Adenosylhomocysteinase

Overview
NameAdenosylhomocysteinase
Smed IDSMED30029349
Length (bp)2077
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Adenosylhomocysteinase (SMED30029349) t-SNE clustered cells

Violin plots show distribution of expression levels for Adenosylhomocysteinase (SMED30029349) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Adenosylhomocysteinase (SMED30029349) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Adenosylhomocysteinase (SMED30029349) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029349

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30029349SMESG000029405.1 SmedASXL_003062SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30029349SMESG000029405.1 dd_Smed_v4_3408_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30029349SMESG000029405.1 dd_Smed_v4_3408_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30029349SMESG000029405.1 dd_Smed_v4_3408_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30029349SMESG000029405.1 dd_Smed_v4_3408_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30029349SMESG000029405.1 dd_Smed_v4_3408_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30029349SMESG000029405.1 dd_Smed_v4_3408_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30029349SMESG000029405.1 dd_Smed_v4_3408_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30029349SMESG000029405.1 dd_Smed_v4_3408_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Adenosylhomocysteinase vs. Ensembl Human
Match: AHCYL2 (adenosylhomocysteinase like 2 [Source:HGNC Symbol;Acc:HGNC:22204])

HSP 1 Score: 500.36 bits (1287), Expect = 5.014e-171
Identity = 251/434 (57.83%), Postives = 323/434 (74.42%), Query Frame = 3
Query:  579 NSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            NS+G +DFCV  I +A  GRREIEIA+QEM   +++    + + PL GAKI+GCTHITAQTAVL+E L  LGA  RW ACNIYST NEVAAALAESG P+++WKG++EDDFWW ID+C+NVE     ++ILDDGGDLT  + K  P      KGIVEES+TG+HRLY + K   L  PAMN+N+SVTK KFD+ Y C+E+++D LKR+TD    GK V+VCGYG VGKGCC  LK MG+ V V EIDPIC++QAC++GFR++ ++  +   DIV+TCTG  +++     +++K+ CIVCNMGH  +EID+ SL+   + WER+R  VD VI P  KRI+L+A+GR+ NL+CSTVP+ V+S+T+T Q LALIELY A +GRYK ++YL+PKK DE VA  HL  F A L ELTD QAKYLG+NK GP+K  +YRY
Sbjct:   76 NSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTAVLMETLGALGAQCRWAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVNVE-GWQPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMDGFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIVLLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELTDEQAKYLGLNKNGPFKPNYYRY 508          
BLAST of Adenosylhomocysteinase vs. Ensembl Human
Match: AHCYL2 (adenosylhomocysteinase like 2 [Source:HGNC Symbol;Acc:HGNC:22204])

HSP 1 Score: 500.36 bits (1287), Expect = 5.124e-171
Identity = 251/434 (57.83%), Postives = 323/434 (74.42%), Query Frame = 3
Query:  579 NSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            NS+G +DFCV  I +A  GRREIEIA+QEM   +++    + + PL GAKI+GCTHITAQTAVL+E L  LGA  RW ACNIYST NEVAAALAESG P+++WKG++EDDFWW ID+C+NVE     ++ILDDGGDLT  + K  P      KGIVEES+TG+HRLY + K   L  PAMN+N+SVTK KFD+ Y C+E+++D LKR+TD    GK V+VCGYG VGKGCC  LK MG+ V V EIDPIC++QAC++GFR++ ++  +   DIV+TCTG  +++     +++K+ CIVCNMGH  +EID+ SL+   + WER+R  VD VI P  KRI+L+A+GR+ NL+CSTVP+ V+S+T+T Q LALIELY A +GRYK ++YL+PKK DE VA  HL  F A L ELTD QAKYLG+NK GP+K  +YRY
Sbjct:   76 NSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTAVLMETLGALGAQCRWAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVNVE-GWQPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMDGFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIVLLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELTDEQAKYLGLNKNGPFKPNYYRY 508          
BLAST of Adenosylhomocysteinase vs. Ensembl Human
Match: AHCYL2 (adenosylhomocysteinase like 2 [Source:HGNC Symbol;Acc:HGNC:22204])

HSP 1 Score: 499.975 bits (1286), Expect = 1.051e-170
Identity = 251/434 (57.83%), Postives = 323/434 (74.42%), Query Frame = 3
Query:  579 NSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            NS+G +DFCV  I +A  GRREIEIA+QEM   +++    + + PL GAKI+GCTHITAQTAVL+E L  LGA  RW ACNIYST NEVAAALAESG P+++WKG++EDDFWW ID+C+NVE     ++ILDDGGDLT  + K  P      KGIVEES+TG+HRLY + K   L  PAMN+N+SVTK KFD+ Y C+E+++D LKR+TD    GK V+VCGYG VGKGCC  LK MG+ V V EIDPIC++QAC++GFR++ ++  +   DIV+TCTG  +++     +++K+ CIVCNMGH  +EID+ SL+   + WER+R  VD VI P  KRI+L+A+GR+ NL+CSTVP+ V+S+T+T Q LALIELY A +GRYK ++YL+PKK DE VA  HL  F A L ELTD QAKYLG+NK GP+K  +YRY
Sbjct:   86 NSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTAVLMETLGALGAQCRWAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVNVE-GWQPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMDGFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIVLLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELTDEQAKYLGLNKNGPFKPNYYRY 518          
BLAST of Adenosylhomocysteinase vs. Ensembl Human
Match: AHCYL2 (adenosylhomocysteinase like 2 [Source:HGNC Symbol;Acc:HGNC:22204])

HSP 1 Score: 503.442 bits (1295), Expect = 1.168e-170
Identity = 251/434 (57.83%), Postives = 323/434 (74.42%), Query Frame = 3
Query:  579 NSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            NS+G +DFCV  I +A  GRREIEIA+QEM   +++    + + PL GAKI+GCTHITAQTAVL+E L  LGA  RW ACNIYST NEVAAALAESG P+++WKG++EDDFWW ID+C+NVE     ++ILDDGGDLT  + K  P      KGIVEES+TG+HRLY + K   L  PAMN+N+SVTK KFD+ Y C+E+++D LKR+TD    GK V+VCGYG VGKGCC  LK MG+ V V EIDPIC++QAC++GFR++ ++  +   DIV+TCTG  +++     +++K+ CIVCNMGH  +EID+ SL+   + WER+R  VD VI P  KRI+L+A+GR+ NL+CSTVP+ V+S+T+T Q LALIELY A +GRYK ++YL+PKK DE VA  HL  F A L ELTD QAKYLG+NK GP+K  +YRY
Sbjct:  179 NSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTAVLMETLGALGAQCRWAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVNVE-GWQPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMDGFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIVLLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELTDEQAKYLGLNKNGPFKPNYYRY 611          
BLAST of Adenosylhomocysteinase vs. Ensembl Human
Match: AHCYL2 (adenosylhomocysteinase like 2 [Source:HGNC Symbol;Acc:HGNC:22204])

HSP 1 Score: 503.056 bits (1294), Expect = 1.687e-170
Identity = 251/434 (57.83%), Postives = 323/434 (74.42%), Query Frame = 3
Query:  579 NSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            NS+G +DFCV  I +A  GRREIEIA+QEM   +++    + + PL GAKI+GCTHITAQTAVL+E L  LGA  RW ACNIYST NEVAAALAESG P+++WKG++EDDFWW ID+C+NVE     ++ILDDGGDLT  + K  P      KGIVEES+TG+HRLY + K   L  PAMN+N+SVTK KFD+ Y C+E+++D LKR+TD    GK V+VCGYG VGKGCC  LK MG+ V V EIDPIC++QAC++GFR++ ++  +   DIV+TCTG  +++     +++K+ CIVCNMGH  +EID+ SL+   + WER+R  VD VI P  KRI+L+A+GR+ NL+CSTVP+ V+S+T+T Q LALIELY A +GRYK ++YL+PKK DE VA  HL  F A L ELTD QAKYLG+NK GP+K  +YRY
Sbjct:  178 NSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTAVLMETLGALGAQCRWAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVNVEGW-QPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMDGFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIVLLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELTDEQAKYLGLNKNGPFKPNYYRY 610          
BLAST of Adenosylhomocysteinase vs. Ensembl Celegans
Match: ahcy-1 (Adenosylhomocysteinase [Source:UniProtKB/Swiss-Prot;Acc:P27604])

HSP 1 Score: 355.91 bits (912), Expect = 4.628e-116
Identity = 190/430 (44.19%), Postives = 277/430 (64.42%), Query Frame = 3
Query:  600 FCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXA-QVLALIELYT--ATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            + V+ I  A  GR+EI +A+ EM G +++ +      PLKGA+I GC H+T QTAVLIE L  LGA V+W +CNI+STQ+  AAA+A++G+P+Y+WKG+T++++ W I++ I  +    +++ILDDGGDLT  +    P+ L   +G+ EE+ TG+H L  ++    L+ PA+N+N+SVTKSKFD+ Y  +E+L D +KR+TD  ++GK+ +V GYG VGKG   +LK  G++VIV EIDPI ++QA +EG+ V  +  A P A+I+VT TG   ++    FE L +  IVCN+GH   EID+  L       + I+  VD   L + + +IL+A+GR+ NL C+T     +   S   QVLA +EL+T   T   YK  +Y++PK  DE VA  HL+  G +L +L+D QA YLGV   GPYK   YRY
Sbjct:    8 YKVADIKLADFGRKEIILAENEMPGLMAMRSKYGPSQPLKGARIAGCLHMTIQTAVLIETLTALGAEVQWSSCNIFSTQDHAAAAIAQTGVPVYAWKGETDEEYEWCIEQTIVFKDGQPLNMILDDGGDLTNLVHAKYPQYLAGIRGLSEETTTGVHNLAKMLAKGDLKVPAINVNDSVTKSKFDNLYGIRESLPDGIKRATDVMLAGKVAVVAGYGDVGKGSAASLKAFGSRVIVTEIDPINALQAAMEGYEVTTLEEAAPKANIIVTTTGCKDIVTGKHFELLPNDAIVCNVGHFDCEIDVKWLNTNATKKDTIKPQVDRYTLKNGRHVILLAEGRLVNLGCATGHPSFVMSNSFTNQVLAQVELWTKFGTPQEYKLGLYVLPKTLDEEVAYLHLAQLGVKLTKLSDEQASYLGVPVAGPYKPDHYRY 437          
BLAST of Adenosylhomocysteinase vs. Ensembl Celegans
Match: ahcy-1 (Adenosylhomocysteinase [Source:UniProtKB/Swiss-Prot;Acc:P27604])

HSP 1 Score: 355.91 bits (912), Expect = 4.628e-116
Identity = 190/430 (44.19%), Postives = 277/430 (64.42%), Query Frame = 3
Query:  600 FCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXA-QVLALIELYT--ATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            + V+ I  A  GR+EI +A+ EM G +++ +      PLKGA+I GC H+T QTAVLIE L  LGA V+W +CNI+STQ+  AAA+A++G+P+Y+WKG+T++++ W I++ I  +    +++ILDDGGDLT  +    P+ L   +G+ EE+ TG+H L  ++    L+ PA+N+N+SVTKSKFD+ Y  +E+L D +KR+TD  ++GK+ +V GYG VGKG   +LK  G++VIV EIDPI ++QA +EG+ V  +  A P A+I+VT TG   ++    FE L +  IVCN+GH   EID+  L       + I+  VD   L + + +IL+A+GR+ NL C+T     +   S   QVLA +EL+T   T   YK  +Y++PK  DE VA  HL+  G +L +L+D QA YLGV   GPYK   YRY
Sbjct:    8 YKVADIKLADFGRKEIILAENEMPGLMAMRSKYGPSQPLKGARIAGCLHMTIQTAVLIETLTALGAEVQWSSCNIFSTQDHAAAAIAQTGVPVYAWKGETDEEYEWCIEQTIVFKDGQPLNMILDDGGDLTNLVHAKYPQYLAGIRGLSEETTTGVHNLAKMLAKGDLKVPAINVNDSVTKSKFDNLYGIRESLPDGIKRATDVMLAGKVAVVAGYGDVGKGSAASLKAFGSRVIVTEIDPINALQAAMEGYEVTTLEEAAPKANIIVTTTGCKDIVTGKHFELLPNDAIVCNVGHFDCEIDVKWLNTNATKKDTIKPQVDRYTLKNGRHVILLAEGRLVNLGCATGHPSFVMSNSFTNQVLAQVELWTKFGTPQEYKLGLYVLPKTLDEEVAYLHLAQLGVKLTKLSDEQASYLGVPVAGPYKPDHYRY 437          
BLAST of Adenosylhomocysteinase vs. Ensembl Fly
Match: AhcyL1 (gene:FBgn0035371 transcript:FBtr0073016)

HSP 1 Score: 499.975 bits (1286), Expect = 5.635e-171
Identity = 254/460 (55.22%), Postives = 332/460 (72.17%), Query Frame = 3
Query:  504 ENDDKDPKKKLTIREKFENPETRKCNSRGFNDFCVSKIN-EASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            + DD  P++K+            + NS+G +DFCV  I  + + GRREIEIA+QEM G +++     +D PLK AKI+GCTHI AQTAVLIE L+ LGASVRW ACNIYSTQNEVAAALAESGIPI++W+G+TE+DFWW ID+C+N E     ++ILDDGGD T  +LK  P      KGIVEES+TG+HRLY + K   L  PAMN+N+SVTK+KFD+ Y CKE+++D+LKRSTD    GK V+VCGYG VGKGC Q LKG G  V + EIDPIC++QA ++GFRV+ ++  +   DIVVT TG  +++     +K+K GCIVCNMGH  +EID++ L+   + WE++R  VD +I P  K IIL+A+GR+ NL+CS++PS  +S+TS  Q LALIEL+ A  GRYK+++YL+PKK DE VA  HL  F A L EL+D QAKY+G+NK GP+K  +YRY
Sbjct:   75 DGDDVPPREKV------------QKNSKGSSDFCVRNIGAQHAFGRREIEIAEQEMPGIIALKKRAAEDKPLKDAKIVGCTHINAQTAVLIETLVELGASVRWAACNIYSTQNEVAAALAESGIPIFAWRGETEEDFWWCIDRCVNAENW-QPNMILDDGGDATHLMLKKYPTMFKLVKGIVEESVTGVHRLYQLSKAGKLTVPAMNVNDSVTKTKFDNLYSCKESILDSLKRSTDVMFGGKQVVVCGYGDVGKGCAQALKGQGCIVYITEIDPICALQASMDGFRVVKLNEVIRNVDIVVTATGNKNVVVREHMDKMKSGCIVCNMGHSNTEIDVNGLRTPDLTWEKVRSQVDHIIWPEGKYIILLAEGRLVNLSCSSIPSFAVSITSATQALALIELFNAPPGRYKSDVYLLPKKMDEYVASLHLPTFDAHLTELSDEQAKYMGLNKAGPFKPNYYRY 521          
BLAST of Adenosylhomocysteinase vs. Ensembl Fly
Match: AhcyL2 (gene:FBgn0015011 transcript:FBtr0083378)

HSP 1 Score: 459.529 bits (1181), Expect = 1.475e-155
Identity = 232/434 (53.46%), Postives = 322/434 (74.19%), Query Frame = 3
Query:  579 NSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            NS G  DFCV  I++++ GRREIEIA+ EM G +++    +D+ PLKGA I+GCTH+ AQ+AVLIE L+ LGA+VRW ACNIYSTQN VAAALAE+GIPI++W+G+TE++FWW +D+ I        +LILDDGGD T  +LK  P+     +GIVEES+TG+HRLY + K   L  PA+N+N+SVTK+KFD++Y C+++++D+LKR+TD    GK V++CGYG VGKGC Q+LKG G  V V E+DPIC++QA ++GFRV+ ++  +   D+VVT TG  +++      ++K+GCI+CNMGH  SEID++ L    + WER+R  VD +  P  + IIL+A+GR+ NL+CST+ S V+SV S+ Q LALIEL++A  GRYK+++YL+PKK DE VA  HL+ F A L ELTD Q+K++G+NK GP+K  +YRY
Sbjct:   61 NSAGGTDFCVKSISKSAFGRREIEIAESEMPGIMTLRKRAKDEKPLKGANIVGCTHVNAQSAVLIETLVQLGATVRWAACNIYSTQNAVAAALAEAGIPIFAWRGETEEEFWWCLDRAI-YSDGWQPNLILDDGGDATHLMLKKYPDYFKAIRGIVEESVTGVHRLYMLSKGGKLTVPAINVNDSVTKNKFDTFYTCRDSILDSLKRTTDIMFGGKQVVICGYGDVGKGCAQSLKGQGCIVYVTEVDPICALQAAMDGFRVVRLNEVIRTVDVVVTATGNKNVITRDHMNRMKNGCILCNMGHSCSEIDVNGLHTPELTWERVRSQVDHIRWPDGRMIILLAEGRLVNLSCSTISSFVVSVASSTQALALIELFSAP-GRYKSDVYLLPKKMDEYVASLHLATFDAHLTELTDEQSKFMGLNKAGPFKANYYRY 492          
BLAST of Adenosylhomocysteinase vs. Ensembl Fly
Match: AhcyL2 (gene:FBgn0015011 transcript:FBtr0083379)

