slc8a-1

Overview
Nameslc8a-1 (AKN21455.1)
Smed IDSMED30029327
Length (bp)3407
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc8a-1 (SMED30029327) t-SNE clustered cells

Violin plots show distribution of expression levels for slc8a-1 (SMED30029327) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc8a-1 (SMED30029327) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc8a-1 (SMED30029327) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029327

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30029327SMESG000077236.1 dd_Smed_v4_3303_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30029327SMESG000077236.1 dd_Smed_v4_3303_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30029327SMESG000077236.1 dd_Smed_v4_3303_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30029327SMESG000077236.1 dd_Smed_v4_3303_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parapharyngeal cellSMED30029327SMESG000077236.1 dd_Smed_v4_3303_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
photoreceptor neuronSMED30029327SMESG000077236.1 SMED30029327smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30029327SMESG000077236.1 dd_Smed_v6_3303_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc8a-1 vs. Ensembl Human
Match: SLC8A3 (solute carrier family 8 member A3 [Source:HGNC Symbol;Acc:HGNC:11070])

HSP 1 Score: 833.558 bits (2152), Expect = 0.000e+0
Identity = 474/907 (52.26%), Postives = 623/907 (68.69%), Query Frame = 2
Query:  428 NGACESLNDTSCKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALE--GDHE--LHCNHSLEDAH-LDGDKKENLTELE-----KTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLER-RLSQDPDKLGLKEKENNNQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPR---AVTQDGKKVSI-NQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGG-TDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVSQSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            N +C   +D  CK+G++LP+W P    S+GDKIAR  VYFV+L+Y+FLGVSIIADRFMASIEVITS+ER+V ++K NGE  T  +R+WNETVSNLTLMALGSSAPEILLS+IE+CG  F AGDLGP TIVGSAAFN+FIIIG CVYVIPDGE R+IKHL VF ITA+WS+FAYIWLY+I+A FSP V+QVWE LLT FFF + VL A+VAD ++   K++ ++Y     +   +E  GDH   +  +  + ++H LDG    NL  LE     ++R + I ++++++ K+P  D   L E A    L+   KSRAFYR+QATR +TG+GN++KK   E+ + +    ++   E E+   K+FFDP  Y  +EN G   + V R G D  ++KTM  V+Y TEDG+A AG DY  T G V+ + GE QK   + IIDDDIFE DEHFF+ L + R      ++G   +I N L         L  P +AT+ +LDDDHAGIF FE     V+ES G  E+KV R+SGARG V+VP+R+   TA GG  D+ +    LEF ND+T   I+V I+D+ EYE+ E F I LGEP  +++             G + V++ K   ++   ++  I +MGKP LG+  +++VII+ES EFK  VD L++   L+  +GT SW++QF+EAITVS   ++ ED     EE+LPSC DYVMHFLT+FWKVLFA VPPT+Y  GW  F V I++IG LTA+IGDLAS FGCTIG+ ++VTA+ FVA GTS+PDTFASK AA+ D  AD+S+GNVTGSNAVNVFLGIGLAWS+AA+Y   +G  F V +G+L FSVT+F IFA   I+ +L RR   +GGELGGPR  K+ATT  FV LW++Y++ ++LE YC+IKGF
