top
BLAST of Serine incorporator 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
serinc12.069e-13649.89serine incorporator 1 [Source:NCBI gene;Acc:103046... [more]
si:ch73-267c23.105.111e-13348.01serine incorporator 1-like [Source:NCBI gene;Acc:1... [more]
serinc2l1.900e-13250.91serine incorporator 2-like [Source:NCBI gene;Acc:1... [more]
serinc22.347e-12248.74serine incorporator 2 [Source:NCBI gene;Acc:103046... [more]
si:ch73-267c23.107.506e-11648.04serine incorporator 1-like [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Serine incorporator 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000006270.17.242e-14249.89pep scaffold:Pmarinus_7.0:GL482447:5290:18448:-1 g... [more]
serinc43.872e-9242.47serine incorporator 4 [Source:ZFIN;Acc:ZDB-GENE-12... [more]
serinc51.882e-6637.30serine incorporator 5 [Source:NCBI gene;Acc:406835... [more]
back to top
BLAST of Serine incorporator 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
TMS11.501e-4627.29Vacuolar membrane protein of unknown function; is ... [more]
back to top
BLAST of Serine incorporator 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
SERINC7.212e-12247.12Probable serine incorporator [Source:UniProtKB/Sw... [more]
EDO334313.498e-10543.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO434861.341e-7236.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329256.600e-6934.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487924.907e-6332.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Serine incorporator 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-267c23.102.590e-13146.68serine incorporator 1 [Source:NCBI gene;Acc:101159... [more]
serinc13.668e-13050.00serine incorporator 1 [Source:NCBI gene;Acc:101170... [more]
serinc21.835e-12147.83serine incorporator 1-like [Source:NCBI gene;Acc:1... [more]
serinc2l3.672e-12048.40serine incorporator 1 [Source:NCBI gene;Acc:101173... [more]
serinc57.620e-6732.45serine incorporator 5 [Source:NCBI gene;Acc:101155... [more]
back to top
BLAST of Serine incorporator 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020805.10.000e+0100.00SMESG000020805.1[more]
SMESG000020805.10.000e+0100.00SMESG000020805.1[more]
SMESG000001436.12.070e-10038.64SMESG000001436.1[more]
SMESG000038788.11.437e-1826.11SMESG000038788.1[more]
SMESG000038788.12.219e-1826.11SMESG000038788.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029350 ID=SMED30029350|Name=Serine incorporator 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1633bp
TATAAAATGATCATTTACAATATTGTTTATATAATTCATATTTCAGAAAA
AACTTTAAATTTATAAACAATCAAAGTCATTATAATTAAGAGATGGGTTG
CATTATTGGCTCATTAGCATGTTGCTTTTGTAGTTCAGCAGCTAGTTTAT
GCTGTGGTTGTTTACCTTCTTGCAAAAATTCCACATCTACTCGCTTAGTT
TATGGTTTATTTTTAATATTGGGCACAATATTATCTTGTATAATGTTGGC
TCCTGGATTTAAAAACACTCTTTCGAATATAAAAGCACTTTGTACTCCTT
ATGAAATTGGGCTATATCCAGCATCTTATACTATATACTCCGGCTTCGAT
TGTAGCTTGATTGCCGGATACGGTGCGGTCTATCGTGTTTGTTTCGCAAT
GGCGTGCTTCTTTTTCTTATTTTGTGTATTAATGATAAAAGTACATAGTT
CTCAAGATCCTCGTGCTAAAATTCAAAACGGATTTTGGTTTTTTAAGATA
TTGATTTTTATAGGCTTGATGGTTGGTGGATTTTACATCCCAACGAATTC