HSP 1 Score: 456.833 bits (1174), Expect = 2.922e-154
Identity = 231/433 (53.35%), Postives = 321/433 (74.13%), Query Frame = 3
Query:  579 NSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYR 1877
            NS G  DFCV  I++++ GRREIEIA+ EM G +++    +D+ PLKGA I+GCTH+ AQ+AVLIE L+ LGA+VRW ACNIYSTQN VAAALAE+GIPI++W+G+TE++FWW +D+ I        +LILDDGGD T  +LK  P+     +GIVEES+TG+HRLY + K   L  PA+N+N+SVTK+KFD++Y C+++++D+LKR+TD    GK V++CGYG VGKGC Q+LKG G  V V E+DPIC++QA ++GFRV+ ++  +   D+VVT TG  +++      ++K+GCI+CNMGH  SEID++ L    + WER+R  VD +  P  + IIL+A+GR+ NL+CST+ S V+SV S+ Q LALIEL++A  GRYK+++YL+PKK DE VA  HL+ F A L ELTD Q+K++G+NK GP+K  +YR
Sbjct:   61 NSAGGTDFCVKSISKSAFGRREIEIAESEMPGIMTLRKRAKDEKPLKGANIVGCTHVNAQSAVLIETLVQLGATVRWAACNIYSTQNAVAAALAEAGIPIFAWRGETEEEFWWCLDRAI-YSDGWQPNLILDDGGDATHLMLKKYPDYFKAIRGIVEESVTGVHRLYMLSKGGKLTVPAINVNDSVTKNKFDTFYTCRDSILDSLKRTTDIMFGGKQVVICGYGDVGKGCAQSLKGQGCIVYVTEVDPICALQAAMDGFRVVRLNEVIRTVDVVVTATGNKNVITRDHMNRMKNGCILCNMGHSCSEIDVNGLHTPELTWERVRSQVDHIRWPDGRMIILLAEGRLVNLSCSTISSFVVSVASSTQALALIELFSAP-GRYKSDVYLLPKKMDEYVASLHLATFDAHLTELTDEQSKFMGLNKAGPFKANYYR 491          
BLAST of Adenosylhomocysteinase vs. Ensembl Fly
Match: Ahcy (gene:FBgn0014455 transcript:FBtr0074030)

HSP 1 Score: 355.525 bits (911), Expect = 5.225e-116
Identity = 194/428 (45.33%), Postives = 277/428 (64.72%), Query Frame = 3
Query:  600 FCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXA-QVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            + V+ I+ A  GR+ I IA+ EM G ++         PLKGA+I GC H+T QTAVLIE L+ LGA V+W +CNI+STQ+  AAA+A +G+P+Y+WKG+T++++ W I++ +       +++ILDDGGDLT  + +  P+ L N KG+ EE+ TG+H LY + K   L  PA+N+N+SVTKSKFD+ Y C+E+L+D +KR+TD  I+GK+  V GYG VGKGC Q LKG G +VIV E+DPI ++QA +EG+ V  M  A   A I VT TG   ++     +++ D  IVCN+GH   EID+D L         ++  VD   + S K IIL+A+GR+ NL C+      +   S   QVLA IEL+T +D +Y   ++++PK  DE VA  HL   G +L +LT++QA YLGV++ GP+K   YRY
Sbjct:    6 YKVADISLAEWGRKAIIIAENEMPGLMACRKKYGPSKPLKGARITGCLHMTVQTAVLIETLVELGAQVQWSSCNIFSTQDNAAAAIAATGVPVYAWKGETDEEYMWCIEQTLVFPDGQPLNMILDDGGDLTNLVHEKFPQYLKNIKGLSEETTTGVHNLYKMFKEGRLGVPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKVCCVAGYGDVGKGCAQALKGFGGRVIVTEVDPINALQAAMEGYEVTTMEEASKEASIFVTTTGCRDIITSVHLQQMPDDAIVCNIGHFDIEIDVDWLNANAKEKVNVKPQVDRYTMQSGKHIILLAEGRLVNLGCAHGHPSFVMSNSFTNQVLAQIELWTKSD-KYAVGVHVLPKILDEEVASLHLEKLGVKLTKLTEKQATYLGVSQTGPFKPDHYRY 432          
BLAST of Adenosylhomocysteinase vs. Ensembl Fly
Match: Ahcy (gene:FBgn0014455 transcript:FBtr0346181)

HSP 1 Score: 355.525 bits (911), Expect = 5.225e-116
Identity = 194/428 (45.33%), Postives = 277/428 (64.72%), Query Frame = 3
Query:  600 FCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXA-QVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            + V+ I+ A  GR+ I IA+ EM G ++         PLKGA+I GC H+T QTAVLIE L+ LGA V+W +CNI+STQ+  AAA+A +G+P+Y+WKG+T++++ W I++ +       +++ILDDGGDLT  + +  P+ L N KG+ EE+ TG+H LY + K   L  PA+N+N+SVTKSKFD+ Y C+E+L+D +KR+TD  I+GK+  V GYG VGKGC Q LKG G +VIV E+DPI ++QA +EG+ V  M  A   A I VT TG   ++     +++ D  IVCN+GH   EID+D L         ++  VD   + S K IIL+A+GR+ NL C+      +   S   QVLA IEL+T +D +Y   ++++PK  DE VA  HL   G +L +LT++QA YLGV++ GP+K   YRY
Sbjct:    6 YKVADISLAEWGRKAIIIAENEMPGLMACRKKYGPSKPLKGARITGCLHMTVQTAVLIETLVELGAQVQWSSCNIFSTQDNAAAAIAATGVPVYAWKGETDEEYMWCIEQTLVFPDGQPLNMILDDGGDLTNLVHEKFPQYLKNIKGLSEETTTGVHNLYKMFKEGRLGVPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKVCCVAGYGDVGKGCAQALKGFGGRVIVTEVDPINALQAAMEGYEVTTMEEASKEASIFVTTTGCRDIITSVHLQQMPDDAIVCNIGHFDIEIDVDWLNANAKEKVNVKPQVDRYTMQSGKHIILLAEGRLVNLGCAHGHPSFVMSNSFTNQVLAQIELWTKSD-KYAVGVHVLPKILDEEVASLHLEKLGVKLTKLTEKQATYLGVSQTGPFKPDHYRY 432          
BLAST of Adenosylhomocysteinase vs. Ensembl Zebrafish
Match: ahcyl1 (adenosylhomocysteinase-like 1 [Source:ZFIN;Acc:ZDB-GENE-021206-7])

HSP 1 Score: 502.286 bits (1292), Expect = 3.361e-171
Identity = 249/439 (56.72%), Postives = 327/439 (74.49%), Query Frame = 3
Query:  564 ETRKCNSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            E  + NS+G +DFCV  I +A  GRREIEIA+Q+M   +S+    + + PL GAK+ GCTHITAQTAVLIE L+ LGA  RW ACNIYSTQNEVAAALAESG+ +++WKG++EDDFWW ID+C+N++     ++ILDDGGDLT  + K  P      +GIVEES+TG+HRLY + K   L  PAMN+N+SVTK KFD+ Y C+E+++D LKR+TD    GK V+VCGYG VGKGCC  LK +GA V V EIDPIC++QAC++GFRV+ ++  +   D+V+TCTG  +++     +++K+GCIVCNMGH  +EID+ SL+   + WER+R  VD VI P  KR+IL+A+GR+ NL+CSTVPS V+S+T+T Q LALIELY A +GRYK ++YL+PKK DE VA  HL  F A L EL+D QAKY+G+NK GP+K  +YRY
Sbjct:  117 EKSQVNSKGSSDFCVKNIKQAEFGRREIEIAEQDMSALISLRKRAQGEKPLAGAKVAGCTHITAQTAVLIETLVALGAQCRWTACNIYSTQNEVAAALAESGVSVFAWKGESEDDFWWCIDRCVNMDGW-QANMILDDGGDLTHWVYKKYPSVFKKVRGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDVMFGGKQVVVCGYGEVGKGCCSALKALGAIVCVTEIDPICALQACMDGFRVVKLNEVVRQMDMVITCTGNKNVVTREHLDRMKNGCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRVILLAEGRLLNLSCSTVPSFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHLPNFDAHLTELSDEQAKYMGLNKNGPFKPNYYRY 554          
BLAST of Adenosylhomocysteinase vs. Ensembl Zebrafish
Match: ahcyl1 (adenosylhomocysteinase-like 1 [Source:ZFIN;Acc:ZDB-GENE-021206-7])

HSP 1 Score: 499.59 bits (1285), Expect = 5.248e-171
Identity = 249/439 (56.72%), Postives = 327/439 (74.49%), Query Frame = 3
Query:  564 ETRKCNSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            E  + NS+G +DFCV  I +A  GRREIEIA+Q+M   +S+    + + PL GAK+ GCTHITAQTAVLIE L+ LGA  RW ACNIYSTQNEVAAALAESG+ +++WKG++EDDFWW ID+C+N++     ++ILDDGGDLT  + K  P      +GIVEES+TG+HRLY + K   L  PAMN+N+SVTK KFD+ Y C+E+++D LKR+TD    GK V+VCGYG VGKGCC  LK +GA V V EIDPIC++QAC++GFRV+ ++  +   D+V+TCTG  +++     +++K+GCIVCNMGH  +EID+ SL+   + WER+R  VD VI P  KR+IL+A+GR+ NL+CSTVPS V+S+T+T Q LALIELY A +GRYK ++YL+PKK DE VA  HL  F A L EL+D QAKY+G+NK GP+K  +YRY
Sbjct:   63 EKSQVNSKGSSDFCVKNIKQAEFGRREIEIAEQDMSALISLRKRAQGEKPLAGAKVAGCTHITAQTAVLIETLVALGAQCRWTACNIYSTQNEVAAALAESGVSVFAWKGESEDDFWWCIDRCVNMDGW-QANMILDDGGDLTHWVYKKYPSVFKKVRGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDVMFGGKQVVVCGYGEVGKGCCSALKALGAIVCVTEIDPICALQACMDGFRVVKLNEVVRQMDMVITCTGNKNVVTREHLDRMKNGCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRVILLAEGRLLNLSCSTVPSFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHLPNFDAHLTELSDEQAKYMGLNKNGPFKPNYYRY 500          
BLAST of Adenosylhomocysteinase vs. Ensembl Zebrafish
Match: ahcyl2b (adenosylhomocysteinase like 2b [Source:ZFIN;Acc:ZDB-GENE-040115-5])

HSP 1 Score: 497.278 bits (1279), Expect = 8.586e-169
Identity = 249/434 (57.37%), Postives = 321/434 (73.96%), Query Frame = 3
Query:  579 NSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            NS+G  DFC+  I +A  GRREIEIA+QEM   +++    + + PL GAKI+GCTHITAQTAVL+E L  LGA  RW ACNIYSTQNEVAAALAE G  +++WKG++EDDFWW ID+C+NVE     ++ILDDGGDLT  + K  P      KGIVEES+TG+HRLY + K   L  PAMN+N+SVTK KFD+ Y C+E+++D LKR+TD    GK V+VCGYG VGKGC   LK MG+ V V EIDPIC++QAC++GFR++ +S  +   DIV+TCTG  +++     +++K+GCIVCNMGH  +EID+ SL+   + WER+R  VD VI P  KRI+L+A+GR+ NL+CSTVP+ V+S+T+T Q LALIELY A +GRYK ++YL+PKK DE VA  HL  F A L EL+D QAKYLG+NK GP+K  +YRY
Sbjct:  159 NSKGSGDFCIKNIKQADFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTAVLMETLSALGAQCRWAACNIYSTQNEVAAALAEGGFSVFAWKGESEDDFWWCIDRCVNVE-GWQPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDVMFGGKQVVVCGYGEVGKGCSAALKAMGSIVYVTEIDPICALQACMDGFRLVKLSEVIRQVDIVITCTGNKNVVVREYMDRMKNGCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIVLLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELSDEQAKYLGLNKNGPFKPNYYRY 591          
BLAST of Adenosylhomocysteinase vs. Ensembl Zebrafish
Match: ahcyl2a (adenosylhomocysteinase like 2a [Source:ZFIN;Acc:ZDB-GENE-070112-1522])

HSP 1 Score: 471.47 bits (1212), Expect = 4.454e-160
Identity = 238/458 (51.97%), Postives = 327/458 (71.40%), Query Frame = 3
Query:  507 NDDKDPKKKLTIREKFENPETRKCNSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            +D +DP+ +++ R+K      ++ NS+G  DFC+  I  A  GRR+IE+A+ EM   +++    + + PL GAKI+GCTH+TAQTAVL E L  LGA  RW ACNIYSTQNEVAAALAE   P+++WKG++EDDFWW ID+C+NVE     ++ILDDGGD+T  + K  P      KGIVEESITGIHRL+H+ K   L  PA+N+N+SVTK KFD+ Y C+E+++D+LK++ D    GK V+VCGYG VGKGC   LK MG+ V V EIDPIC++QAC++GFR+  +S  +   D+V+TCTG  +++     + +K+GC+VCNMG   +EI++ +L+   + W+ +R  VD +I P  KR+IL+A+GRV NL+ STVP  V+S+T+T Q LALIEL+ A +GRYK ++YL+PKK DE VA  HL  F A L ELTD QAKY+G++K GP+K  +YRY
Sbjct:   47 SDAEDPENEVSPRDK------QRMNSKGNKDFCIKNIKLADFGRRQIELAEDEMTALMALRKAAQGEKPLAGAKIVGCTHVTAQTAVLFETLSGLGAQCRWAACNIYSTQNEVAAALAERDFPVFAWKGESEDDFWWCIDRCVNVEGWE-PNMILDDGGDMTHWIYKKYPHIFKKVKGIVEESITGIHRLHHLSKAGKLCVPAINVNDSVTKQKFDNLYCCRESILDSLKKTADIMFGGKQVVVCGYGEVGKGCSAALKAMGSIVYVTEIDPICALQACMDGFRLTKLSDVVRQVDMVITCTGNKNVVVREHMDVMKNGCVVCNMGRSNTEINVSALKTPDLTWQHVRAQVDHIIWPDGKRMILLAEGRVLNLSSSTVPIYVLSITATTQALALIELFNAPEGRYKQDVYLLPKKLDEYVASLHLQTFDAHLTELTDDQAKYMGLSKNGPFKPNYYRY 497          
BLAST of Adenosylhomocysteinase vs. Ensembl Zebrafish
Match: ahcyl2a (adenosylhomocysteinase like 2a [Source:ZFIN;Acc:ZDB-GENE-070112-1522])

HSP 1 Score: 469.929 bits (1208), Expect = 1.941e-159
Identity = 238/457 (52.08%), Postives = 326/457 (71.33%), Query Frame = 3
Query:  507 NDDKDPKKKLTIREKFENPETRKCNSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYR 1877
            +D +DP+ +++ R+K      ++ NS+G  DFC+  I  A  GRR+IE+A+ EM   +++    + + PL GAKI+GCTH+TAQTAVL E L  LGA  RW ACNIYSTQNEVAAALAE   P+++WKG++EDDFWW ID+C+NVE     ++ILDDGGD+T  + K  P      KGIVEESITGIHRL+H+ K   L  PA+N+N+SVTK KFD+ Y C+E+++D+LK++ D    GK V+VCGYG VGKGC   LK MG+ V V EIDPIC++QAC++GFR+  +S  +   D+V+TCTG  +++     + +K+GC+VCNMG   +EI++ +L+   + W+ +R  VD +I P  KRIIL+A+GRV NL+ STVP  V+S+T+T Q LALIEL+ A +GRYK ++YL+PKK DE VA  HL  F A L ELTD QAKY+G++K GP+K  +YR
Sbjct:   47 SDAEDPEDEVSPRDK------QRMNSKGNKDFCIKNIKLADFGRRQIELAEDEMTALMALRKAAQGEKPLAGAKIVGCTHVTAQTAVLFETLSGLGAQCRWAACNIYSTQNEVAAALAERDFPVFAWKGESEDDFWWCIDRCVNVEGWE-PNMILDDGGDMTHWIYKKYPHIFKKVKGIVEESITGIHRLHHLSKAGKLCVPAINVNDSVTKQKFDNLYCCRESILDSLKKTADIMFGGKQVVVCGYGEVGKGCSAALKAMGSIVYVTEIDPICALQACMDGFRLTKLSDVVRQVDMVITCTGNKNVVVREHMDVMKNGCVVCNMGRSNTEINVSALKTPDLTWQHVRAQVDHIIWPDGKRIILLAEGRVLNLSSSTVPIYVLSITATTQALALIELFNAPEGRYKQDVYLLPKKLDEYVASLHLQTFDAHLTELTDDQAKYMGLSKNGPFKPNYYR 496          
BLAST of Adenosylhomocysteinase vs. Ensembl Xenopus
Match: ahcyl2 (adenosylhomocysteinase-like 2 [Source:NCBI gene;Acc:549163])