Sbjct:   45 NESCSGSSD--CKEGVILPIWYP-ENPSLGDKIARVIVYFVALIYMFLGVSIIADRFMASIEVITSQEREVTIKKPNGETSTTTIRVWNETVSNLTLMALGSSAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFIIIGICVYVIPDGETRKIKHLRVFFITAAWSIFAYIWLYMILAVFSPGVVQVWEGLLTLFFFPVCVLLAWVADKRLLFYKYMHKKYRTDKHRGIIIETEGDHPKGIEMDGKMMNSHFLDG----NLVPLEGKEVDESRREMIRILKDLKQKHPEKDLDQLVEMANYYALSHQQKSRAFYRIQATRMMTGAGNILKKHAAEQAKKASSMSEVHTDEPEDFISKVFFDPCSYQCLENCGAVLLTVVRKGGD--MSKTMY-VDYKTEDGSANAGADYEFTEGTVVLKPGETQKEFSVGIIDDDIFEEDEHFFVRLSNVRIEEEQPEEGMPPAIFNSLPLPRAV---LASPCVATVTILDDDHAGIFTFECDTIHVSESIGVMEVKVLRTSGARGTVIVPFRTVEGTAKGGGEDFEDTYGELEFKNDETVKTIRVKIVDEEEYERQENFFIALGEPKWMER-------------GISDVTDRKLTMEE--EEAKRIAEMGKPVLGEHPKLEVIIEESYEFKTTVDKLIKKTNLALVVGTHSWRDQFMEAITVSAAGDEDEDE--SGEERLPSCFDYVMHFLTVFWKVLFACVPPTEYCHGWACFAVSILIIGMLTAIIGDLASHFGCTIGLKDSVTAVVFVAFGTSVPDTFASKAAALQDVYADASIGNVTGSNAVNVFLGIGLAWSVAAIYWALQGQEFHVSAGTLAFSVTLFTIFAFVCISVLLYRRRPHLGGELGGPRGCKLATTWLFVSLWLLYILFATLEAYCYIKGF 921          
BLAST of slc8a-1 vs. Ensembl Human
Match: SLC8A3 (solute carrier family 8 member A3 [Source:HGNC Symbol;Acc:HGNC:11070])

HSP 1 Score: 830.861 bits (2145), Expect = 0.000e+0
Identity = 475/907 (52.37%), Postives = 622/907 (68.58%), Query Frame = 2
Query:  428 NGACESLNDTSCKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALE--GDHE--LHCNHSLEDAH-LDGDKKENLTELE-----KTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLER-RLSQDPDKLGLKEKENNNQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPR---AVTQDGKKVSI-NQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGG-TDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVSQSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            N +C   +D  CK+G++LP+W P    S+GDKIAR  VYFV+L+Y+FLGVSIIADRFMASIEVITS+ER+V ++K NGE  T  +R+WNETVSNLTLMALGSSAPEILLS+IE+CG  F AGDLGP TIVGSAAFN+FIIIG CVYVIPDGE R+IKHL VF ITA+WS+FAYIWLY+I+A FSP V+QVWE LLT FFF + VL A+VAD ++   K++ ++Y     +   +E  GDH   +  +  + ++H LDG    NL  LE     ++R + I ++++++ K+P  D   L E A    L+   KSRAFYR+QATR +TG+GN++KK   E+ + +    ++   E E+   K+FFDP  Y  +EN G   + V R G D  ++KTM  V+Y TEDG+A AG DY  T G V+ + GE QK   + IIDDDIFE DEHFF+ L + R      ++G   +I N L         L  P +AT+ +LDDDHAGIF FE     V+ES G  E+KV R+SGARG V+VP+R+   TA GG  D+ +    LEF ND+T   I+V I+D+ EYE+ E F I LGEP  +++ GI    +  + T      E +        ++  I +MGKP LG+  +++VII+ES EFK  VD L++   L+  +GT SW++QF+EAITVS   ++ ED     EE+LPSC DYVMHFLT+FWKVLFA VPPT+Y  GW  F V I++IG LTA+IGDLAS FGCTIG+ ++VTA+ FVA GTS+PDTFASK AA+ D  AD+S+GNVTGSNAVNVFLGIGLAWS+AA+Y   +G  F V +G+L FSVT+F IFA   I+ +L RR   +GGELGGPR  K+ATT  FV LW++Y++ ++LE YC+IKGF
Sbjct:   45 NESCSGSSD--CKEGVILPIWYP-ENPSLGDKIARVIVYFVALIYMFLGVSIIADRFMASIEVITSQEREVTIKKPNGETSTTTIRVWNETVSNLTLMALGSSAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFIIIGICVYVIPDGETRKIKHLRVFFITAAWSIFAYIWLYMILAVFSPGVVQVWEGLLTLFFFPVCVLLAWVADKRLLFYKYMHKKYRTDKHRGIIIETEGDHPKGIEMDGKMMNSHFLDG----NLVPLEGKEVDESRREMIRILKDLKQKHPEKDLDQLVEMANYYALSHQQKSRAFYRIQATRMMTGAGNILKKHAAEQAKKASSMSEVHTDEPEDFISKVFFDPCSYQCLENCGAVLLTVVRKGGD--MSKTMY-VDYKTEDGSANAGADYEFTEGTVVLKPGETQKEFSVGIIDDDIFEEDEHFFVRLSNVRIEEEQPEEGMPPAIFNSLPLPRAV---LASPCVATVTILDDDHAGIFTFECDTIHVSESIGVMEVKVLRTSGARGTVIVPFRTVEGTAKGGGEDFEDTYGELEFKNDETVKTIRVKIVDEEEYERQENFFIALGEPKWMER-GISALLLSPDVTDRKLTMEEE--------EAKRIAEMGKPVLGEHPKLEVIIEESYEFKTTVDKLIKKTNLALVVGTHSWRDQFMEAITVSAAGDEDEDE--SGEERLPSCFDYVMHFLTVFWKVLFACVPPTEYCHGWACFAVSILIIGMLTAIIGDLASHFGCTIGLKDSVTAVVFVAFGTSVPDTFASKAAALQDVYADASIGNVTGSNAVNVFLGIGLAWSVAAIYWALQGQEFHVSAGTLAFSVTLFTIFAFVCISVLLYRRRPHLGGELGGPRGCKLATTWLFVSLWLLYILFATLEAYCYIKGF 927          
BLAST of slc8a-1 vs. Ensembl Human
Match: SLC8A3 (solute carrier family 8 member A3 [Source:HGNC Symbol;Acc:HGNC:11070])

HSP 1 Score: 829.321 bits (2141), Expect = 0.000e+0