AGGCTTTGTAACATCCTGGCTTATTATCGGAATGATTGGTGGTTTTTTAT
ACATCCTTATCCAATTAATATTGCTGGTGGATTTCGCCCACAGCTGGAAT
GAAAGTTGGATTGATGGTTACGAAGAAAATGACAATAAAGCGTATTATTT
TGGATTAATATTTTTCACGATTTTCTTTTATGCTGCATCTTTGACATTCA
TTGTCTTACTTTATATTTACTATGGTGGTCATCCAGATTGCGCTCTTAAT
AAATTCTTTATTAGTTTCAATATGATTTTATGTATAATGATCAGTATCGT
TTCAATTCTACCCAAGATTCACGAATACATGCCAAGATCTGGTTTGCTTC
AATCATCAATACTAACTTTGTACACAGTCTATTTAACATGGTCCGCTATG
ACCAATGGATCGAACAAAAACTGTAATCCAACCTTGATAATAAATACTTA
TAACACTAGTCGGCCGAATGGCATTGGTACAACTGTGACATCAGTTACTA
ACAATGAGCAAAATTGGTCATGGACTGTTATAGTCGGATTAGTAGTATTT
CTATTAACGGTGATTTATTCAAGCATACGTAGTAGTGGCCATACGAGTGT
TGGCAAGTTGACAATGCATGGATCTGAAACTGCTATATTGACTGATCAGG
AGTCTGGTGCTCCTGTTTCAAAGCCTCAAGAAGGCGGACAAAGTGTATGG
GACAACGAAGAGGAAGGTGTTGCATACGATTATTCGTTTTTTCACTTCAT
GTTTTTTCTCGGCTCGCTTTATGTAATGATGACATTGACTAATTGGTACC
AACCAAATAGCAATCTGTTGACCCTGAATTCCAATGACGCAAGCGTTTGG
GTGAAAATTATCAGTAGTTGGTTATGCATTTGCATCTACTTGTGGACCCT
TTTAGCTCCGTGTATGTTTCCAGATCGAGAGTTCAACTGAGTTTGATTGA
CACTATAATTACAATATTTCATCGACTATAACGACTGCGTTTTCATCCAC
CCACTTATTTGTTATGAAAAAATAATTATTATTTTGAATATTCATTTAAT
TAGATAAAGATTTTTCTGTGTTTTTAAAAAAAA
back to top

protein sequence of SMED30029350-orf-1

>SMED30029350-orf-1 ID=SMED30029350-orf-1|Name=SMED30029350-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=466bp
MGCIIGSLACCFCSSAASLCCGCLPSCKNSTSTRLVYGLFLILGTILSCI
MLAPGFKNTLSNIKALCTPYEIGLYPASYTIYSGFDCSLIAGYGAVYRVC
FAMACFFFLFCVLMIKVHSSQDPRAKIQNGFWFFKILIFIGLMVGGFYIP
TNSGFVTSWLIIGMIGGFLYILIQLILLVDFAHSWNESWIDGYEENDNKA
YYFGLIFFTIFFYAASLTFIVLLYIYYGGHPDCALNKFFISFNMILCIMI
SIVSILPKIHEYMPRSGLLQSSILTLYTVYLTWSAMTNGSNKNCNPTLII
NTYNTSRPNGIGTTVTSVTNNEQNWSWTVIVGLVVFLLTVIYSSIRSSGH
TSVGKLTMHGSETAILTDQESGAPVSKPQEGGQSVWDNEEEGVAYDYSFF
HFMFFLGSLYVMMTLTNWYQPNSNLLTLNSNDASVWVKIISSWLCICIYL
WTLLAPCMFPDREFN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR029554SERINC2
IPR005016TDE1/TMS
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006658phosphatidylserine metabolic process
GO:0006665sphingolipid metabolic process
GO:0015825L-serine transport
Vocabulary: molecular function
TermDefinition
GO:0015194L-serine transmembrane transporter activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005016Serine incorporator/TMS membrane proteinPFAMPF03348Serinccoord: 10..463
e-value: 3.6E-162
score: 540.2
IPR005016Serine incorporator/TMS membrane proteinPANTHERPTHR10383SERINE INCORPORATORcoord: 5..465
IPR029554Serine incorporator 2PANTHERPTHR10383:SF22SERINE INCORPORATOR 2coord: 5..465
NoneNo IPR availableSIGNALP_EUKSignalP-TMSignalP-TMcoord: 1..18
score: 0.637
NoneNo IPR availableTMHMMTMhelixcoord: 238..260
NoneNo IPR availableTMHMMTMhelixcoord: 5..27
NoneNo IPR availableTMHMMTMhelixcoord: 323..345
NoneNo IPR availableTMHMMTMhelixcoord: 434..456
NoneNo IPR availableTMHMMTMhelixcoord: 159..181
NoneNo IPR availableTMHMMTMhelixcoord: 95..117
NoneNo IPR availableTMHMMTMhelixcoord: 130..149
NoneNo IPR availableTMHMMTMhelixcoord: 267..286
NoneNo IPR availableTMHMMTMhelixcoord: 397..419
NoneNo IPR availableTMHMMTMhelixcoord: 34..56
NoneNo IPR availableTMHMMTMhelixcoord: 201..223