HSP 1 Score: 506.908 bits (1304), Expect = 1.876e-172
Identity = 253/434 (58.29%), Postives = 325/434 (74.88%), Query Frame = 3
Query:  579 NSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            NS+G +DFCV  I +A  GRREIEIA+QEM   +++    + + PL GAKI+GCTHITAQTAVLIE L  LGA  RW ACNIYST NEVAAALAESG+P++SWKG++EDDFWW ID+C+NVE     ++ILDDGGDLT  + K  P      KGIVEES+TG+HRLY + K   L  PAMN+N+SVTK KFD+ Y C+E+++D LKR+TD    GK V+VCGYG VGKGCC  LK MG+ V V EIDPIC++QAC++GFR++ ++  +   DIV+TCTG  +++     +++K+GCIVCNMGH  +EID+ SL+   + WER+R  VD VI P  KRI+L+A+GR+ NL+CSTVP+ V+S+T+T Q LALIELY A +GRYK ++YL+PKK DE VA  HL  F A L EL+D QAKYLG+NK GP+K  +YRY
Sbjct:  156 NSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTAVLIETLGALGAQCRWAACNIYSTLNEVAAALAESGVPVFSWKGESEDDFWWCIDRCVNVEGW-QPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMDGFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNGCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIVLLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELSDEQAKYLGLNKNGPFKPNYYRY 588          
BLAST of Adenosylhomocysteinase vs. Ensembl Xenopus
Match: ahcyl2 (adenosylhomocysteinase-like 2 [Source:NCBI gene;Acc:549163])

HSP 1 Score: 501.13 bits (1289), Expect = 2.582e-171
Identity = 252/433 (58.20%), Postives = 324/433 (74.83%), Query Frame = 3
Query:  579 NSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYR 1877
            NS+G +DFCV  I +A  GRREIEIA+QEM   +++    + + PL GAKI+GCTHITAQTAVLIE L  LGA  RW ACNIYST NEVAAALAESG+P++SWKG++EDDFWW ID+C+NVE     ++ILDDGGDLT  + K  P      KGIVEES+TG+HRLY + K   L  PAMN+N+SVTK KFD+ Y C+E+++D LKR+TD    GK V+VCGYG VGKGCC  LK MG+ V V EIDPIC++QAC++GFR++ ++  +   DIV+TCTG  +++     +++K+GCIVCNMGH  +EID+ SL+   + WER+R  VD VI P  KRI+L+A+GR+ NL+CSTVP+ V+S+T+T Q LALIELY A +GRYK ++YL+PKK DE VA  HL  F A L EL+D QAKYLG+NK GP+K  +YR
Sbjct:   72 NSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTAVLIETLGALGAQCRWAACNIYSTLNEVAAALAESGVPVFSWKGESEDDFWWCIDRCVNVEGW-QPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMDGFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNGCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIVLLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELSDEQAKYLGLNKNGPFKPNYYR 503          
BLAST of Adenosylhomocysteinase vs. Ensembl Xenopus
Match: ahcyl2 (adenosylhomocysteinase-like 2 [Source:NCBI gene;Acc:549163])

HSP 1 Score: 504.212 bits (1297), Expect = 4.500e-171
Identity = 252/433 (58.20%), Postives = 324/433 (74.83%), Query Frame = 3
Query:  579 NSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYR 1877
            NS+G +DFCV  I +A  GRREIEIA+QEM   +++    + + PL GAKI+GCTHITAQTAVLIE L  LGA  RW ACNIYST NEVAAALAESG+P++SWKG++EDDFWW ID+C+NVE     ++ILDDGGDLT  + K  P      KGIVEES+TG+HRLY + K   L  PAMN+N+SVTK KFD+ Y C+E+++D LKR+TD    GK V+VCGYG VGKGCC  LK MG+ V V EIDPIC++QAC++GFR++ ++  +   DIV+TCTG  +++     +++K+GCIVCNMGH  +EID+ SL+   + WER+R  VD VI P  KRI+L+A+GR+ NL+CSTVP+ V+S+T+T Q LALIELY A +GRYK ++YL+PKK DE VA  HL  F A L EL+D QAKYLG+NK GP+K  +YR
Sbjct:  171 NSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTAVLIETLGALGAQCRWAACNIYSTLNEVAAALAESGVPVFSWKGESEDDFWWCIDRCVNVEGW-QPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMDGFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNGCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIVLLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELSDEQAKYLGLNKNGPFKPNYYR 602          
BLAST of Adenosylhomocysteinase vs. Ensembl Xenopus
Match: ahcyl2 (adenosylhomocysteinase-like 2 [Source:NCBI gene;Acc:549163])

HSP 1 Score: 500.745 bits (1288), Expect = 7.429e-171
Identity = 252/433 (58.20%), Postives = 324/433 (74.83%), Query Frame = 3
Query:  579 NSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYR 1877
            NS+G +DFCV  I +A  GRREIEIA+QEM   +++    + + PL GAKI+GCTHITAQTAVLIE L  LGA  RW ACNIYST NEVAAALAESG+P++SWKG++EDDFWW ID+C+NVE     ++ILDDGGDLT  + K  P      KGIVEES+TG+HRLY + K   L  PAMN+N+SVTK KFD+ Y C+E+++D LKR+TD    GK V+VCGYG VGKGCC  LK MG+ V V EIDPIC++QAC++GFR++ ++  +   DIV+TCTG  +++     +++K+GCIVCNMGH  +EID+ SL+   + WER+R  VD VI P  KRI+L+A+GR+ NL+CSTVP+ V+S+T+T Q LALIELY A +GRYK ++YL+PKK DE VA  HL  F A L EL+D QAKYLG+NK GP+K  +YR
Sbjct:   92 NSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTAVLIETLGALGAQCRWAACNIYSTLNEVAAALAESGVPVFSWKGESEDDFWWCIDRCVNVE-GWQPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMDGFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNGCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIVLLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELSDEQAKYLGLNKNGPFKPNYYR 523          
BLAST of Adenosylhomocysteinase vs. Ensembl Xenopus
Match: ahcyl2 (adenosylhomocysteinase-like 2 [Source:NCBI gene;Acc:549163])

HSP 1 Score: 500.745 bits (1288), Expect = 7.463e-171
Identity = 252/433 (58.20%), Postives = 324/433 (74.83%), Query Frame = 3
Query:  579 NSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYR 1877
            NS+G +DFCV  I +A  GRREIEIA+QEM   +++    + + PL GAKI+GCTHITAQTAVLIE L  LGA  RW ACNIYST NEVAAALAESG+P++SWKG++EDDFWW ID+C+NVE     ++ILDDGGDLT  + K  P      KGIVEES+TG+HRLY + K   L  PAMN+N+SVTK KFD+ Y C+E+++D LKR+TD    GK V+VCGYG VGKGCC  LK MG+ V V EIDPIC++QAC++GFR++ ++  +   DIV+TCTG  +++     +++K+GCIVCNMGH  +EID+ SL+   + WER+R  VD VI P  KRI+L+A+GR+ NL+CSTVP+ V+S+T+T Q LALIELY A +GRYK ++YL+PKK DE VA  HL  F A L EL+D QAKYLG+NK GP+K  +YR
Sbjct:   96 NSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTAVLIETLGALGAQCRWAACNIYSTLNEVAAALAESGVPVFSWKGESEDDFWWCIDRCVNVE-GWQPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMDGFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNGCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIVLLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELSDEQAKYLGLNKNGPFKPNYYR 527          
BLAST of Adenosylhomocysteinase vs. Ensembl Mouse
Match: Ahcyl2 (S-adenosylhomocysteine hydrolase-like 2 [Source:MGI Symbol;Acc:MGI:1921590])

HSP 1 Score: 500.745 bits (1288), Expect = 2.597e-171
Identity = 251/434 (57.83%), Postives = 323/434 (74.42%), Query Frame = 3
Query:  579 NSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            NS+G +DFCV  I +A  GRREIEIA+QEM   +++    + + PL GAKI+GCTHITAQTAVL+E L  LGA  RW ACNIYST NEVAAALAESG P+++WKG++EDDFWW ID+C+NVE     ++ILDDGGDLT  + K  P      KGIVEES+TG+HRLY + K   L  PAMN+N+SVTK KFD+ Y C+E+++D LKR+TD    GK V+VCGYG VGKGCC  LK MG+ V V EIDPIC++QAC++GFR++ ++  +   DIV+TCTG  +++     +++K+ CIVCNMGH  +EID+ SL+   + WER+R  VD VI P  KRI+L+A+GR+ NL+CSTVP+ V+S+T+T Q LALIELY A +GRYK ++YL+PKK DE VA  HL  F A L ELTD QAKYLG+NK GP+K  +YRY
Sbjct:   76 NSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTAVLMETLGALGAQCRWAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVNVEGW-QPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMDGFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIVLLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELTDEQAKYLGLNKNGPFKPNYYRY 508          
BLAST of Adenosylhomocysteinase vs. Ensembl Mouse
Match: Ahcyl2 (S-adenosylhomocysteine hydrolase-like 2 [Source:MGI Symbol;Acc:MGI:1921590])

HSP 1 Score: 500.36 bits (1287), Expect = 3.518e-171
Identity = 251/434 (57.83%), Postives = 323/434 (74.42%), Query Frame = 3
Query:  579 NSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            NS+G +DFCV  I +A  GRREIEIA+QEM   +++    + + PL GAKI+GCTHITAQTAVL+E L  LGA  RW ACNIYST NEVAAALAESG P+++WKG++EDDFWW ID+C+NVE     ++ILDDGGDLT  + K  P      KGIVEES+TG+HRLY + K   L  PAMN+N+SVTK KFD+ Y C+E+++D LKR+TD    GK V+VCGYG VGKGCC  LK MG+ V V EIDPIC++QAC++GFR++ ++  +   DIV+TCTG  +++     +++K+ CIVCNMGH  +EID+ SL+   + WER+R  VD VI P  KRI+L+A+GR+ NL+CSTVP+ V+S+T+T Q LALIELY A +GRYK ++YL+PKK DE VA  HL  F A L ELTD QAKYLG+NK GP+K  +YRY
Sbjct:   76 NSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTAVLMETLGALGAQCRWAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVNVE-GWQPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMDGFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIVLLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELTDEQAKYLGLNKNGPFKPNYYRY 508          
BLAST of Adenosylhomocysteinase vs. Ensembl Mouse
Match: Ahcyl2 (S-adenosylhomocysteine hydrolase-like 2 [Source:MGI Symbol;Acc:MGI:1921590])

HSP 1 Score: 502.671 bits (1293), Expect = 1.438e-170
Identity = 251/434 (57.83%), Postives = 323/434 (74.42%), Query Frame = 3
Query:  579 NSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            NS+G +DFCV  I +A  GRREIEIA+QEM   +++    + + PL GAKI+GCTHITAQTAVL+E L  LGA  RW ACNIYST NEVAAALAESG P+++WKG++EDDFWW ID+C+NVE     ++ILDDGGDLT  + K  P      KGIVEES+TG+HRLY + K   L  PAMN+N+SVTK KFD+ Y C+E+++D LKR+TD    GK V+VCGYG VGKGCC  LK MG+ V V EIDPIC++QAC++GFR++ ++  +   DIV+TCTG  +++     +++K+ CIVCNMGH  +EID+ SL+   + WER+R  VD VI P  KRI+L+A+GR+ NL+CSTVP+ V+S+T+T Q LALIELY A +GRYK ++YL+PKK DE VA  HL  F A L ELTD QAKYLG+NK GP+K  +YRY
Sbjct:  181 NSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTAVLMETLGALGAQCRWAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVNVE-GWQPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMDGFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIVLLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELTDEQAKYLGLNKNGPFKPNYYRY 613          
BLAST of Adenosylhomocysteinase vs. Ensembl Mouse
Match: Ahcyl2 (S-adenosylhomocysteine hydrolase-like 2 [Source:MGI Symbol;Acc:MGI:1921590])

HSP 1 Score: 502.671 bits (1293), Expect = 1.729e-170
Identity = 251/434 (57.83%), Postives = 323/434 (74.42%), Query Frame = 3
Query:  579 NSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            NS+G +DFCV  I +A  GRREIEIA+QEM   +++    + + PL GAKI+GCTHITAQTAVL+E L  LGA  RW ACNIYST NEVAAALAESG P+++WKG++EDDFWW ID+C+NVE     ++ILDDGGDLT  + K  P      KGIVEES+TG+HRLY + K   L  PAMN+N+SVTK KFD+ Y C+E+++D LKR+TD    GK V+VCGYG VGKGCC  LK MG+ V V EIDPIC++QAC++GFR++ ++  +   DIV+TCTG  +++     +++K+ CIVCNMGH  +EID+ SL+   + WER+R  VD VI P  KRI+L+A+GR+ NL+CSTVP+ V+S+T+T Q LALIELY A +GRYK ++YL+PKK DE VA  HL  F A L ELTD QAKYLG+NK GP+K  +YRY
Sbjct:  180 NSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTAVLMETLGALGAQCRWAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVNVE-GWQPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMDGFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIVLLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELTDEQAKYLGLNKNGPFKPNYYRY 612          
BLAST of Adenosylhomocysteinase vs. Ensembl Mouse
Match: Ahcyl1 (S-adenosylhomocysteine hydrolase-like 1 [Source:MGI Symbol;Acc:MGI:2385184])

HSP 1 Score: 473.396 bits (1217), Expect = 2.759e-160
Identity = 246/439 (56.04%), Postives = 327/439 (74.49%), Query Frame = 3
Query:  564 ETRKCNSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            E ++ NS+G ++FCV  I +A  GRREIEIA+Q+M   +S+    + + PL GAKI+GCTHITAQTAVLIE L  LGA  RW ACNIYSTQNEVAAALAE+G+ +++WKG++EDDFWW ID+C+N++     ++ILDDGGDLT  + K  P      +GIVEES+TG+HRLY + K   L  PAMN+N+SVTK KFD+ Y C+E+++D LKR+TD    GK V+VCGYG VGKGCC  LK +GA V + EIDPIC++QAC++GFRV+ ++  +   D+V+TCTG  +++     +++K+ CIVCNMGH  +EID+ SL+   + WER+R  VD VI P  KR++L+A+GR+ NL+CSTVP+ V+S+T+T Q LALIELY A +GRYK ++YL+PKK DE VA  HL  F A L ELTD QAKYLG+NK GP+K  +YRY
Sbjct:   93 EKQQTNSKGSSNFCVKNIKQAEFGRREIEIAEQDMSALISLRKRAQGEKPLAGAKIVGCTHITAQTAVLIETLCALGAQCRWSACNIYSTQNEVAAALAEAGVAVFAWKGESEDDFWWCIDRCVNMD-GWQANMILDDGGDLTHWVYKKYPNVFKKIRGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDVMFGGKQVVVCGYGEVGKGCCAALKALGAIVYITEIDPICALQACMDGFRVVKLNEVIRQVDVVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVTSLRTPELTWERVRSQVDHVIWPDGKRVVLLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHLPSFDAHLTELTDDQAKYLGLNKNGPFKPNYYRY 530          
BLAST of Adenosylhomocysteinase vs. UniProt/SwissProt
Match: sp|Q96HN2|SAHH3_HUMAN (Adenosylhomocysteinase 3 OS=Homo sapiens OX=9606 GN=AHCYL2 PE=1 SV=1)

HSP 1 Score: 503.442 bits (1295), Expect = 5.608e-170
Identity = 251/434 (57.83%), Postives = 323/434 (74.42%), Query Frame = 3
Query:  579 NSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            NS+G +DFCV  I +A  GRREIEIA+QEM   +++    + + PL GAKI+GCTHITAQTAVL+E L  LGA  RW ACNIYST NEVAAALAESG P+++WKG++EDDFWW ID+C+NVE     ++ILDDGGDLT  + K  P      KGIVEES+TG+HRLY + K   L  PAMN+N+SVTK KFD+ Y C+E+++D LKR+TD    GK V+VCGYG VGKGCC  LK MG+ V V EIDPIC++QAC++GFR++ ++  +   DIV+TCTG  +++     +++K+ CIVCNMGH  +EID+ SL+   + WER+R  VD VI P  KRI+L+A+GR+ NL+CSTVP+ V+S+T+T Q LALIELY A +GRYK ++YL+PKK DE VA  HL  F A L ELTD QAKYLG+NK GP+K  +YRY
Sbjct:  179 NSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTAVLMETLGALGAQCRWAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVNVE-GWQPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMDGFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIVLLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELTDEQAKYLGLNKNGPFKPNYYRY 611          
BLAST of Adenosylhomocysteinase vs. UniProt/SwissProt
Match: sp|Q9VZX9|SAHH2_DROME (Adenosylhomocysteinase-like 1 OS=Drosophila melanogaster OX=7227 GN=AhcyL1 PE=1 SV=1)