Identity = 474/911 (52.03%), Postives = 621/911 (68.17%), Query Frame = 2
Query:  428 NGACESLNDTSCKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALE--GDHE--LHCNHSLEDAH-LDGDKKENLTELE-----KTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLER-RLSQDPDKLGLKEKENNNQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPR---AVTQDGKKVSI-NQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGG-TDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVSQSSE----IEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            N +C   +D  CK+G++LP+W P    S+GDKIAR  VYFV+L+Y+FLGVSIIADRFMASIEVITS+ER+V ++K NGE  T  +R+WNETVSNLTLMALGSSAPEILLS+IE+CG  F AGDLGP TIVGSAAFN+FIIIG CVYVIPDGE R+IKHL VF ITA+WS+FAYIWLY+I+A FSP V+QVWE LLT FFF + VL A+VAD ++   K++ ++Y     +   +E  GDH   +  +  + ++H LDG    NL  LE     ++R + I ++++++ K+P  D   L E A    L+   KSRAFYR+QATR +TG+GN++KK   E+ + +    ++   E E+   K+FFDP  Y  +EN G   + V R G D  ++KTM  V+Y TEDG+A AG DY  T G V+ + GE QK   + IIDDDIFE DEHFF+ L + R      ++G   +I N L         L  P +AT+ +LDDDHAGIF FE     V+ES G  E+KV R+SGARG V+VP+R+   TA GG  D+ +    LEF ND+T   I+V I+D+ EYE+ E F I LGEP  +++                 +S +    D+ ++   E    I +MGKP LG+  +++VII+ES EFK  VD L++   L+  +GT SW++QF+EAITVS   ++ ED     EE+LPSC DYVMHFLT+FWKVLFA VPPT+Y  GW  F V I++IG LTA+IGDLAS FGCTIG+ ++VTA+ FVA GTS+PDTFASK AA+ D  AD+S+GNVTGSNAVNVFLGIGLAWS+AA+Y   +G  F V +G+L FSVT+F IFA   I+ +L RR   +GGELGGPR  K+ATT  FV LW++Y++ ++LE YC+IKGF
Sbjct:   45 NESCSGSSD--CKEGVILPIWYP-ENPSLGDKIARVIVYFVALIYMFLGVSIIADRFMASIEVITSQEREVTIKKPNGETSTTTIRVWNETVSNLTLMALGSSAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFIIIGICVYVIPDGETRKIKHLRVFFITAAWSIFAYIWLYMILAVFSPGVVQVWEGLLTLFFFPVCVLLAWVADKRLLFYKYMHKKYRTDKHRGIIIETEGDHPKGIEMDGKMMNSHFLDG----NLVPLEGKEVDESRREMIRILKDLKQKHPEKDLDQLVEMANYYALSHQQKSRAFYRIQATRMMTGAGNILKKHAAEQAKKASSMSEVHTDEPEDFISKVFFDPCSYQCLENCGAVLLTVVRKGGD--MSKTMY-VDYKTEDGSANAGADYEFTEGTVVLKPGETQKEFSVGIIDDDIFEEDEHFFVRLSNVRIEEEQPEEGMPPAIFNSLPLPRAV---LASPCVATVTILDDDHAGIFTFECDTIHVSESIGVMEVKVLRTSGARGTVIVPFRTVEGTAKGGGEDFEDTYGELEFKNDETVKTIRVKIVDEEEYERQENFFIALGEPKWMER----------------GISALLLSPDRKLTMEEEEAKRIAEMGKPVLGEHPKLEVIIEESYEFKTTVDKLIKKTNLALVVGTHSWRDQFMEAITVSAAGDEDEDE--SGEERLPSCFDYVMHFLTVFWKVLFACVPPTEYCHGWACFAVSILIIGMLTAIIGDLASHFGCTIGLKDSVTAVVFVAFGTSVPDTFASKAAALQDVYADASIGNVTGSNAVNVFLGIGLAWSVAAIYWALQGQEFHVSAGTLAFSVTLFTIFAFVCISVLLYRRRPHLGGELGGPRGCKLATTWLFVSLWLLYILFATLEAYCYIKGF 924          
BLAST of slc8a-1 vs. Ensembl Human
Match: SLC8A1 (solute carrier family 8 member A1 [Source:HGNC Symbol;Acc:HGNC:11068])

HSP 1 Score: 820.076 bits (2117), Expect = 0.000e+0
Identity = 467/937 (49.84%), Postives = 620/937 (66.17%), Query Frame = 2
Query:  428 NGACESLNDTSCKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALE--GDH-----ELHCNHSLEDAH----LDG----DKKENLTELEKTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLER-RLSQDPDKLGLKEKENNN-QKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXX---XXXXXXXXXXXXXNLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGG-TDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFN----------HVSE------VKTHSDQ------LVSQSSE---IEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            N   E      CKKG++LP+W+P    S GDKIARA VYFV+++Y+FLGVSIIADRFM+SIEVITS+E+++ ++K NGE     VRIWNETVSNLTLMALGSSAPEILLSVIE+CG NF AGDLGP TIVGSAAFN+FIII  CVYV+PDGE R+IKHL VF +TA+WS+FAY WLY+I++  SP V++VWE LLTFFFF + V+ A+VAD ++   K++ +RY     +   +E  GD      E+  +  + ++H    LDG    +  E   + E+ R +   +++E++ K+P+ + + L E A  +VL++  KSRAFYR+QATR +TG+GN++K+   ++ R +    ++  +  EN+   KIFF+ G Y  +EN GT  + + R G D       + V++ TEDGTA AG DY  T G V+F+ G+ QK I + II     +  E       N+K     ++DG  +  N ++     G     P  AT+ + DDDHAGIF FEE  T V+ES G  E+KV R+SGARG V+VPY++   TA GG  D+ +    LEF ND+    I V +IDD EYEK++ F +E+GEP LV+     K+ +  E  GF           H  E      V T +D+      L S+  E   I +MG+P LG+  +++VII+ES EFK  VD L++   L+  +GT+SW+EQF+EAITVS    + +D D+  EEKLPSC DYVMHFLT+FWKVLFAFVPPT+Y  GW  F V I++IG LTA IGDLAS FGCTIG+ ++VTA+ FVA+GTS+PDTFASKVAA  D  AD+S+GNVTGSNAVNVFLGIG+AWSIAA+YH   G  F+V  G+L FSVT+F IFA   +  +L RR   +GGELGGPR  K+ T+  FV LW++Y+  SSLE YCHIKGF
Sbjct:   44 NETGECTGSYYCKKGVILPIWEP-QDPSFGDKIARATVYFVAMVYMFLGVSIIADRFMSSIEVITSQEKEITIKKPNGETTKTTVRIWNETVSNLTLMALGSSAPEILLSVIEVCGHNFTAGDLGPSTIVGSAAFNMFIIIALCVYVVPDGETRKIKHLRVFFVTAAWSIFAYTWLYIILSVISPGVVEVWEGLLTFFFFPICVVFAWVADRRLLFYKYVYKRYRAGKQRGMIIEHEGDRPSSKTEIEMDGKVVNSHVENFLDGALVLEVDERDQDDEEARREMARILKELKQKHPDKEIEQLIELANYQVLSQQQKSRAFYRIQATRLMTGAGNILKRHAADQARKAVSMHEVNTEVTENDPVSKIFFEQGTYQCLENCGTVALTIIRRGGD---LTNTVFVDFRTEDGTANAGSDYEFTEGTVVFKPGDTQKEIRVGIIDDDIFEEDENFLVHLSNVKVSSEASEDGI-LEANHVSTLACLG----SPSTATVTIFDDDHAGIFTFEEPVTHVSESIGIMEVKVLRTSGARGNVIVPYKTIEGTARGGGEDFEDTCGELEFQNDEIVKTISVKVIDDEEYEKNKTFFLEIGEPRLVEMSE-KKALLLNELGGFTITGQPVFRKVHAREHPILSTVITIADEYDDKQPLTSKEEEERRIAEMGRPILGEHTKLEVIIEESYEFKSTVDKLIKKTNLALVVGTNSWREQFIEAITVSA--GEDDDDDECGEEKLPSCFDYVMHFLTVFWKVLFAFVPPTEYWNGWACFIVSILMIGLLTAFIGDLASHFGCTIGLKDSVTAVVFVALGTSVPDTFASKVAATQDQYADASIGNVTGSNAVNVFLGIGVAWSIAAIYHAANGEQFKVSPGTLAFSVTLFTIFAFINVGVLLYRRRPEIGGELGGPRTAKLLTSCLFVLLWLLYIFFSSLEAYCHIKGF 968          
BLAST of slc8a-1 vs. Ensembl Human
Match: SLC8A3 (solute carrier family 8 member A3 [Source:HGNC Symbol;Acc:HGNC:11070])

HSP 1 Score: 819.305 bits (2115), Expect = 0.000e+0
Identity = 470/911 (51.59%), Postives = 617/911 (67.73%), Query Frame = 2
Query:  428 NGACESLNDTSCKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALE--GDHE--LHCNHSLEDAH-LDGDKKENLTELE-----KTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLER-RLSQDPDKLGLKEKENNNQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPR---AVTQDGKKVSI-NQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGG-TDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVSQSSE----IEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            N +C   +D  CK+G++LP+W P    S+GDKIAR  VYFV+L+Y+FLGVSIIADRFMASIEVITS+ER+V ++K NGE  T  +R+WNETVSNLTLMALGSSAPEILLS+IE+CG  F AGDLGP TIVGSAAFN+FIIIG CVYVIPDGE R+IKHL VF ITA+WS+FAYIWLY+I+A FSP V+QVWE LLT FFF + VL A+VAD ++   K++ ++Y     +   +E  GDH   +  +  + ++H LDG    NL  LE     ++R + I ++++++ K+P  D   L E A    L+   KSRAFYR+QATR +TG+GN++KK   E+ + +    ++   E E+   K+FFDP  Y  +EN G   + V R G D  ++KTM  V+Y TEDG+A AG DY  T G V+ + GE QK   + IIDDDIFE DEHFF+ L + R      ++G   +I N L         L  P +AT+ +LDDDHAGIF FE     V+ES G  E+KV R+SGARG V+VP+R+   TA GG  D+ +    LEF ND+T   I + +IDD  YEK++ + IE+  P +V                 +    +    D+ ++   E    I +MGKP LG+  +++VII+ES EFK  VD L++   L+  +GT SW++QF+EAITVS   ++ ED     EE+LPSC DYVMHFLT+FWKVLFA VPPT+Y  GW  F V I++IG LTA+IGDLAS FGCTIG+ ++VTA+ FVA GTS+PDTFASK AA+ D  AD+S+GNVTGSNAVNVFLGIGLAWS+AA+Y   +G  F V +G+L FSVT+F IFA   I+ +L RR   +GGELGGPR  K+ATT  FV LW++Y++ ++LE YC+IKGF