HSP 1 Score: 499.975 bits (1286), Expect = 5.648e-170
Identity = 254/460 (55.22%), Postives = 332/460 (72.17%), Query Frame = 3
Query:  504 ENDDKDPKKKLTIREKFENPETRKCNSRGFNDFCVSKIN-EASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            + DD  P++K+            + NS+G +DFCV  I  + + GRREIEIA+QEM G +++     +D PLK AKI+GCTHI AQTAVLIE L+ LGASVRW ACNIYSTQNEVAAALAESGIPI++W+G+TE+DFWW ID+C+N E     ++ILDDGGD T  +LK  P      KGIVEES+TG+HRLY + K   L  PAMN+N+SVTK+KFD+ Y CKE+++D+LKRSTD    GK V+VCGYG VGKGC Q LKG G  V + EIDPIC++QA ++GFRV+ ++  +   DIVVT TG  +++     +K+K GCIVCNMGH  +EID++ L+   + WE++R  VD +I P  K IIL+A+GR+ NL+CS++PS  +S+TS  Q LALIEL+ A  GRYK+++YL+PKK DE VA  HL  F A L EL+D QAKY+G+NK GP+K  +YRY
Sbjct:   75 DGDDVPPREKV------------QKNSKGSSDFCVRNIGAQHAFGRREIEIAEQEMPGIIALKKRAAEDKPLKDAKIVGCTHINAQTAVLIETLVELGASVRWAACNIYSTQNEVAAALAESGIPIFAWRGETEEDFWWCIDRCVNAENW-QPNMILDDGGDATHLMLKKYPTMFKLVKGIVEESVTGVHRLYQLSKAGKLTVPAMNVNDSVTKTKFDNLYSCKESILDSLKRSTDVMFGGKQVVVCGYGDVGKGCAQALKGQGCIVYITEIDPICALQASMDGFRVVKLNEVIRNVDIVVTATGNKNVVVREHMDKMKSGCIVCNMGHSNTEIDVNGLRTPDLTWEKVRSQVDHIIWPEGKYIILLAEGRLVNLSCSSIPSFAVSITSATQALALIELFNAPPGRYKSDVYLLPKKMDEYVASLHLPTFDAHLTELSDEQAKYMGLNKAGPFKPNYYRY 521          
BLAST of Adenosylhomocysteinase vs. UniProt/SwissProt
Match: sp|A6QLP2|SAHH3_BOVIN (Adenosylhomocysteinase 3 OS=Bos taurus OX=9913 GN=AHCYL2 PE=1 SV=1)

HSP 1 Score: 503.442 bits (1295), Expect = 6.050e-170
Identity = 252/434 (58.06%), Postives = 323/434 (74.42%), Query Frame = 3
Query:  579 NSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            NS+G +DFCV  I +A  GRREIEIA+QEM   +++    + + PL GAKI+GCTHITAQTAVL+E L  LGA  RW ACNIYST NEVAAALAESG P+++WKG++EDDFWW ID+C+NVE     ++ILDDGGDLT  + K  P      KGIVEES+TG+HRLY + K   L  PAMN+N+SVTK KFD+ Y C+E+++D LKR+TD    GK V+VCGYG VGKGCC  LK MG+ V V EIDPIC++QAC++GFR++ ++  +   DIV+TCTG  +++     +++K+ CIVCNMGH  +EID+ SL+   + WER+R  VD VI P  KRIIL+A+GR+ NL+CSTVP+ V+S+T+T Q LALIELY A +GRYK ++YL+PKK DE VA  HL  F A L ELTD QAKYLG+NK GP+K  +YRY
Sbjct:  179 NSKGNSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTAVLMETLGALGAQCRWAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVNVE-GWQPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMDGFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIILLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELTDEQAKYLGLNKNGPFKPNYYRY 611          
BLAST of Adenosylhomocysteinase vs. UniProt/SwissProt
Match: sp|Q68FL4|SAHH3_MOUSE (Putative adenosylhomocysteinase 3 OS=Mus musculus OX=10090 GN=Ahcyl2 PE=1 SV=1)

HSP 1 Score: 502.671 bits (1293), Expect = 1.006e-169
Identity = 251/434 (57.83%), Postives = 323/434 (74.42%), Query Frame = 3
Query:  579 NSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            NS+G +DFCV  I +A  GRREIEIA+QEM   +++    + + PL GAKI+GCTHITAQTAVL+E L  LGA  RW ACNIYST NEVAAALAESG P+++WKG++EDDFWW ID+C+NVE     ++ILDDGGDLT  + K  P      KGIVEES+TG+HRLY + K   L  PAMN+N+SVTK KFD+ Y C+E+++D LKR+TD    GK V+VCGYG VGKGCC  LK MG+ V V EIDPIC++QAC++GFR++ ++  +   DIV+TCTG  +++     +++K+ CIVCNMGH  +EID+ SL+   + WER+R  VD VI P  KRI+L+A+GR+ NL+CSTVP+ V+S+T+T Q LALIELY A +GRYK ++YL+PKK DE VA  HL  F A L ELTD QAKYLG+NK GP+K  +YRY
Sbjct:  181 NSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTAVLMETLGALGAQCRWAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVNVE-GWQPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMDGFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIVLLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELTDEQAKYLGLNKNGPFKPNYYRY 613          
BLAST of Adenosylhomocysteinase vs. UniProt/SwissProt
Match: sp|Q5R889|SAHH3_PONAB (Putative adenosylhomocysteinase 3 OS=Pongo abelii OX=9601 GN=AHCYL2 PE=2 SV=1)

HSP 1 Score: 498.819 bits (1283), Expect = 1.322e-169
Identity = 250/434 (57.60%), Postives = 323/434 (74.42%), Query Frame = 3
Query:  579 NSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            NS+G +DFCV  I +A  GRREIEIA+QEM   +++    + + PL GAKI+GCTHITAQTAVL+E L  LGA  RW ACNIYST NEVAAALAESG P+++WKG++EDDFWW ID+C+NVE     ++ILDDGGDLT  + K  P      KGIVEES+TG+HRLY + K   L  PAMN+N+SVTK KFD+ Y C+E+++D LKR+TD    GK V+VCGYG VGKGCC  LK MG+ V V EIDPIC++QAC++GFR++ ++  +   DIV+TCTG  +++     +++K+ CIVCN+GH  +EID+ SL+   + WER+R  VD VI P  KRI+L+A+GR+ NL+CSTVP+ V+S+T+T Q LALIELY A +GRYK ++YL+PKK DE VA  HL  F A L ELTD QAKYLG+NK GP+K  +YRY
Sbjct:   76 NSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTAVLMETLGALGAQCRWAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVNVE-GWQPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMDGFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNIGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIVLLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELTDEQAKYLGLNKNGPFKPNYYRY 508          
BLAST of Adenosylhomocysteinase vs. TrEMBL
Match: A0A4E0R6V7 (Adenosylhomocysteinase OS=Fasciola hepatica OX=6192 GN=D915_007723 PE=3 SV=1)

HSP 1 Score: 560.451 bits (1443), Expect = 0.000e+0
Identity = 286/499 (57.31%), Postives = 382/499 (76.55%), Query Frame = 3
Query:  387 KDKRRASVIISKKVWNXXXXXXXXXXXXXXXXXXXXXXXENDDKD-PKKKLTIREKFENPETRKCNSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            +DKRR+SV I ++V+  +  SSLS+ S+  + S    +S +DD +  +++   RE++  P +R  NSRGFNDFCV KI +AS GRREIEIA+QEM G +++    +DD PLKGAK+LGCTH+TA TAVL+E +++LGA VRWCACNIYSTQNEVAAALAE+G  +Y+WKG++E+DFWW ID+CIN    S  +++LDDGGDLT +L K  PE +   +GIVEES+TG+HRLY  +K  +L  PAMN+++S+ KSKFD+YYLCKE++VDALKR+TD  ISGK ++VCGYG VGKG C  LKG+GA V V E DPIC++QAC++G+RV+ +   +   D+V+TCTG  S++  A  +++K+GC+VCNMGH  +EID+ SLQ   + WER+R  VD VI    KRI+LIA+GR+ANL+CSTVPS+V+SV+++ Q LALIELY A  GRYKN++YL+PKK DE VA  HL +F A+L ELTD QAKYLGV+K GP+K + YRY
Sbjct:   54 RDKRRSSVKIDRRVYMQQHTSSLSSISTDRDDSSYTGSSSDDDGEGSQQRENPRERWLKPSSRATNSRGFNDFCVQKIRQASFGRREIEIAEQEMPGLVALRKRAKDDQPLKGAKVLGCTHVTAHTAVLLETMVSLGAQVRWCACNIYSTQNEVAAALAENGYSVYAWKGESEEDFWWCIDRCINGTGWS-PNVVLDDGGDLTHKLHKDYPELIVGVRGIVEESVTGVHRLYQYVKAGTLAAPAMNVSDSINKSKFDNYYLCKESIVDALKRTTDMMISGKTIVVCGYGEVGKGVCHALKGIGAFVCVTETDPICALQACMDGYRVVKIDEVIRTVDVVITCTGNKSVVTRAHMDRMKNGCVVCNMGHSNTEIDVRSLQTPDLTWERVRSQVDHVIWMDGKRIVLIAEGRLANLSCSTVPSIVVSVSASTQALALIELYNAPTGRYKNDVYLLPKKMDEYVATLHLPLFNARLTELTDEQAKYLGVSKSGPFKPSNYRY 551          
BLAST of Adenosylhomocysteinase vs. TrEMBL
Match: A0A504Z1E6 (Adenosylhomocysteinase OS=Fasciola gigantica OX=46835 GN=FGIG_06786 PE=3 SV=1)

HSP 1 Score: 559.681 bits (1441), Expect = 0.000e+0
Identity = 286/499 (57.31%), Postives = 382/499 (76.55%), Query Frame = 3
Query:  387 KDKRRASVIISKKVWNXXXXXXXXXXXXXXXXXXXXXXXENDDKD-PKKKLTIREKFENPETRKCNSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            +DKRR+SV I ++V+  +  SSLS+ S+  + S    +S +DD +  +++   RE++  P +R  NSRGFNDFCV KI +AS GRREIEIA+QEM G +++    +DD PLKGAK+LGCTH+TA TAVL+E +++LGA VRWCACNIYSTQNEVAAALAE+G  +Y+WKG++E+DFWW ID+CIN    S  +++LDDGGDLT +L K  PE +   +GIVEES+TG+HRLY  +K  +L  PAMN+++S+ KSKFD+YYLCKE++VDALKR+TD  ISGK ++VCGYG VGKG C  LKG+GA V V E DPIC++QAC++G+RV+ +   +   D+V+TCTG  S++  A  +++K+GC+VCNMGH  +EID+ SLQ   + WER+R  VD VI    KRI+LIA+GR+ANL+CSTVPS+V+SV+++ Q LALIELY A  GRYKN++YL+PKK DE VA  HL +F A+L ELTD QAKYLGV+K GP+K + YRY
Sbjct:   54 RDKRRSSVKIDRRVYMQQYTSSLSSISTDRDDSSYTGSSSDDDGEGSQQRENPRERWLKPSSRATNSRGFNDFCVQKIRQASFGRREIEIAEQEMPGLVALRKRAKDDQPLKGAKVLGCTHVTAHTAVLLETMVSLGAQVRWCACNIYSTQNEVAAALAENGYSVYAWKGESEEDFWWCIDRCINGTGWS-PNIVLDDGGDLTHKLHKDYPELIVGVRGIVEESVTGVHRLYQYVKAGTLAAPAMNVSDSINKSKFDNYYLCKESIVDALKRTTDMMISGKTIVVCGYGEVGKGVCHALKGIGAFVCVTETDPICALQACMDGYRVVKIDEVIRTVDVVITCTGNKSVVTRAHMDRMKNGCVVCNMGHSNTEIDVRSLQTPDLTWERVRSQVDHVIWMDGKRIVLIAEGRLANLSCSTVPSIVVSVSASTQALALIELYNAPTGRYKNDVYLLPKKMDEYVATLHLPLFNARLTELTDEQAKYLGVSKSGPFKPSNYRY 551          
BLAST of Adenosylhomocysteinase vs. TrEMBL
Match: A0A1S8X158 (Adenosylhomocysteinase (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_03697 PE=3 SV=1)

HSP 1 Score: 557.755 bits (1436), Expect = 0.000e+0
Identity = 287/498 (57.63%), Postives = 377/498 (75.70%), Query Frame = 3
Query:  387 KDKRRASVIISKKVWNXXXXXXXXXXXXXXXXXXXXXXXENDDKDPKKKLTIREKFENPETRKCNSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            +DKRR+SV I ++V+  +  +SLS+ S+  + S    +S  D++D  ++   RE++  P +R  NSRGFNDFCV KI  AS G REIEIA+QEM   +++    +DD PLKGA+ILGCTH+TA TAVL+E L+ LGA VRWCACNIYSTQNEVAAALAE G  IY+WKG++E+DFWW ID+CI    +   +++LDDGGDLT RL K  P+ L+  +GIVEES+TG+HRLY  +K  +L+ PAMN+++S+ KSKFD+YYLCKE++VDALKR+TD  ISGK VLVCGYG VGKG C  LKG+GA V + EIDPIC++QA ++G+RV+ +   +   D+V+TCTG  S++  A  + +K+GC+VCNMGH  +EID+ SLQ   + WER+R  VD VI    KRI+LIA+GR+ANL+CSTVPS+VISV+++ Q LALIELY A  GRYKN++YL+PKK DE VA  HLS+F A+L ELTD QAKYLGVNK GP+K + YR+
Sbjct:  146 RDKRRSSVKIDRRVYVQQHTASLSSISTEQDDSSYTGSSSEDEEDSPQRENPRERWLKPASRPTNSRGFNDFCVQKIRRASFGLREIEIAEQEMPALVNLRKRAKDDQPLKGAQILGCTHVTAHTAVLLETLVVLGAQVRWCACNIYSTQNEVAAALAEKGYAIYAWKGESEEDFWWCIDQCIK-HDSWLPNVVLDDGGDLTHRLHKEYPDLLSGVRGIVEESVTGVHRLYQYVKAGTLRVPAMNVSDSINKSKFDNYYLCKESVVDALKRTTDMMISGKTVLVCGYGEVGKGVCHALKGIGAFVCITEIDPICALQASMDGYRVVKIEEVIRSVDVVITCTGNKSVVTRAHMDSMKNGCVVCNMGHSNTEIDVRSLQTPDLTWERVRSQVDHVIWMDGKRIVLIAEGRLANLSCSTVPSIVISVSASTQALALIELYNAPPGRYKNDVYLLPKKMDEYVATLHLSLFNARLTELTDDQAKYLGVNKTGPFKPSNYRH 642          

HSP 2 Score: 62.3882 bits (150), Expect = 3.598e-6
Identity = 29/49 (59.18%), Postives = 35/49 (71.43%), Query Frame = 3
Query: 1731 IYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYR 1877
            I+   +  DE VA  HLS+F A+L ELTD QAKYLGVNK GP+K + YR
Sbjct:  661 IFYRKRWVDEYVATLHLSLFNARLTELTDDQAKYLGVNKTGPFKPSNYR 709          
BLAST of Adenosylhomocysteinase vs. TrEMBL
Match: H2KNW6 (Adenosylhomocysteinase OS=Clonorchis sinensis OX=79923 GN=CLF_100885 PE=3 SV=1)