Sbjct:   45 NESCSGSSD--CKEGVILPIWYP-ENPSLGDKIARVIVYFVALIYMFLGVSIIADRFMASIEVITSQEREVTIKKPNGETSTTTIRVWNETVSNLTLMALGSSAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFIIIGICVYVIPDGETRKIKHLRVFFITAAWSIFAYIWLYMILAVFSPGVVQVWEGLLTLFFFPVCVLLAWVADKRLLFYKYMHKKYRTDKHRGIIIETEGDHPKGIEMDGKMMNSHFLDG----NLVPLEGKEVDESRREMIRILKDLKQKHPEKDLDQLVEMANYYALSHQQKSRAFYRIQATRMMTGAGNILKKHAAEQAKKASSMSEVHTDEPEDFISKVFFDPCSYQCLENCGAVLLTVVRKGGD--MSKTMY-VDYKTEDGSANAGADYEFTEGTVVLKPGETQKEFSVGIIDDDIFEEDEHFFVRLSNVRIEEEQPEEGMPPAIFNSLPLPRAV---LASPCVATVTILDDDHAGIFTFECDTIHVSESIGVMEVKVLRTSGARGTVIVPFRTVEGTAKGGGEDFEDTYGELEFKNDETVKTIHIKVIDDEAYEKNKNYFIEMMGPRMVD---------------MSFQKALLLSPDRKLTMEEEEAKRIAEMGKPVLGEHPKLEVIIEESYEFKTTVDKLIKKTNLALVVGTHSWRDQFMEAITVSAAGDEDEDE--SGEERLPSCFDYVMHFLTVFWKVLFACVPPTEYCHGWACFAVSILIIGMLTAIIGDLASHFGCTIGLKDSVTAVVFVAFGTSVPDTFASKAAALQDVYADASIGNVTGSNAVNVFLGIGLAWSVAAIYWALQGQEFHVSAGTLAFSVTLFTIFAFVCISVLLYRRRPHLGGELGGPRGCKLATTWLFVSLWLLYILFATLEAYCYIKGF 925          
BLAST of slc8a-1 vs. Ensembl Celegans
Match: ncx-2 (Na/Ca eXchangers [Source:UniProtKB/TrEMBL;Acc:H2KYP4])

HSP 1 Score: 805.438 bits (2079), Expect = 0.000e+0
Identity = 444/933 (47.59%), Postives = 624/933 (66.88%), Query Frame = 2
Query:  377 CIVVIEFLSWIQCEPLKNGACESLNDT-SCKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALEGDHELHCNHSLEDAHLDGDKKENLTELEKTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLERRLSQDPDKL---GLKEKENNNQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGGTDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFT-------GFNHVSEVKTHSDQ---------LVSQSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPS-----CLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            C + + FL  +         C + + T +C  G+V+P+W+P   L+ GD++ R  +YF  + Y+FLG+SI+ADRFM+SIEVITS ER ++V++   +   + VRIWN+TVSNLTLMALGSSAPEILLS+IE+    FEAGDLGP TIVGSAAFNLF+II  CV VIP GE+RR KHL VF +TA+WSVFAY+WLYLI+AFFSP  I++WE  LTF FF LTV TAY+AD K+   KFL  RY R +          E+     LE+    GD    L   E+ R ++IE++REIR +NP+I P  L++QA+ E+++R PKSRAFYR+QATR L G G+++KK ++++  ++  D L     K+  +N  KIF DP HYTV+E+VG+F+V+V R G  + +    + V+Y TEDG+A AG DYI   G + F   +  + + I ++DDD+FE DEHF++ L + R  T+DG  +   ++    +  +E+  P  ATIM+LDDDHAG+F FE     V E+CG   +++ R SGARG V++P+R+   TA+    +   E  + F ++QTEA +++ I+D  +YE+ +YF+IEL  PI  KK     S I + F        G +  SE K  + +         L     EI +MGKPRLG+  + ++ I+ES EF+ +VD ++++      +GT SW+EQF+EA+ VS G++D ++ +D  + +        C+DYVMH LT+ WK+ FA +PPTDY GGW +F V I +IG LTAV+GDLAS FGC +G+ +AVTAI+FVA+GTS+PDTFASKV+A+ D  AD++VGNVTGSNAVNVFLGIG+AWS+AA+YH+ +G+ F V  G+LGFSV +FC  A+  I  ++LRRN++VGGELGGP  L+  T ++F  LW +Y++LS+LE YC I GF
Sbjct:    6 CWLAVAFLVALAGLADAGSNCSAADATRNCIDGLVIPIWRPFLDLTTGDRVLRGVLYFFVIAYMFLGISIVADRFMSSIEVITSMERTIVVKRPGLDPMAVQVRIWNDTVSNLTLMALGSSAPEILLSIIEVIARGFEAGDLGPNTIVGSAAFNLFMIIAICVVVIPKGEIRRQKHLDVFCVTATWSVFAYVWLYLILAFFSPGEIEIWEGALTFIFFPLTVFTAYMADIKLIQNKFLPHRYRRGSHGQMIATEAEEMKM---LENG-TQGDPA--LKAFEEHRQEFIELMREIRKQNPHITPTELQKQAEYEMISRGPKSRAFYRVQATRRLIGGGDIVKK-RIDKEHNKALDALVQAQEKQSRDNTCKIFLDPAHYTVLESVGSFDVVVGRDGGPDGLT---VMVDYFTEDGSANAGSDYIPVKGTLTFYPEDKHQKVTIEVVDDDVFEEDEHFYLRLCNLRVRTKDGIIIDPTRIGGLPVAQLEM--PNTATIMILDDDHAGVFGFEHDHFQVVENCGHLSLQMKRHSGARGKVIIPFRTVEGTASADKHFEMKEGEIVFEDNQTEALVEIGIVDTEQYERSDYFYIELSPPIWAKKMN-DLSRIQERFQRRMERKRGSSVASESKDSNTENGDDEVTTSLTPSQLEIAEMGKPRLGEFTKCQITIRESKEFQGIVDRMIKNANTRIMLGTHSWREQFMEALVVSAGDDDDDEGEDGEDGEEKEPEEPGCMDYVMHVLTVPWKLTFATIPPTDYFGGWATFVVAIFMIGVLTAVVGDLASQFGCWVGLKDAVTAISFVALGTSVPDTFASKVSAVQDKYADNAVGNVTGSNAVNVFLGIGIAWSMAAIYHWNQGTKFLVDPGNLGFSVLIFCTEAVLCIIVLVLRRNKKVGGELGGPIALRWMTAMFFASLWFMYLLLSALEAYCIIPGF 925          
BLAST of slc8a-1 vs. Ensembl Celegans
Match: ncx-1 (Na/Ca eXchangers; Sodium-calcium exchanger [Source:UniProtKB/TrEMBL;Acc:G5EF08])

HSP 1 Score: 682.174 bits (1759), Expect = 0.000e+0
Identity = 404/894 (45.19%), Postives = 544/894 (60.85%), Query Frame = 2
Query:  461 CKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALEGDHELHCNHSLED----AHLDGDKKENLT-------ELEKTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLERRLSQDPDKLGLKEKENNNQKIFFDPGHYTVMENVGTFNVMVK--RTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGGTDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVSQSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRR-NRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            C  G+++P+W+P   LS      RA VY ++L YLF GVSI+ADRFMASIEVITS+++ V ++K  GE  TI VR+WNETVSNLTLMALGSSAPEILLSVIEICG+NFEAG+LGP TIVGSAAFNLFIII  C+  IP+GE RR++H  VF +T  WS FAY+WLYLI++ FSP  ++VWE +LTF FF LTV +AY AD          +R +   + S+            + E+    A L GD  +NL          E  R  Y+++ +++R ++P+     LE+ A  +V+    KSRAFYR+Q TR + GSG++ KK K   +L  +P  +     +     + FDP HYT +ENVG   + VK  R    E    T + V Y T   TA A  D++ T G + F+ G+ ++ I++ I+D+DI+E DE F + L   RA   +       +L      G+       AT++++DDDHAG F F   +    ESCG    +V RS GARG V +PY++    A    DY   E  L+F ++Q++A I + I++D+EYEK E F+IELGEPI  +                           +L      IE  GKP LG     KV+I E  EFK+ +D  L     S  +GTSSWK+QF EA T+ P E D E           + ++ VMH++ L WK+LFA +PPTDY  GW+ F V I +IG LTA IGD+A+ FGCT+G+ ++VTA+T VAMGTSLPDTFAS+ AA+ D  AD S+GNVTGSNAVNVFLGIG+AW IAA  H ++G+ F V +GSL FSVT+F I ++  +A +  RR NR+V GELGGP   +I +   FV +W++Y++LS+LE YC IKGF
Sbjct:   50 CSPGVIVPVWQPSENLSECKIWFRAIVYLIALAYLFFGVSIVADRFMASIEVITSQQKSVKMKKITGEHFTIMVRVWNETVSNLTLMALGSSAPEILLSVIEICGNNFEAGELGPSTIVGSAAFNLFIIIAVCIMAIPNGETRRVQHNGVFWVTVVWSTFAYVWLYLILSVFSPGEVEVWEGVLTFVFFPLTVGSAYFADAH---AGQFGQRLISGPLSSFVRRSPRRSPSKKTRENVENGAGLPGDATQNLIGGDADALAFEIHRRHYLDIFKQLRSEHPDAPVVELEKHAMEKVVGEQKKSRAFYRIQTTRKMIGSGDIQKKLKKSNKL--EPMVV-----QKTMATVEFDPPHYTCLENVGDVYLTVKCDRGSVPED---TTVTVHYRTIADTAQAESDFVHTEGTITFEPGQTEQKIKVGIVDNDIYEDDEQFMVRLSQVRAFRSEHFSSVPARL------GLAA----TATVIIVDDDHAGSFGFLSEKFKCTESCGSFVAEVIRSRGARGKVSIPYKTVDGAAKSPQDYEHQEGVLKFADEQSKAEIYIPIVNDDEYEKHEDFYIELGEPIWHR---------------------------ELADDEEGIE--GKPILG-FSRCKVVITEDREFKNFMDRALVTANTSIMVGTSSWKQQFTEAWTLEPEEEDGE----------VTTMEKVMHYIALPWKLLFALIPPTDYFNGWLCFVVAIAMIGLLTAFIGDIAAAFGCTVGLKDSVTALTLVAMGTSLPDTFASRTAAVGDQWADGSIGNVTGSNAVNVFLGIGIAWMIAACVHAYRGTKFLVATGSLAFSVTMFLIGSVVCVALLQYRRFNRKVNGELGGPMGWRIISAGIFVSVWLLYILLSTLEAYCIIKGF 880          
BLAST of slc8a-1 vs. Ensembl Celegans
Match: ncx-1 (Na/Ca eXchangers; Sodium-calcium exchanger [Source:UniProtKB/TrEMBL;Acc:G5EF08])

HSP 1 Score: 682.174 bits (1759), Expect = 0.000e+0