HSP 1 Score: 557.37 bits (1435), Expect = 0.000e+0
Identity = 287/497 (57.75%), Postives = 376/497 (75.65%), Query Frame = 3
Query:  387 KDKRRASVIISKKVWNXXXXXXXXXXXXXXXXXXXXXXXENDDKDPKKKLTIREKFENPETRKCNSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYR 1877
            +DKRR+SV I ++V+  +  +SLS+ S+  + S    +S  D++D  ++   RE++  P +R  NSRGFNDFCV KI  AS G REIEIA+QEM   +++    +DD PLKGA+ILGCTH+TA TAVL+E L+ LGA VRWCACNIYSTQNEVAAALAE G  IY+WKG++E+DFWW ID+CI    +   +++LDDGGDLT RL K  P+ L+  +GIVEES+TG+HRLY  +K  +L+ PAMN+++S+ KSKFD+YYLCKE++VDALKR+TD  ISGK VLVCGYG VGKG C  LKG+GA V + EIDPIC++QA ++G+RV+ +   +   D+V+TCTG  S++  A  + +K+GC+VCNMGH  +EID+ SLQ   + WER+R  VD VI    KRI+LIA+GR+ANL+CSTVPS+VISV+++ Q LALIELY A  GRYKN++YL+PKK DE VA  HLS+F A+L ELTD QAKYLGVNK GP+K + YR
Sbjct:   72 RDKRRSSVKIDRRVYVQQHTASLSSISTEQDDSSYTGSSSEDEEDSPQRENPRERWLKPASRPTNSRGFNDFCVQKIRRASFGLREIEIAEQEMPALVNLRKRAKDDQPLKGAQILGCTHVTAHTAVLLETLVVLGAQVRWCACNIYSTQNEVAAALAEKGYAIYAWKGESEEDFWWCIDQCIK-HDSWLPNVVLDDGGDLTHRLHKEYPDLLSGVRGIVEESVTGVHRLYQYVKAGTLRVPAMNVSDSINKSKFDNYYLCKESVVDALKRTTDMMISGKTVLVCGYGEVGKGVCHALKGIGAFVCITEIDPICALQASMDGYRVVKIEEVIRSVDVVITCTGNKSVVTRAHMDSMKNGCVVCNMGHSNTEIDVRSLQTPDLTWERVRSQVDHVIWMDGKRIVLIAEGRLANLSCSTVPSIVISVSASTQALALIELYNAPPGRYKNDVYLLPKKMDEYVATLHLSLFNARLTELTDDQAKYLGVNKTGPFKPSNYR 567          
BLAST of Adenosylhomocysteinase vs. TrEMBL
Match: A0A419PTC6 (Adenosylhomocysteinase OS=Clonorchis sinensis OX=79923 GN=AHCYL2 PE=3 SV=1)

HSP 1 Score: 556.599 bits (1433), Expect = 0.000e+0
Identity = 287/498 (57.63%), Postives = 377/498 (75.70%), Query Frame = 3
Query:  387 KDKRRASVIISKKVWNXXXXXXXXXXXXXXXXXXXXXXXENDDKDPKKKLTIREKFENPETRKCNSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            +DKRR+SV I ++V+  +  +SLS+ S+  + S    +S  D++D  ++   RE++  P +R  NSRGFNDFCV KI  AS G REIEIA+QEM   +++    +DD PLKGA+ILGCTH+TA TAVL+E L+ LGA VRWCACNIYSTQNEVAAALAE G  IY+WKG++E+DFWW ID+CI    +   +++LDDGGDLT RL K  P+ L+  +GIVEES+TG+HRLY  +K  +L+ PAMN+++S+ KSKFD+YYLCKE++VDALKR+TD  ISGK VLVCGYG VGKG C  LKG+GA V + EIDPIC++QA ++G+RV+ +   +   D+V+TCTG  S++  A  + +K+GC+VCNMGH  +EID+ SLQ   + WER+R  VD VI    KRI+LIA+GR+ANL+CSTVPS+VISV+++ Q LALIELY A  GRYKN++YL+PKK DE VA  HLS+F A+L ELTD QAKYLGVNK GP+K + YR+
Sbjct:   72 RDKRRSSVKIDRRVYVQQHTASLSSISTEQDDSSYTGSSSEDEEDSPQRENPRERWLKPASRPTNSRGFNDFCVQKIRRASFGLREIEIAEQEMPALVNLRKRAKDDQPLKGAQILGCTHVTAHTAVLLETLVVLGAQVRWCACNIYSTQNEVAAALAEKGYAIYAWKGESEEDFWWCIDQCIK-HDSWLPNVVLDDGGDLTHRLHKEYPDLLSGVRGIVEESVTGVHRLYQYVKAGTLRVPAMNVSDSINKSKFDNYYLCKESVVDALKRTTDMMISGKTVLVCGYGEVGKGVCHALKGIGAFVCITEIDPICALQASMDGYRVVKIEEVIRSVDVVITCTGNKSVVTRAHMDSMKNGCVVCNMGHSNTEIDVRSLQTPDLTWERVRSQVDHVIWMDGKRIVLIAEGRLANLSCSTVPSIVISVSASTQALALIELYNAPPGRYKNDVYLLPKKMDEYVATLHLSLFNARLTELTDDQAKYLGVNKTGPFKPSNYRH 568          
BLAST of Adenosylhomocysteinase vs. Ensembl Cavefish
Match: ahcyl2b (adenosylhomocysteinase like 2 [Source:NCBI gene;Acc:103046793])

HSP 1 Score: 499.204 bits (1284), Expect = 1.882e-169
Identity = 247/434 (56.91%), Postives = 322/434 (74.19%), Query Frame = 3
Query:  579 NSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            NS+G  DFC+  I +A  GRREIEIA+QEM   +++    + + PL GAK++GCTHITAQTAVL+E L  LGA  RW ACNIYSTQNEVAAALAE G  +++WKG++EDDFWW ID+C+N+E     ++ILDDGGDLT  + K  P      KGIVEES+TG+HRLY + K   L  PAMN+N+SVTK KFD+ Y C+E+++D LKR+TD    GK V+VCGYG VGKGCC  LK MG+ V V EIDPIC++QAC++GFR++ ++  +   DIV+TCTG  +++     +++K+GCIVCNMGH  +EID+ SL+   + WER+R  VD VI P  KRI+L+A+GR+ NL+CSTVP+ V+S+T+T Q LALIELY A +GRYK ++YL+PKK DE VA  HL  F A L EL+D QAKYLG+NK GP+K  +YRY
Sbjct:  164 NSKGNADFCIKNIKQADFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKVVGCTHITAQTAVLMETLSALGAQCRWAACNIYSTQNEVAAALAEGGFSVFAWKGESEDDFWWCIDRCVNLEGW-QPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDVMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMDGFRLVKLNEVIRQVDIVITCTGNKNVVMRESLDRMKNGCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIVLLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELSDEQAKYLGLNKNGPFKPNYYRY 596          
BLAST of Adenosylhomocysteinase vs. Ensembl Cavefish
Match: ahcyl1 (adenosylhomocysteinase like 1 [Source:NCBI gene;Acc:103047407])

HSP 1 Score: 496.893 bits (1278), Expect = 3.172e-169
Identity = 246/439 (56.04%), Postives = 325/439 (74.03%), Query Frame = 3
Query:  564 ETRKCNSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            E  + NS G +DFCV  I +A  GRREIEIA+Q+M   +S+    + + PL GAK++GCTHITAQTAVLIE L+ LGA  RW ACNIYSTQNEVAAALAE G+ +++WKG++EDDFWW ID+C+N E     ++ILDDGGDLT  + K  P      +GIVEES+TG+HRLY + K   L  PAMN+N+SVTK KFD+ Y C+E+++D LKR+TD    GK V+VCGYG VGKGCC  LK +GA V V EIDPIC++QAC++GF+V+ ++  +   D+V+TCTG  +++     +++K+GCIVCNMGH  +EID+ SL+   + WER+R  VD +I P  KR+IL+A+GR+ NL+CSTVPS V+S+T+T Q LALIELY A +GRY+ ++YL+PKK DE VA  HL  F A L EL+D QAKY+G+NK GP+K  +YRY
Sbjct:  116 EKTQVNSTGSSDFCVKNIKQAEFGRREIEIAEQDMSALISLRKRAQGEKPLAGAKVVGCTHITAQTAVLIETLVALGAQCRWTACNIYSTQNEVAAALAEIGVAVFAWKGESEDDFWWCIDRCVNTEGW-QANMILDDGGDLTHWVYKKYPSVFKKVQGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDVMFGGKQVVVCGYGEVGKGCCSALKALGAIVCVTEIDPICALQACMDGFKVVKLNEVIRQMDMVITCTGNKNVVTREQLDRMKNGCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHIIWPDGKRVILLAEGRLLNLSCSTVPSFVLSITATTQALALIELYNAPEGRYRQDVYLLPKKMDEYVASLHLPNFDAHLTELSDEQAKYMGLNKNGPFKPNYYRY 553          
BLAST of Adenosylhomocysteinase vs. Ensembl Cavefish
Match: ahcyl2a (adenosylhomocysteinase like 2a [Source:ZFIN;Acc:ZDB-GENE-070112-1522])

HSP 1 Score: 486.108 bits (1250), Expect = 6.327e-166
Identity = 243/433 (56.12%), Postives = 320/433 (73.90%), Query Frame = 3
Query:  579 NSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYR 1877
            NS+G NDFC+  I +A+ GRREIE+A+QEM   + +    + + PL GAKI+GCTHITA TAVLIE L  LGA  RW ACNIYS QNEVAAALAE G+P+++WKG++E+D++W IDKC+N E     +LILDDGGDLT  + +  P+   N KGIVEES++G+HRLY + K   L  PA+N+NESV K KFD++Y CKE+++D LKR+TD T+SGK V+VCGYG VGKGCC  LKG+GA V V EIDPIC++QAC+EG ++  ++  + + DIV+TCTG  +++     E +K GCIVCNMGH  +EID+ SL    + W RIR  VD ++ P  K+I+L+A+GR+ NL+CSTVP  V+ +T+T Q LALIEL+ A +GRYK +IY+ PKK DE VA  HL  + A L ELTD QAKY+GVNK GP+K ++YR
Sbjct:   63 NSKGSNDFCIRSIRQAAFGRREIEMAEQEMPALMMLRKATQGEKPLAGAKIVGCTHITAHTAVLIETLSLLGAQCRWTACNIYSIQNEVAAALAEGGVPVFAWKGESEEDYFWCIDKCVNAE-GWEPNLILDDGGDLTHWIYRKYPQLFENIKGIVEESVSGVHRLYQLYKAGKLCSPAINVNESVIKQKFDNFYCCKESVLDGLKRTTDVTLSGKQVVVCGYGEVGKGCCAALKGLGAIVYVTEIDPICALQACMEGLQLARLNDVIKMVDIVITCTGNKNVVTRELLESMKSGCIVCNMGHSNTEIDVASLLTPDLTWRRIRKHVDHIVWPDGKQIVLLAKGRLLNLSCSTVPVYVLCITATTQALALIELFNAPEGRYKQDIYMFPKKLDEYVAVLHLQSYDAHLTELTDEQAKYMGVNKSGPFKPSYYR 494          
BLAST of Adenosylhomocysteinase vs. Ensembl Cavefish
Match: ahcy (adenosylhomocysteinase [Source:NCBI gene;Acc:103042971])

HSP 1 Score: 369.392 bits (947), Expect = 3.050e-121
Identity = 194/428 (45.33%), Postives = 284/428 (66.36%), Query Frame = 3
Query:  600 FCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXA-QVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            F V+ I+ A  GR+ I+IA+ EM G + +  +     PLKGA+I GC H+T QTAVLIE L  LGA V+W +CNI+STQ+  AAA+A++G+P+Y+WKG+T++++ W I++ +  +    +++ILDDGGDLT  + +  P+ L+  KG+ EE+ TG+H LY ++K   L+ PA+N+N+SVTKSKFD+ Y C+E+L+D +KR+TD  I+GK+ +V GYG VGKGC Q L+G GA+VIV EIDPI ++QA +EG+ V  M  A    +I VT TG   ++    FE++KD  IVCN+GH   EID+  + +       ++  VD   + S + +I++A+GR+ NL C+      +   S   QVLA IEL+T T  +Y   +Y +PKK DE VA +HL   G +L +LT+ QAKYLG+   GP+K   YRY
Sbjct:    7 FKVADISLAEWGRKAIDIAENEMPGLMKMREVYGPTKPLKGARIAGCLHMTLQTAVLIETLTALGAEVQWSSCNIFSTQDHAAAAIAKTGVPVYAWKGETDEEYVWCIEQTLYFKDGQPLNMILDDGGDLTNLVHQKYPKLLSGIKGVSEETTTGVHNLYKMLKKGDLKIPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKVAVVAGYGDVGKGCVQALRGFGARVIVTEIDPINALQAAMEGYEVTTMDEACKEGNIFVTTTGCKDIILGRHFEQMKDDSIVCNIGHFDCEIDMKWMNENAAERINVKPQVDRYRMKSGRHVIVLAEGRLVNLGCAMGHPSFVMSNSFTNQVLAQIELWTNTS-KYPLGVYFLPKKLDEEVAAAHLDKLGVKLTKLTENQAKYLGLPCEGPFKPDHYRY 433          
BLAST of Adenosylhomocysteinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006905.1 (pep scaffold:Pmarinus_7.0:GL477645:46731:62118:1 gene:ENSPMAG00000006207.1 transcript:ENSPMAT00000006905.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 396.741 bits (1018), Expect = 1.916e-132
Identity = 213/433 (49.19%), Postives = 287/433 (66.28%), Query Frame = 3
Query:  588 GFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIA--QGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            G +D+CV   + A LGRREI IAQQ++   +++      D PL GA+I+GCTH+TA TAVLIE L  LGA  RW ACNIYST N+VAAALAE+G  +++WKG++E+DFWW I +C+        ++ILDDGGDLT  + +  P  L     ++      + RLY + K+  L  PA+N+N+SVTK KFD+ Y C+ET++D LKR+ D  + G   ++CGYG VGKGCC  LKG+ + V V E+DPIC++QA      ++    AL        C G   ++     E+LK G IVCNMGH  +EID+ SL    + WER+R  VD +I P  KRI L+A  QGR+ NL+C++VP+ V+SVT+T Q LALIELY A +GRYK+++YL+PKK DE VA  HL  FGA L EL+D QA+YLG+ K GP+K  +YRY
Sbjct:   15 GDDDYCVKDASRAELGRREISIAQQDIPALMALRKRAARDRPLAGARIVGCTHVTAHTAVLIETLCDLGAECRWAACNIYSTHNDVAAALAEAGCSVFAWKGESEEDFWWCIGRCV-YSDGWKPNMILDDGGDLTHWMYRKHPNIL----AVLGAVRRAVRRLYQLSKSGKLTIPAINVNDSVTKHKFDTLYTCRETVLDGLKRTCDVMLGGMQAVICGYGEVGKGCCAALKGLCSIVYVTEVDPICALQAWSSQASLIRCGGALRWCRW-CRCAGNKHVVRREHMERLKGGAIVCNMGHSNTEIDVASLHTTELTWERVRPQVDHIIWPDGKRITLLAEEQGRLLNLSCASVPTCVLSVTATTQALALIELYNAPEGRYKHDVYLLPKKLDEYVASLHLPSFGASLTELSDEQARYLGIKKDGPFKANYYRY 441          
BLAST of Adenosylhomocysteinase vs. Ensembl Sea Lamprey
Match: ahcy (adenosylhomocysteinase [Source:ZFIN;Acc:ZDB-GENE-031219-6])