Identity = 404/894 (45.19%), Postives = 544/894 (60.85%), Query Frame = 2
Query:  461 CKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALEGDHELHCNHSLED----AHLDGDKKENLT-------ELEKTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLERRLSQDPDKLGLKEKENNNQKIFFDPGHYTVMENVGTFNVMVK--RTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGGTDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVSQSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRR-NRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            C  G+++P+W+P   LS      RA VY ++L YLF GVSI+ADRFMASIEVITS+++ V ++K  GE  TI VR+WNETVSNLTLMALGSSAPEILLSVIEICG+NFEAG+LGP TIVGSAAFNLFIII  C+  IP+GE RR++H  VF +T  WS FAY+WLYLI++ FSP  ++VWE +LTF FF LTV +AY AD          +R +   + S+            + E+    A L GD  +NL          E  R  Y+++ +++R ++P+     LE+ A  +V+    KSRAFYR+Q TR + GSG++ KK K   +L  +P  +     +     + FDP HYT +ENVG   + VK  R    E    T + V Y T   TA A  D++ T G + F+ G+ ++ I++ I+D+DI+E DE F + L   RA   +       +L      G+       AT++++DDDHAG F F   +    ESCG    +V RS GARG V +PY++    A    DY   E  L+F ++Q++A I + I++D+EYEK E F+IELGEPI  +                           +L      IE  GKP LG     KV+I E  EFK+ +D  L     S  +GTSSWK+QF EA T+ P E D E           + ++ VMH++ L WK+LFA +PPTDY  GW+ F V I +IG LTA IGD+A+ FGCT+G+ ++VTA+T VAMGTSLPDTFAS+ AA+ D  AD S+GNVTGSNAVNVFLGIG+AW IAA  H ++G+ F V +GSL FSVT+F I ++  +A +  RR NR+V GELGGP   +I +   FV +W++Y++LS+LE YC IKGF
Sbjct:   50 CSPGVIVPVWQPSENLSECKIWFRAIVYLIALAYLFFGVSIVADRFMASIEVITSQQKSVKMKKITGEHFTIMVRVWNETVSNLTLMALGSSAPEILLSVIEICGNNFEAGELGPSTIVGSAAFNLFIIIAVCIMAIPNGETRRVQHNGVFWVTVVWSTFAYVWLYLILSVFSPGEVEVWEGVLTFVFFPLTVGSAYFADAH---AGQFGQRLISGPLSSFVRRSPRRSPSKKTRENVENGAGLPGDATQNLIGGDADALAFEIHRRHYLDIFKQLRSEHPDAPVVELEKHAMEKVVGEQKKSRAFYRIQTTRKMIGSGDIQKKLKKSNKL--EPMVV-----QKTMATVEFDPPHYTCLENVGDVYLTVKCDRGSVPED---TTVTVHYRTIADTAQAESDFVHTEGTITFEPGQTEQKIKVGIVDNDIYEDDEQFMVRLSQVRAFRSEHFSSVPARL------GLAA----TATVIIVDDDHAGSFGFLSEKFKCTESCGSFVAEVIRSRGARGKVSIPYKTVDGAAKSPQDYEHQEGVLKFADEQSKAEIYIPIVNDDEYEKHEDFYIELGEPIWHR---------------------------ELADDEEGIE--GKPILG-FSRCKVVITEDREFKNFMDRALVTANTSIMVGTSSWKQQFTEAWTLEPEEEDGE----------VTTMEKVMHYIALPWKLLFALIPPTDYFNGWLCFVVAIAMIGLLTAFIGDIAAAFGCTVGLKDSVTALTLVAMGTSLPDTFASRTAAVGDQWADGSIGNVTGSNAVNVFLGIGIAWMIAACVHAYRGTKFLVATGSLAFSVTMFLIGSVVCVALLQYRRFNRKVNGELGGPMGWRIISAGIFVSVWLLYILLSTLEAYCIIKGF 880          
BLAST of slc8a-1 vs. Ensembl Celegans
Match: ncx-1 (Na/Ca eXchangers; Sodium-calcium exchanger [Source:UniProtKB/TrEMBL;Acc:G5EF08])

HSP 1 Score: 610.142 bits (1572), Expect = 0.000e+0
Identity = 370/834 (44.36%), Postives = 493/834 (59.11%), Query Frame = 2
Query:  419 PLKNGACESLNDTSCKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALEGDHELHCNHSLED----AHLDGDKKENLT-------ELEKTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLERRLSQDPDKLGLKEKENNNQKIFFDPGHYTVMENVGTFNVMVK--RTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGGTDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVSQSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTF 2881