HSP 1 Score: 328.946 bits (842), Expect = 3.158e-106
Identity = 180/425 (42.35%), Postives = 268/425 (63.06%), Query Frame = 3
Query:  609 SKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXA-QVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            + I+ A  GR+ ++IA+ EM G + +  +     PL GA+I GC H+T QTAVLIE L+ LG  V W +CNI+STQ+  AAA+A++GIP+++WKG+T++++ W I++ +       +++ILDDGGDLT  +    PE L   +G+ EE+ TG+H LY ++KN  L+ PA+N+N+SVTKSKFD+ Y C+E+L+D +KR+TD  I+GK+ +V GYG VGKG  Q+L+  GA+VI+ EIDPI ++QA +EG+ V  M  A   A+I VT TG   ++    FE++K+  IVCN+GH   E+D+  L         I+  VD   L + + +IL+A+GR+ NL C+      +   S   QVLA IEL+  TD +Y   ++ +PKK D    R  +S   A+    T +Q  YL + + GP K   YRY
Sbjct:   10 ADISLAEWGRKALDIAENEMPGLMKMRQMYGKSKPLTGARISGCLHMTVQTAVLIETLVELGLQVMWSSCNIFSTQDHAAAAIAKAGIPVFAWKGETDEEYVWCIEQTLIFPDGKPLNMILDDGGDLTNLVHTKHPELLKGIRGVSEETTTGVHNLYKMLKNNELKIPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKVAVVAGYGDVGKGSAQSLRSFGARVIITEIDPINALQAAMEGYEVTTMDEACKEANIFVTTTGCKDIITGRHFEQMKEDSIVCNIGHFDCELDVKWLNDHAAEKINIKPQVDRYRLKNGRHVILLAEGRLVNLGCAMGHPSFVMSNSFTNQVLAQIELWKHTD-KYPLGVHFLPKKSDNASIRVRISTPTARDTFFTQKQXSYLSIPREGPLKPDHYRY 433          
BLAST of Adenosylhomocysteinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009744.1 (pep scaffold:Pmarinus_7.0:GL483938:703:10985:1 gene:ENSPMAG00000008796.1 transcript:ENSPMAT00000009744.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 320.472 bits (820), Expect = 8.971e-105
Identity = 157/298 (52.68%), Postives = 214/298 (71.81%), Query Frame = 3
Query:  990 TQRLLKTKPEALNNCKGIVEESITGIHR-LYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            T  + K  P      +GIVEES+TG+HR LY + K   L  PA+N+N+SVTK KFD+ Y C+E+++D LKR+TD     K V+VCGYG VGKGCC  LK +GA V V E+DPIC++QAC+EG+R++ ++  +  ADI++TCTG  +++     ++LK+GCIVCNMGH  +EID+ SL+   + WER+R  VD V  P  KR++L+A+GR+ N + S+VPS V+S+T+T Q LALIELY A DGRYK ++YL+PKK DE VA  HL  F A L ELTD QAKYLG++K GP+K  +YR+
Sbjct:    9 THWMYKQYPSMFRTVRGIVEESVTGVHRWLYQLSKAGKLCVPAVNVNDSVTKQKFDNLYSCRESILDGLKRTTDIMFGSKQVVVCGYGEVGKGCCAALKALGAVVYVTEMDPICALQACLEGYRIVKLTEVVRQADIIITCTGNKNVVTREHLDRLKNGCIVCNMGHSNTEIDVASLRSPDLTWERVRAHVDHVTWPDGKRLVLLAEGRLLNRSSSSVPSFVLSITATTQALALIELYNAPDGRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELTDDQAKYLGMSKNGPFKPNYYRW 306          
BLAST of Adenosylhomocysteinase vs. Ensembl Sea Lamprey
Match: ahcy (adenosylhomocysteinase [Source:ZFIN;Acc:ZDB-GENE-031219-6])

HSP 1 Score: 322.013 bits (824), Expect = 1.259e-103
Identity = 181/428 (42.29%), Postives = 271/428 (63.32%), Query Frame = 3
Query:  609 SKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXA-QVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTD--RQAK-YLGVNKCGPYKTTFYRY 1880
            + I+ A  GR+ ++IA+ EM G + +  +     PL GA+I GC H+T QTAVLIE L+ LG  V W +CNI+STQ+  AAA+A++GIP+++WKG+T++++ W I++ +       +++ILDDGGDLT  +    PE L   +G+ EE+ TG+H LY ++KN  L+ PA+N+N+SVTKSKFD+ Y C+E+L+D +KR+TD  I+GK+ +V GYG VGKG  Q+L+  GA+VI+ EIDPI ++QA +EG+ V  M  A   A+I VT TG   ++    FE++K+  IVCN+GH   E+D+  L         I+  VD   L + + +IL+A+GR+ NL C+      +   S   QVLA IEL+  TD +Y   ++ +PKK ++ V  + + + G  L   T    QAK YL + + GP K   YRY
Sbjct:   10 ADISLAEWGRKALDIAENEMPGLMKMRQMYGKSKPLTGARISGCLHMTVQTAVLIETLVELGLQVMWSSCNIFSTQDHAAAAIAKAGIPVFAWKGETDEEYVWCIEQTLIFPDGKPLNMILDDGGDLTNLVHTKHPELLKGIRGVSEETTTGVHNLYKMLKNNELKIPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKVAVVAGYGDVGKGSAQSLRSFGARVIITEIDPINALQAAMEGYEVTTMDEACKEANIFVTTTGCKDIITGRHFEQMKEDSIVCNIGHFDCELDVKWLNDHAAEKINIKPQVDRYRLKNGRHVILLAEGRLVNLGCAMGHPSFVMSNSFTNQVLAQIELWKHTD-KYPLGVHFLPKKRNKRVIAAAIDMLGITLTRRTRGYEQAKAYLSIPREGPLKPDHYRY 436          
BLAST of Adenosylhomocysteinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007565.1 (pep scaffold:Pmarinus_7.0:GL492884:1286:4056:1 gene:ENSPMAG00000006833.1 transcript:ENSPMAT00000007565.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 131.724 bits (330), Expect = 4.859e-36
Identity = 62/102 (60.78%), Postives = 75/102 (73.53%), Query Frame = 3
Query:  564 ETRKCNSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESG 869
            E R+ NS+  +DFCV  I +A  GRREIEIA+QEM   +++    + D PL GAK++GCTHITAQ AVLIE L  LGA  RW ACNI+ST +EVAAALAESG
Sbjct:   53 EKRQSNSKSSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGDKPLAGAKVVGCTHITAQAAVLIETLCALGAQCRWAACNIFSTHDEVAAALAESG 154          
BLAST of Adenosylhomocysteinase vs. Ensembl Yeast
Match: SAH1 (S-adenosyl-L-homocysteine hydrolase; catabolizes S-adenosyl-L-homocysteine which is formed after donation of the activated methyl group of S-adenosyl-L-methionine (AdoMet) to an acceptor; regulates cellular lipid homoeostasis by regulating phosphatidylcholine(PC)synthesis and triacylglycerol (TG) levels [Source:SGD;Acc:S000000845])

HSP 1 Score: 356.295 bits (913), Expect = 6.455e-117
Identity = 187/443 (42.21%), Postives = 284/443 (64.11%), Query Frame = 3
Query:  597 DFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTK-PEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXA-QVLALIELYTATD-------------GRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            ++ ++ I+ A+ GR+EIE+A+ EM G +++     D  PLKGA+I GC H+T QTAVLIE L+ LGA V W +CNIYSTQ+  AAA+A SG+P+++WKG+TE+++ W I++ +   + +    ++ D G     L+  K PE L +C G+ EE+ TG+H LY ++K   L+ PA+N+N+SVTKSKFD+ Y C+E+LVD +KR+TD  ++GK+ +V GYG VGKGC   L+GMGA+V+V EIDPI ++QA +EG++V+ M  A  +  + VT TG   ++N   F  + +  IVCN+GH   EID+  L+        I+  VD  +L S + +IL+A GR+ NL C+T  S  +   S + QVLA I L+ + D             G ++  ++++PK  DE VA+ HL   G +L +L+  Q++YLG+ + GP+K   YRY
Sbjct:    7 NYKIADISLAAFGRKEIELAEHEMPGLMAIRKAYGDVQPLKGARIAGCLHMTIQTAVLIETLVALGAEVTWSSCNIYSTQDHAAAAIAASGVPVFAWKGETEEEYLWCIEQQLFAFKDNKKLNLILDDGGDLTTLVHEKHPEMLEDCFGLSEETTTGVHHLYRMVKEGKLKVPAINVNDSVTKSKFDNLYGCRESLVDGIKRATDVMLAGKVAVVAGYGDVGKGCAAALRGMGARVLVTEIDPINALQAAMEGYQVVTMEDASHIGQVFVTTTGCRDIINGEHFINMPEDAIVCNIGHFDIEIDVAWLKANAKECINIKPQVDRYLLSSGRHVILLANGRLVNLGCATGHSSFVMSCSFSNQVLAQIALFKSNDKSFREKHIEFQKTGPFEVGVHVLPKILDEAVAKFHLGNLGVRLTKLSKVQSEYLGIPEEGPFKADHYRY 449          
BLAST of Adenosylhomocysteinase vs. Ensembl Nematostella
Match: EDO33638 (Adenosylhomocysteinase [Source:UniProtKB/TrEMBL;Acc:A7SRK8])

HSP 1 Score: 495.352 bits (1274), Expect = 3.568e-170
Identity = 250/437 (57.21%), Postives = 324/437 (74.14%), Query Frame = 3
Query:  579 NSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSN---XXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            NS+G +DFCV  I  A  GRREIEIA+QEM G + +      D PL+GAKI+ CTH+TAQ AVLIE L+ LGA +RWCACNIYSTQNEVAAA+AESG+ I++WKG++E+DFWW I+KCI    TSN    +++LDDGGD T  + K      N  KGIVEES+TG+HRLY + K   L  PAMN+N+SVTK+KFD+ Y C+E+++D+LKR+TD    GK VLVCGYG VGKGCC  LKG+GA V + EIDPIC +QAC++GFRV+ +       DI++TCTG  +++     ++LK+GCIVCNMGH  +EID+ SL+   + WE++R  VD +I P  KRI+L+A+GR+ NL+CS+VPS V+S+T+T Q +ALIELY A  GRYK+++YL+PKK DE VA  HL  F A L +L+D QAKYLGVNK GPYK  +YRY
Sbjct:   47 NSKGTSDFCVKNIKLADFGRREIEIAEQEMPGLMLLRKRNCTDKPLEGAKIVACTHVTAQAAVLIETLMALGAQIRWCACNIYSTQNEVAAAMAESGLSIFAWKGESEEDFWWCIEKCI----TSNGWQPNMVLDDGGDATHLMYKKFNGTFNTLKGIVEESVTGVHRLYQLSKQGKLTVPAMNVNDSVTKTKFDNLYCCRESILDSLKRTTDVMFGGKQVLVCGYGEVGKGCCAALKGLGAIVYITEIDPICGLQACMDGFRVVKIEEVCKHIDILITCTGNKNVVTREHLDRLKNGCIVCNMGHSNTEIDVASLRTSDLAWEKVRSQVDHIIWPDKKRIVLLAEGRLVNLSCSSVPSFVVSITATTQAIALIELYKAPPGRYKHDVYLLPKKMDEYVAMLHLPTFDAHLTDLSDDQAKYLGVNKNGPYKPNYYRY 479          
BLAST of Adenosylhomocysteinase vs. Ensembl Nematostella
Match: EDO47256 (Adenosylhomocysteinase [Source:UniProtKB/TrEMBL;Acc:A7RME1])

HSP 1 Score: 349.747 bits (896), Expect = 5.207e-114
Identity = 188/428 (43.93%), Postives = 279/428 (65.19%), Query Frame = 3
Query:  600 FCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXA-QVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            + V+ I+ A  GR+EI +A+ EM G +++        PLKGA+I GC H+T QTAVLIE L  LGA V+W +CNI+STQ+  AAA+A++G+P+Y+WKG+T++++ W I++ +  +    +++ILDDGGDLT  + +   + L   +G+ EE+ TG+H LY +++   L+  A+N+N+SVTKSKFD+ Y  +E+LVD LKR+TD  ++GK+V+V GYG VGKG  Q+LKG G++V++ EIDPI ++QA  EGF V  M  A   A+I VT TG   ++    F  +KD  IVCN+GH   EID+  L +       I+  VD   LP+ + ++L+A+GR+ NL C+      +   S   QVLA IEL+T  + +Y   +Y++PK  DE VA  HL   G +L +LT+ QA YLG+   GP+K  +YRY
Sbjct:    9 YKVADISLAEWGRKEIVLAENEMPGLMALRKEYGPSKPLKGARIAGCLHMTIQTAVLIETLTELGAEVQWSSCNIFSTQDHAAAAIAKTGVPVYAWKGETDEEYIWCIEQTLVFKDGQPLNMILDDGGDLTNLVHEKYTQYLEGIRGLSEETTTGVHNLYKMMEKGKLKITAINVNDSVTKSKFDNLYGIRESLVDGLKRATDIMLAGKVVVVAGYGDVGKGSVQSLKGFGSRVLITEIDPINALQAACEGFEVTTMDEAASQANIFVTATGCSGIITKEHFMMMKDDAIVCNVGHFDCEIDVAWLNEN-CKKSTIKPQVDRYELPNGRHVVLLAEGRLVNLGCAMGHPSFVMSNSFTNQVLAQIELWTRHE-KYPLNVYMLPKTLDEKVAALHLDHLGVKLTKLTNTQASYLGIKTEGPFKPEYYRY 434          
BLAST of Adenosylhomocysteinase vs. Ensembl Nematostella
Match: EDO25856 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TDI6])

HSP 1 Score: 246.899 bits (629), Expect = 8.288e-77
Identity = 132/262 (50.38%), Postives = 184/262 (70.23%), Query Frame = 3
Query:  579 NSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINV-EQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRV 1361
            N+  +  + V  I  A  GR+EIE+A+ EM G +++ A      PLKGA+I GC H+T QTAVLIE L+ LGA V W +CNI+STQ+  AAA+A +GIP+Y+WKG  E++F W I++ +   E    +++ILDDGGDLT  +    PE +   KG+ EE+ TG+HRLY  +KN +L  PA+N+N+SVTKSKFD+ Y CKE+ VDA++R+TD  ++GK V+VCGYG VGKG   + +G G+ V V EIDPIC++QA ++GF V
Sbjct:    4 NTTTYVPYKVKDITLADWGRKEIELAEAEMPGLMALRAEYGASQPLKGARIAGCLHMTIQTAVLIETLVALGAEVTWSSCNIFSTQDHAAAAIAAAGIPVYAWKGLNEEEFDWCIEQTLWFGEDRKPLNMILDDGGDLTNMVFDRFPELIEEIKGLSEETTTGVHRLYERMKNGTLHIPAINVNDSVTKSKFDNKYGCKESAVDAVRRATDIMLAGKRVVVCGYGDVGKGTAASFRGAGSIVTVTEIDPICALQAAMDGFEV 265          
BLAST of Adenosylhomocysteinase vs. Ensembl Medaka
Match: AHCYL1 (S-adenosylhomocysteine hydrolase-like protein 1 [Source:NCBI gene;Acc:101168941])

HSP 1 Score: 499.204 bits (1284), Expect = 3.305e-170
Identity = 250/458 (54.59%), Postives = 331/458 (72.27%), Query Frame = 3
Query:  507 NDDKDPKKKLTIREKFENPETRKCNSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            +D+  P+ K  I            NS+G +DFCV  I +   GRREIEIA+Q+M   +S+    + + PL GAKI+GCTHITAQTAVLIE L+ LGA  RW ACNIYSTQNEVAAAL+E+G+ +++WKG++EDDFWW ID+C+N E     ++ILDDGGDLT  + K  P      +GIVEES+TG+HRLY + K   L  PAMN+N+SVTK KFD+ Y C+E+++D LKR+TD    GK V++CGYG VGKGCC  LK +GA V V EIDPIC++QAC++GFRV+ ++  +   DI++TCTG  +++     +++K+G IVCNMGH  +EID+ SL+   + WER+R  VD VI P  KR+IL+A+GR+ NL+CSTVP+ V+S+T+T Q LALIELY A +GRYK ++YL+PKK DE VA  HL+ F A L ELTD QAKYLG+NK GP+K  +YRY
Sbjct:  107 DDETSPRDKTQI------------NSKGSSDFCVKNIKQNEFGRREIEIAEQDMSALISLRKRAQSEKPLAGAKIVGCTHITAQTAVLIETLVALGAQCRWTACNIYSTQNEVAAALSETGVAVFAWKGESEDDFWWCIDRCVNTEGW-QPNMILDDGGDLTHWVYKKYPNVFKKIRGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDVMFGGKQVVICGYGEVGKGCCAALKALGAIVYVTEIDPICALQACMDGFRVVKLNEVIRQVDIIITCTGNKNVVTRDQLDRMKNGSIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRVILLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHLTTFDAHLTELTDDQAKYLGLNKNGPFKPNYYRY 551          
BLAST of Adenosylhomocysteinase vs. Ensembl Medaka
Match: AHCYL2 (putative adenosylhomocysteinase 3 [Source:NCBI gene;Acc:101159714])

HSP 1 Score: 501.13 bits (1289), Expect = 4.342e-170
Identity = 249/434 (57.37%), Postives = 322/434 (74.19%), Query Frame = 3
Query:  579 NSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            NS+G  DFC+  I +A  GRREIEIA+QEM   +++    + + PL GAK++GCTHITAQTAVL+E L  LGA  RW ACNIYSTQNEVAAALAE G  +++WKG++EDDFWW ID+C+NVE     ++ILDDGGDLT  + K  P      KGIVEES+TG+HRLY + K   L  PAMN+N+SVTK KFD+ Y C+E+++D LKR+TD    GK V+VCGYG VGKGCC  LK MG+ V V EIDPIC++QAC++GFR++ ++  +   DIV+TCTG  +++     +++K+GCIVCNMGH  +EID+ SL+   + WER+R  VD VI P  KRI+L+A+GR+ NL+CSTVP+ V+S+T+T Q LALIELY A +GRYK ++YL+PKK DE VA  HL  F A L ELTD QAKYLG+NK GP+K  +YRY
Sbjct:  171 NSKGNGDFCIKNIKQADFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKVVGCTHITAQTAVLMETLSALGAQCRWAACNIYSTQNEVAAALAEGGFSVFAWKGESEDDFWWCIDRCVNVEGW-QPNMILDDGGDLTHWIYKKYPSMFKKIKGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDVMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMDGFRLVKLNEVIRQVDIVITCTGNKNVVVREHLDRMKNGCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIVLLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELTDEQAKYLGLNKNGPFKPNYYRY 603          
BLAST of Adenosylhomocysteinase vs. Ensembl Medaka
Match: ahcyl1 (adenosylhomocysteinase like 1 [Source:NCBI gene;Acc:101165058])

HSP 1 Score: 496.123 bits (1276), Expect = 7.270e-169
Identity = 242/436 (55.50%), Postives = 325/436 (74.54%), Query Frame = 3
Query:  573 KCNSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            + NS G +DFCV  I +A  GRREIEIA+Q+M   +S+    + + PL GAK++GCTHITAQTAVLIE L+ LGA  RW ACNIYSTQNEVAAALAE+G+ +++WKG++EDDFWW ID+C+N       ++ILDDGGDLT  + K  P      +GIVEES+TG+HRLY + K   L  PAMN+N+SVTK KFD+ Y C+E+++D LKR+TD    GK V+VCGYG VGKGCC  LK +GA V + EIDPIC++QAC++GFRV+ +S  +   D+V+TCTG  ++++    +++K+GCIVCNMGH  +EID+ SL+   + WER+R  VD +I P  KR+IL+A+GR+ NL+CSTVP+ V+S+T+T Q LALIEL+ A +GRYK ++YL+PKK DE V+  HL  F A L EL+D QAKY+G++K GP+K  +YRY
Sbjct:  121 QVNSHGSSDFCVKNIKQAEFGRREIEIAEQDMSALISLRKRAQGEKPLAGAKVVGCTHITAQTAVLIETLVALGAQCRWTACNIYSTQNEVAAALAETGVSVFAWKGESEDDFWWCIDRCVNAAGW-QANMILDDGGDLTHWVYKKYPSVFKKVRGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDIMFGGKQVVVCGYGEVGKGCCAALKALGAIVCITEIDPICALQACMDGFRVVKLSEVIRQMDVVITCTGNKNVVSREQLDRMKNGCIVCNMGHSNTEIDVASLRSPELTWERVRSQVDHIIWPDGKRVILLAEGRLLNLSCSTVPTFVLSITATTQALALIELFNAPEGRYKQDVYLLPKKMDEYVSSLHLPNFDAHLTELSDEQAKYMGLHKNGPFKPNYYRY 555          
BLAST of Adenosylhomocysteinase vs. Ensembl Medaka
Match: ahcyl1 (adenosylhomocysteinase like 1 [Source:NCBI gene;Acc:101165058])

HSP 1 Score: 493.812 bits (1270), Expect = 8.083e-169
Identity = 242/434 (55.76%), Postives = 324/434 (74.65%), Query Frame = 3
Query:  579 NSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            NS G +DFCV  I +A  GRREIEIA+Q+M   +S+    + + PL GAK++GCTHITAQTAVLIE L+ LGA  RW ACNIYSTQNEVAAALAE+G+ +++WKG++EDDFWW ID+C+N       ++ILDDGGDLT  + K  P      +GIVEES+TG+HRLY + K   L  PAMN+N+SVTK KFD+ Y C+E+++D LKR+TD    GK V+VCGYG VGKGCC  LK +GA V + EIDPIC++QAC++GFRV+ +S  +   D+V+TCTG  ++++    +++K+GCIVCNMGH  +EID+ SL+   + WER+R  VD +I P  KR+IL+A+GR+ NL+CSTVP+ V+S+T+T Q LALIEL+ A +GRYK ++YL+PKK DE V+  HL  F A L EL+D QAKY+G++K GP+K  +YRY
Sbjct:   70 NSHGSSDFCVKNIKQAEFGRREIEIAEQDMSALISLRKRAQGEKPLAGAKVVGCTHITAQTAVLIETLVALGAQCRWTACNIYSTQNEVAAALAETGVSVFAWKGESEDDFWWCIDRCVNAAGW-QANMILDDGGDLTHWVYKKYPSVFKKVRGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDIMFGGKQVVVCGYGEVGKGCCAALKALGAIVCITEIDPICALQACMDGFRVVKLSEVIRQMDVVITCTGNKNVVSREQLDRMKNGCIVCNMGHSNTEIDVASLRSPELTWERVRSQVDHIIWPDGKRVILLAEGRLLNLSCSTVPTFVLSITATTQALALIELFNAPEGRYKQDVYLLPKKMDEYVSSLHLPNFDAHLTELSDEQAKYMGLHKNGPFKPNYYRY 502          
BLAST of Adenosylhomocysteinase vs. Ensembl Medaka
Match: ahcyl1 (adenosylhomocysteinase like 1 [Source:NCBI gene;Acc:101165058])

HSP 1 Score: 492.271 bits (1266), Expect = 4.883e-168
Identity = 242/434 (55.76%), Postives = 324/434 (74.65%), Query Frame = 3
Query:  579 NSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            NS G +DFCV  I +A  GRREIEIA+Q+M   +S+    + + PL GAK++GCTHITAQTAVLIE L+ LGA  RW ACNIYSTQNEVAAALAE+G+ +++WKG++EDDFWW ID+C+N       ++ILDDGGDLT  + K  P      +GIVEES+TG+HRLY + K   L  PAMN+N+SVTK KFD+ Y C+E+++D LKR+TD    GK V+VCGYG VGKGCC  LK +GA V + EIDPIC++QAC++GFRV+ +S  +   D+V+TCTG  ++++    +++K+GCIVCNMGH  +EID+ SL+   + WER+R  VD +I P  KR+IL+A+GR+ NL+CSTVP+ V+S+T+T Q LALIEL+ A +GRYK ++YL+PKK DE V+  HL  F A L EL+D QAKY+G++K GP+K  +YRY
Sbjct:   77 NSHGSSDFCVKNIKQAEFGRREIEIAEQDMSALISLRKRAQGEKPLAGAKVVGCTHITAQTAVLIETLVALGAQCRWTACNIYSTQNEVAAALAETGVSVFAWKGESEDDFWWCIDRCVNAAGW-QANMILDDGGDLTHWVYKKYPSVFKKVRGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDIMFGGKQVVVCGYGEVGKGCCAALKALGAIVCITEIDPICALQACMDGFRVVKLSEVIRQMDVVITCTGNKNVVSREQLDRMKNGCIVCNMGHSNTEIDVASLRSPELTWERVRSQVDHIIWPDGKRVILLAEGRLLNLSCSTVPTFVLSITATTQALALIELFNAPEGRYKQDVYLLPKKMDEYVSSLHLPNFDAHLTELSDEQAKYMGLHKNGPFKPNYYRY 509          
BLAST of Adenosylhomocysteinase vs. Planmine SMEST
Match: SMESG000029405.1 (SMESG000029405.1)

HSP 1 Score: 1016.14 bits (2626), Expect = 0.000e+0
Identity = 569/572 (99.48%), Postives = 572/572 (100.00%), Query Frame = 3
Query:  165 MNSIKKLFRHSSVPQVENKVNKATNNLKNSEMKGCLKSSASGSEAVQTKWEDLXXXXXXXXXXXXXXXXXXXAQKDKRRASVIISKKVWNXXXXXXXXXXXXXXXXXXXXXXXENDDKDPKKKLTIREKFENPETRKCNSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            MNSIKKLFRHSSVPQVENKVNKATNNLKNSEMKGCLKSSASGSEAVQTKWEDLKDIDDEEFNNEEIEKSKEFAQKDKRRASVIISKKVWNSRRNSSLSNASSFSESSETFSASENDDKDPKKKLTIREKFENPETRKCNSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGA+VRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNIDLILDDGGDLTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCS+VPSVVISVTSTAQVLALIELYTAT+GRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY
Sbjct:    1 MNSIKKLFRHSSVPQVENKVNKATNNLKNSEMKGCLKSSASGSEAVQTKWEDLKDIDDEEFNNEEIEKSKEFAQKDKRRASVIISKKVWNSRRNSSLSNASSFSESSETFSASENDDKDPKKKLTIREKFENPETRKCNSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGATVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNIDLILDDGGDLTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCSSVPSVVISVTSTAQVLALIELYTATNGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 572          
BLAST of Adenosylhomocysteinase vs. Planmine SMEST
Match: SMESG000055982.1 (SMESG000055982.1)

HSP 1 Score: 544.658 bits (1402), Expect = 0.000e+0
Identity = 268/453 (59.16%), Postives = 343/453 (75.72%), Query Frame = 3
Query:  525 KKKLTIREKFENPETRKCNSRGFNDFCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCIN-VEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            KK+   RE++EN  +R+ NS+G  DFCV K+++AS GRREIEIA+QEM G + +      D PL GA I+GCTHITAQTAVLIE L+ LGA VRWCACNIYSTQNEVAAALAES  PI++WKG++EDDFWW I++CIN V  T N+ L        T  + K   +   N +GIVEES+TG+HRLY   KN  L  PAMN+N+S+TK+KFD++YLCKE+++DALKRSTD  I GK VLVCGYG VGKGCCQ LKG+GA + V EIDPIC++QAC++GFRV+ +   +   D+V+TCTG  S+L  +  +K+K+GC+VCNMGH  +EID+ SLQ   + WER+R  VD +I P  KRIILIA+GR+ANL+CS+VPS+V+SVT++ Q LALIEL+    GRY N++YL+PKK DE VA  HLS+F A+L ELTD QA+YLG+NK GP+K  +YRY
Sbjct:   77 KKRENPRERYENENSRQSNSKGSTDFCVQKLSQASFGRREIEIAEQEMPGLMGLRKRALTDQPLTGANIIGCTHITAQTAVLIETLVYLGAQVRWCACNIYSTQNEVAAALAESSHPIFAWKGESEDDFWWCIERCINGVSWTPNMILDDGGDL--TFFVQKNYSQIFKNVRGIVEESVTGVHRLYQYSKNGLLASPAMNVNDSITKTKFDNFYLCKESIIDALKRSTDIMIGGKSVLVCGYGEVGKGCCQALKGLGAFICVTEIDPICALQACMDGFRVVKIDEVIRSVDLVITCTGNRSVLQRSHMDKMKNGCVVCNMGHSNTEIDVFSLQTPDLTWERVRSHVDHIIWPDKKRIILIAEGRLANLSCSSVPSIVVSVTASTQALALIELFNKPKGRYNNDVYLLPKKMDEYVASLHLSLFNARLTELTDEQARYLGLNKSGPFKPNYYRY 527          
BLAST of Adenosylhomocysteinase vs. Planmine SMEST
Match: SMESG000012950.1 (SMESG000012950.1)

HSP 1 Score: 366.696 bits (940), Expect = 2.653e-120
Identity = 193/428 (45.09%), Postives = 283/428 (66.12%), Query Frame = 3
Query:  600 FCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXA-QVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            + V+ I++A  GR+ I IA+ EM G + +  +     PL GA+I GC H+T QTAVLIE L  LGA V+W +CNI+STQ+  AAA+A++G+P+Y+WKG+T++++ W +++ I       +++ILDDGGDLT  + +  P+ LN  KGI EE+ TG+H LY ++    L+CPA+N+N+SVTKSKFD+ Y C+E+L+D +KR+TD  ++GK+ LV GYG VGKGCCQ L+  G +V+V+EIDPI ++QA +EG+ V  +  A+  A I VT +G   ++    FE++ D  IVCN+GH  +E++   L +     + I+  VD   L + + IIL+A GR+ NL C+      +   S   QVLA +EL+T TD +YK  +Y +PKK DE VA++HL   G +L +LT  QA YLGV   GP+K   YRY
Sbjct:    8 YKVADISQAEWGRKTITIAENEMPGLMMMRRVYGTKKPLAGARIAGCLHMTVQTAVLIETLTELGAEVQWSSCNIFSTQDHAAAAIAKTGVPVYAWKGETDEEYLWCMEQTIYFHNGQPLNMILDDGGDLTNLVHEKYPQLLNEIKGISEETTTGVHNLYKMMSAGKLRCPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVMLAGKVALVAGYGDVGKGCCQALRAYGCRVLVSEIDPINALQAVMEGYEVTTVEEAVKKARIFVTASGCKDIIVGKHFEQMLDDSIVCNIGHFDTEVEAKWLFENCKSKDTIKPQVDRYTLKNGRHIILLADGRLVNLGCAHGHPSFVMSNSFTNQVLAQLELWTKTD-QYKVGVYFLPKKLDEEVAQAHLEPLGVKLTKLTPSQADYLGVPIEGPFKPEHYRY 434          
BLAST of Adenosylhomocysteinase vs. Planmine SMEST
Match: SMESG000012950.1 (SMESG000012950.1)

HSP 1 Score: 366.696 bits (940), Expect = 2.799e-120
Identity = 193/428 (45.09%), Postives = 283/428 (66.12%), Query Frame = 3
Query:  600 FCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXA-QVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            + V+ I++A  GR+ I IA+ EM G + +  +     PL GA+I GC H+T QTAVLIE L  LGA V+W +CNI+STQ+  AAA+A++G+P+Y+WKG+T++++ W +++ I       +++ILDDGGDLT  + +  P+ LN  KGI EE+ TG+H LY ++    L+CPA+N+N+SVTKSKFD+ Y C+E+L+D +KR+TD  ++GK+ LV GYG VGKGCCQ L+  G +V+V+EIDPI ++QA +EG+ V  +  A+  A I VT +G   ++    FE++ D  IVCN+GH  +E++   L +     + I+  VD   L + + IIL+A GR+ NL C+      +   S   QVLA +EL+T TD +YK  +Y +PKK DE VA++HL   G +L +LT  QA YLGV   GP+K   YRY
Sbjct:    6 YKVADISQAEWGRKTITIAENEMPGLMMMRRVYGTKKPLAGARIAGCLHMTVQTAVLIETLTELGAEVQWSSCNIFSTQDHAAAAIAKTGVPVYAWKGETDEEYLWCMEQTIYFHNGQPLNMILDDGGDLTNLVHEKYPQLLNEIKGISEETTTGVHNLYKMMSAGKLRCPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVMLAGKVALVAGYGDVGKGCCQALRAYGCRVLVSEIDPINALQAVMEGYEVTTVEEAVKKARIFVTASGCKDIIVGKHFEQMLDDSIVCNIGHFDTEVEAKWLFENCKSKDTIKPQVDRYTLKNGRHIILLADGRLVNLGCAHGHPSFVMSNSFTNQVLAQLELWTKTD-QYKVGVYFLPKKLDEEVAQAHLEPLGVKLTKLTPSQADYLGVPIEGPFKPEHYRY 432          
BLAST of Adenosylhomocysteinase vs. Planmine SMEST
Match: SMESG000012954.1 (SMESG000012954.1)

HSP 1 Score: 362.844 bits (930), Expect = 7.658e-119
Identity = 192/428 (44.86%), Postives = 281/428 (65.65%), Query Frame = 3
Query:  600 FCVSKINEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTAVLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFWWSIDKCINVEQTSNXXXXXXXXXXXTQRLLKTKPEALNNCKGIVEESITGIHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTTISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVLLMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDSLQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCXXXXXXXXXXXXXA-QVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELTDRQAKYLGVNKCGPYKTTFYRY 1880
            + V+ IN A  GR+ I IA+ EM G + +  +     PL GA+I GC H+T QTAVLIE L  LGA V+W +CNI+STQ+  AAA+A++G+P+Y+WKG+T++++ W +++ I       +++ILDDGGDLT  + +  P+ LN  KGI EE+ TG+H LY ++    L+CP++N+N+SVTKSKFD+ Y C+E+LVD +KR+TD  ++GK+ LV GYG VGKGCCQ L+  G +V+V+EIDPI ++QA +EG+ V  +  A+  A I VT +G   ++    FE++ D  IVCN+GH   E++   L +     + I+  VD   L + + IIL+A GR+ NL C+      +   S   QVLA IEL+T TD +YK  +Y +PKK DE VA++HL   G +L +LT  Q++YL +   GP+K   YRY
Sbjct:    6 YKVADINLAEWGRKTITIAENEMPGLMMMRRVYGPRKPLAGARIAGCLHMTVQTAVLIETLTELGAEVQWSSCNIFSTQDHAAAAIAKTGVPVYAWKGETDEEYLWCMEQTIYFHNGQPLNMILDDGGDLTNLVHEKYPQLLNEIKGISEETTTGVHNLYKMMSAGKLKCPSINVNDSVTKSKFDNLYGCRESLVDGIKRATDVMLAGKVALVAGYGDVGKGCCQALRAYGCRVLVSEIDPINALQAAMEGYEVTTVEEAVKKARIFVTASGCKDIIVGKHFEQMLDDSIVCNIGHFDIEVEAKWLVENCKSKDTIKPQVDRYTLKNGRHIILLADGRLVNLGCAHGHPSFVMSNSFTNQVLAQIELWTKTD-QYKVGVYFLPKKLDEEVAQAHLEHLGVKLTKLTPEQSRYLSIPVEGPFKPDHYRY 432          
The following BLAST results are available for this feature:
BLAST of Adenosylhomocysteinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AHCYL25.014e-17157.83adenosylhomocysteinase like 2 [Source:HGNC Symbol;... [more]
AHCYL25.124e-17157.83adenosylhomocysteinase like 2 [Source:HGNC Symbol;... [more]
AHCYL21.051e-17057.83adenosylhomocysteinase like 2 [Source:HGNC Symbol;... [more]
AHCYL21.168e-17057.83adenosylhomocysteinase like 2 [Source:HGNC Symbol;... [more]
AHCYL21.687e-17057.83adenosylhomocysteinase like 2 [Source:HGNC Symbol;... [more]
back to top
BLAST of Adenosylhomocysteinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ahcy-14.628e-11644.19Adenosylhomocysteinase [Source:UniProtKB/Swiss-Pr... [more]
ahcy-14.628e-11644.19Adenosylhomocysteinase [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Adenosylhomocysteinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AhcyL15.635e-17155.22gene:FBgn0035371 transcript:FBtr0073016[more]
AhcyL21.475e-15553.46gene:FBgn0015011 transcript:FBtr0083378[more]
AhcyL22.922e-15453.35gene:FBgn0015011 transcript:FBtr0083379[more]
Ahcy5.225e-11645.33gene:FBgn0014455 transcript:FBtr0074030[more]
Ahcy5.225e-11645.33gene:FBgn0014455 transcript:FBtr0346181[more]
back to top
BLAST of Adenosylhomocysteinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ahcyl13.361e-17156.72adenosylhomocysteinase-like 1 [Source:ZFIN;Acc:ZDB... [more]
ahcyl15.248e-17156.72adenosylhomocysteinase-like 1 [Source:ZFIN;Acc:ZDB... [more]
ahcyl2b8.586e-16957.37adenosylhomocysteinase like 2b [Source:ZFIN;Acc:ZD... [more]
ahcyl2a4.454e-16051.97adenosylhomocysteinase like 2a [Source:ZFIN;Acc:ZD... [more]
ahcyl2a1.941e-15952.08adenosylhomocysteinase like 2a [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Adenosylhomocysteinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ahcyl21.876e-17258.29adenosylhomocysteinase-like 2 [Source:NCBI gene;Ac... [more]
ahcyl22.582e-17158.20adenosylhomocysteinase-like 2 [Source:NCBI gene;Ac... [more]
ahcyl24.500e-17158.20adenosylhomocysteinase-like 2 [Source:NCBI gene;Ac... [more]
ahcyl27.429e-17158.20adenosylhomocysteinase-like 2 [Source:NCBI gene;Ac... [more]
ahcyl27.463e-17158.20adenosylhomocysteinase-like 2 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Adenosylhomocysteinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ahcyl22.597e-17157.83S-adenosylhomocysteine hydrolase-like 2 [Source:MG... [more]
Ahcyl23.518e-17157.83S-adenosylhomocysteine hydrolase-like 2 [Source:MG... [more]
Ahcyl21.438e-17057.83S-adenosylhomocysteine hydrolase-like 2 [Source:MG... [more]
Ahcyl21.729e-17057.83S-adenosylhomocysteine hydrolase-like 2 [Source:MG... [more]
Ahcyl12.759e-16056.04S-adenosylhomocysteine hydrolase-like 1 [Source:MG... [more]
back to top
BLAST of Adenosylhomocysteinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96HN2|SAHH3_HUMAN5.608e-17057.83Adenosylhomocysteinase 3 OS=Homo sapiens OX=9606 G... [more]
sp|Q9VZX9|SAHH2_DROME5.648e-17055.22Adenosylhomocysteinase-like 1 OS=Drosophila melano... [more]
sp|A6QLP2|SAHH3_BOVIN6.050e-17058.06Adenosylhomocysteinase 3 OS=Bos taurus OX=9913 GN=... [more]
sp|Q68FL4|SAHH3_MOUSE1.006e-16957.83Putative adenosylhomocysteinase 3 OS=Mus musculus ... [more]
sp|Q5R889|SAHH3_PONAB1.322e-16957.60Putative adenosylhomocysteinase 3 OS=Pongo abelii ... [more]
back to top
BLAST of Adenosylhomocysteinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0R6V70.000e+057.31Adenosylhomocysteinase OS=Fasciola hepatica OX=619... [more]
A0A504Z1E60.000e+057.31Adenosylhomocysteinase OS=Fasciola gigantica OX=46... [more]
A0A1S8X1583.598e-657.63Adenosylhomocysteinase (Fragment) OS=Opisthorchis ... [more]
H2KNW60.000e+057.75Adenosylhomocysteinase OS=Clonorchis sinensis OX=7... [more]
A0A419PTC60.000e+057.63Adenosylhomocysteinase OS=Clonorchis sinensis OX=7... [more]
back to top
BLAST of Adenosylhomocysteinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ahcyl2b1.882e-16956.91adenosylhomocysteinase like 2 [Source:NCBI gene;Ac... [more]
ahcyl13.172e-16956.04adenosylhomocysteinase like 1 [Source:NCBI gene;Ac... [more]
ahcyl2a6.327e-16656.12adenosylhomocysteinase like 2a [Source:ZFIN;Acc:ZD... [more]
ahcy3.050e-12145.33adenosylhomocysteinase [Source:NCBI gene;Acc:10304... [more]
back to top
BLAST of Adenosylhomocysteinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006905.11.916e-13249.19pep scaffold:Pmarinus_7.0:GL477645:46731:62118:1 g... [more]
ahcy3.158e-10642.35adenosylhomocysteinase [Source:ZFIN;Acc:ZDB-GENE-0... [more]
ENSPMAT00000009744.18.971e-10552.68pep scaffold:Pmarinus_7.0:GL483938:703:10985:1 gen... [more]
ahcy1.259e-10342.29adenosylhomocysteinase [Source:ZFIN;Acc:ZDB-GENE-0... [more]
ENSPMAT00000007565.14.859e-3660.78pep scaffold:Pmarinus_7.0:GL492884:1286:4056:1 gen... [more]
back to top
BLAST of Adenosylhomocysteinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SAH16.455e-11742.21S-adenosyl-L-homocysteine hydrolase; catabolizes S... [more]
back to top
BLAST of Adenosylhomocysteinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO336383.568e-17057.21Adenosylhomocysteinase [Source:UniProtKB/TrEMBL;A... [more]
EDO472565.207e-11443.93Adenosylhomocysteinase [Source:UniProtKB/TrEMBL;A... [more]
EDO258568.288e-7750.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Adenosylhomocysteinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AHCYL13.305e-17054.59S-adenosylhomocysteine hydrolase-like protein 1 [S... [more]
AHCYL24.342e-17057.37putative adenosylhomocysteinase 3 [Source:NCBI gen... [more]
ahcyl17.270e-16955.50adenosylhomocysteinase like 1 [Source:NCBI gene;Ac... [more]
ahcyl18.083e-16955.76adenosylhomocysteinase like 1 [Source:NCBI gene;Ac... [more]
ahcyl14.883e-16855.76adenosylhomocysteinase like 1 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Adenosylhomocysteinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029405.10.000e+099.48SMESG000029405.1[more]
SMESG000055982.10.000e+059.16SMESG000055982.1[more]
SMESG000012950.12.653e-12045.09SMESG000012950.1[more]
SMESG000012950.12.799e-12045.09SMESG000012950.1[more]
SMESG000012954.17.658e-11944.86SMESG000012954.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029349 ID=SMED30029349|Name=Adenosylhomocysteinase|organism=Schmidtea mediterranea sexual|type=transcript|length=2077bp
AATCAAAAACAAGTTGGATTAAAAAAAAATTTCTCGCGACGGATTTAGGT
TTATCGCTTATGCTAAATATAGTAAATGTCTCAATGATTTATATACCAGC
AGGTTGTGCAGTCGACTTTTTGTTATAATACTACTGGTAGTTCTCCCTTG
GATAGAAGTTGTAGATGAATTCCATCAAAAAACTATTTCGTCATTCATCT
GTTCCTCAAGTAGAAAATAAAGTAAATAAAGCCACAAACAACTTGAAAAA
TTCCGAAATGAAAGGTTGCTTGAAATCGTCTGCCAGTGGTTCGGAAGCTG
TTCAGACTAAATGGGAAGACTTAAAAGACATTGATGATGAAGAATTCAAT
AATGAAGAAATAGAAAAATCGAAAGAATTTGCTCAGAAAGATAAACGTCG
AGCTAGTGTTATTATTAGTAAGAAAGTTTGGAATTCTCGGCGCAATAGTA
GCCTTTCAAATGCTTCTTCTTTCAGTGAATCTTCAGAAACTTTTTCAGCT
TCTGAGAATGACGACAAAGACCCAAAGAAAAAACTAACAATTCGAGAGAA
ATTTGAAAATCCCGAAACAAGAAAATGCAATTCTCGTGGATTTAATGACT
TCTGCGTCAGTAAAATTAATGAAGCTTCATTAGGAAGACGTGAAATTGAA
ATAGCTCAACAAGAAATGAAAGGATTTCTATCAGTAATTGCATTGTTAGA
AGATGATATTCCTTTGAAAGGTGCAAAAATTCTCGGTTGTACACACATAA
CTGCTCAAACTGCGGTGCTTATCGAAGGACTAATAACTCTTGGAGCTTCC
GTCAGATGGTGCGCTTGCAACATTTACTCCACTCAGAACGAGGTGGCGGC
CGCCTTGGCGGAGAGTGGAATCCCAATCTACTCATGGAAGGGTCAAACTG
AAGACGATTTTTGGTGGTCTATTGACAAGTGCATAAATGTGGAACAAACT
TCCAATATTGATCTTATCCTCGACGATGGTGGCGATTTGACACAGAGGTT
GTTGAAAACTAAACCAGAAGCCTTGAATAATTGTAAAGGAATTGTCGAAG
AGAGCATTACTGGCATTCATAGGTTATATCATGTCATAAAAAACAAGTCG
CTTCAATGTCCGGCAATGAACATGAATGAATCGGTTACGAAATCCAAATT
TGACAGCTACTATTTATGCAAAGAAACGCTAGTTGATGCGTTGAAAAGAA
GTACGGATACAACAATCAGTGGAAAAATCGTTCTTGTTTGTGGATATGGT
TCGGTAGGGAAAGGATGCTGTCAAACTTTGAAAGGAATGGGTGCCCAAGT
CATCGTGGCTGAAATTGACCCTATTTGTTCAATTCAGGCTTGTATTGAAG
GTTTCCGTGTGTTATTGATGAGCACGGCTCTTCCTTTGGCAGACATTGTT
GTCACTTGCACCGGAACAATTTCTCTTTTGAATGTTGCGGATTTCGAAAA
GCTGAAGGATGGATGCATAGTTTGTAACATGGGTCACCCTACTTCCGAAA
TAGACATAGATTCTCTGCAACAGAAAGGAGTCGTATGGGAAAGAATTAGA
GATGATGTTGATTTCGTAATATTGCCTTCTACAAAAAGAATAATTTTAAT
CGCTCAGGGACGAGTAGCAAATCTCAATTGTTCTACAGTTCCTTCAGTAG
TAATATCAGTCACGTCTACAGCACAGGTGCTTGCCCTCATTGAACTCTAC
ACTGCGACCGATGGCAGATATAAAAACGAAATCTATTTGATTCCAAAGAA
ATGCGATGAAATGGTGGCAAGATCCCATTTGTCGATATTCGGTGCTCAAT
TAAACGAACTGACAGACAGACAGGCAAAATATCTCGGGGTTAATAAATGT
GGTCCATACAAGACCACCTTTTACAGATATTAGCAGCTGAGTGAGAAAAA
TGCTTTAGAAATTCATGATTCCCAGAACTGCTCTAGATCCATTTAGAAAC
TGCAAATATTATTCATAGGCTTGATTCTAATGCTTAGCTCAATTTGCTAT
TCAATTATGATATTTATGTTAAAATTTAGCATTTTTTTCTTTCTTGAGAT
CTTTAATAAATATAGTTCACATTAAAA
back to top

protein sequence of SMED30029349-orf-1

>SMED30029349-orf-1 ID=SMED30029349-orf-1|Name=SMED30029349-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=573bp
MNSIKKLFRHSSVPQVENKVNKATNNLKNSEMKGCLKSSASGSEAVQTKW
EDLKDIDDEEFNNEEIEKSKEFAQKDKRRASVIISKKVWNSRRNSSLSNA
SSFSESSETFSASENDDKDPKKKLTIREKFENPETRKCNSRGFNDFCVSK
INEASLGRREIEIAQQEMKGFLSVIALLEDDIPLKGAKILGCTHITAQTA
VLIEGLITLGASVRWCACNIYSTQNEVAAALAESGIPIYSWKGQTEDDFW
WSIDKCINVEQTSNIDLILDDGGDLTQRLLKTKPEALNNCKGIVEESITG
IHRLYHVIKNKSLQCPAMNMNESVTKSKFDSYYLCKETLVDALKRSTDTT
ISGKIVLVCGYGSVGKGCCQTLKGMGAQVIVAEIDPICSIQACIEGFRVL
LMSTALPLADIVVTCTGTISLLNVADFEKLKDGCIVCNMGHPTSEIDIDS
LQQKGVVWERIRDDVDFVILPSTKRIILIAQGRVANLNCSTVPSVVISVT
STAQVLALIELYTATDGRYKNEIYLIPKKCDEMVARSHLSIFGAQLNELT
DRQAKYLGVNKCGPYKTTFYRY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000420parapharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR042172Adenosylhomocyst_ase-like_sf
IPR036291NAD(P)-bd_dom_sf
IPR015878Ado_hCys_hydrolase_NAD-bd
IPR000043Adenosylhomocysteinase-like
IPR016040NAD(P)-bd_dom
IPR020082S-Ado-L-homoCys_hydrolase_CS
Vocabulary: molecular function
TermDefinition
GO:0004013adenosylhomocysteinase activity
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0006730one-carbon metabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 13..33
NoneNo IPR availableCOILSCoilCoilcoord: 56..76
NoneNo IPR availableGENE3DG3DSA:3.40.50.720coord: 337..488
e-value: 2.4E-58
score: 198.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 111..128
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 103..128
NoneNo IPR availablePANTHERPTHR23420:SF2ADENOSYLHOMOCYSTEINASE 3coord: 85..572
NoneNo IPR availableSUPERFAMILYSSF52283Formate/glycerate dehydrogenase catalytic domain-likecoord: 143..572
IPR015878S-adenosyl-L-homocysteine hydrolase, NAD binding domainSMARTSM00997AdoHcyase_NAD_2coord: 331..492
e-value: 1.7E-75
score: 266.8
IPR015878S-adenosyl-L-homocysteine hydrolase, NAD binding domainPFAMPF00670AdoHcyase_NADcoord: 332..491
e-value: 5.1E-60
score: 202.2
IPR000043Adenosylhomocysteinase-likeSMARTSM00996AdoHcyase_2coord: 145..571
e-value: 5.5E-205
score: 696.9
IPR000043Adenosylhomocysteinase-likePFAMPF05221AdoHcyasecoord: 285..571
e-value: 2.0E-45
score: 346.1
IPR000043Adenosylhomocysteinase-likePFAMPF05221AdoHcyasecoord: 145..281
e-value: 9.1E-56
score: 189.2
IPR000043Adenosylhomocysteinase-likePANTHERPTHR23420ADENOSYLHOMOCYSTEINASEcoord: 85..572
IPR000043Adenosylhomocysteinase-likeCDDcd00401SAHHcoord: 157..560
e-value: 0.0
score: 543.588
IPR042172Adenosylhomocysteinase-like superfamilyGENE3DG3DSA:3.40.50.1480coord: 489..572
e-value: 4.1E-27
score: 97.0
IPR042172Adenosylhomocysteinase-like superfamilyGENE3DG3DSA:3.40.50.1480coord: 134..283
e-value: 4.7E-54
score: 185.3
coord: 284..336
e-value: 2.2E-14
score: 55.1
IPR020082S-adenosyl-L-homocysteine hydrolase, conserved sitePROSITEPS00738ADOHCYASE_1coord: 217..231
IPR020082S-adenosyl-L-homocysteine hydrolase, conserved sitePROSITEPS00739ADOHCYASE_2coord: 353..369
IPR036291NAD(P)-binding domain superfamilySUPERFAMILYSSF51735NAD(P)-binding Rossmann-fold domainscoord: 332..490