            P    AC       C  G+++P+W+P   LS      RA VY ++L YLF GVSI+ADRFMASIEVITS+++ V ++K  GE  TI VR+WNETVSNLTLMALGSSAPEILLSVIEICG+NFEAG+LGP TIVGSAAFNLFIII  C+  IP+GE RR++H  VF +T  WS FAY+WLYLI++ FSP  ++VWE +LTF FF LTV +AY AD          +R +   + S+            + E+    A L GD  +NL          E  R  Y+++ +++R ++P+     LE+ A  +V+    KSRAFYR+Q TR + GSG++ KK K         +KL     +     + FDP HYT +ENVG   + VK  R    E    T + V Y T   TA A  D++ T G + F+ G+ ++ I++ I+D+DI+E DE F + L   RA   +       +L      G+       AT++++DDDHAG F F   +    ESCG    +V RS GARG V +PY++    A    DY   E  L+F ++Q++A I + I++D+EYEK E F+IELGEPI  +                           +L      IE  GKP LG     KV+I E  EFK+ +D  L     S  +GTSSWK+QF EA T+ P E D E           + ++ VMH++ L WK+LFA +PPTDY  GW+ F V I +IG LTA IGD+A+ FGCT+G+ ++VTA+T VAMGTSLPDTFAS+ AA+ D  AD S+GNVTGSNAVNVFLGIG+AW IAA  H ++G+ F
Sbjct:   38 PGPEPACAPAK--PCSPGVIVPVWQPSENLSECKIWFRAIVYLIALAYLFFGVSIVADRFMASIEVITSQQKSVKMKKITGEHFTIMVRVWNETVSNLTLMALGSSAPEILLSVIEICGNNFEAGELGPSTIVGSAAFNLFIIIAVCIMAIPNGETRRVQHNGVFWVTVVWSTFAYVWLYLILSVFSPGEVEVWEGVLTFVFFPLTVGSAYFADAH---AGQFGQRLISGPLSSFVRRSPRRSPSKKTRENVENGAGLPGDATQNLIGGDADALAFEIHRRHYLDIFKQLRSEHPDAPVVELEKHAMEKVVGEQKKSRAFYRIQTTRKMIGSGDIQKKLK-------KSNKLEPMVVQKTMATVEFDPPHYTCLENVGDVYLTVKCDRGSVPED---TTVTVHYRTIADTAQAESDFVHTEGTITFEPGQTEQKIKVGIVDNDIYEDDEQFMVRLSQVRAFRSEHFSSVPARL------GLAA----TATVIIVDDDHAGSFGFLSEKFKCTESCGSFVAEVIRSRGARGKVSIPYKTVDGAAKSPQDYEHQEGVLKFADEQSKAEIYIPIVNDDEYEKHEDFYIELGEPIWHR---------------------------ELADDEEGIE--GKPILG-FSRCKVVITEDREFKNFMDRALVTANTSIMVGTSSWKQQFTEAWTLEPEEEDGE----------VTTMEKVMHYIALPWKLLFALIPPTDYFNGWLCFVVAIAMIGLLTAFIGDIAAAFGCTVGLKDSVTALTLVAMGTSLPDTFASRTAAVGDQWADGSIGNVTGSNAVNVFLGIGIAWMIAACVHAYRGTKF 806          
BLAST of slc8a-1 vs. Ensembl Celegans
Match: ncx-2 (Na/Ca eXchangers [Source:UniProtKB/TrEMBL;Acc:H2KYP4])

HSP 1 Score: 503.056 bits (1294), Expect = 5.405e-161
Identity = 280/597 (46.90%), Postives = 396/597 (66.33%), Query Frame = 2
Query:  377 CIVVIEFLSWIQCEPLKNGACESLNDT-SCKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALEGDHELHCNHSLEDAHLDGDKKENLTELEKTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLERRLSQDPDKLGLKEKENNNQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGGTDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKK 2164
            C + + FL  +         C + + T +C  G+V+P+W+P   L+ GD++ R  +YF  + Y+FLG+SI+ADRFM+SIEVITS ER ++V++   +   + VRIWN+TVSNLTLMALGSSAPEILLS+IE+    FEAGDLGP TIVGSAAFNLF+II  CV VIP GE+RR KHL VF +TA+WSVFAY+WLYLI+AFFSP  I++WE  LTF FF LTV TAY+AD K+   KFL  RY R +          E+     LE+    GD    L   E+ R ++IE++REIR +NP+I P  L++QA+ E+++R PKSRAFYR+QATR L G G+++KK ++++  ++  D    K+  +N  KIF DP HYTV+E+VG+F+V+V R G  + +    + V+Y TEDG+A AG DYI   G + F   +  + + I ++DDD+FE DEHF++ L + R  T+DG  +   ++    +  +E+  P  ATIM+LDDDHAG+F FE     V E+CG   +++ R SGARG V++P+R+   TA+    +   E  + F ++QTEA +++ I+D  +YE+ +YF+IEL  PI  KK
Sbjct:    6 CWLAVAFLVALAGLADAGSNCSAADATRNCIDGLVIPIWRPFLDLTTGDRVLRGVLYFFVIAYMFLGISIVADRFMSSIEVITSMERTIVVKRPGLDPMAVQVRIWNDTVSNLTLMALGSSAPEILLSIIEVIARGFEAGDLGPNTIVGSAAFNLFMIIAICVVVIPKGEIRRQKHLDVFCVTATWSVFAYVWLYLILAFFSPGEIEIWEGALTFIFFPLTVFTAYMADIKLIQNKFLPHRYRRGSHGQMIATEAEEMKM---LENG-TQGDPA--LKAFEEHRQEFIELMREIRKQNPHITPTELQKQAEYEMISRGPKSRAFYRVQATRRLIGGGDIVKK-RIDKEHNKALDAAQEKQSRDNTCKIFLDPAHYTVLESVGSFDVVVGRDGGPDGLT---VMVDYFTEDGSANAGSDYIPVKGTLTFYPEDKHQKVTIEVVDDDVFEEDEHFYLRLCNLRVRTKDGIIIDPTRIGGLPVAQLEM--PNTATIMILDDDHAGVFGFEHDHFQVVENCGHLSLQMKRHSGARGKVIIPFRTVEGTASADKHFEMKEGEIVFEDNQTEALVEIGIVDTEQYERSDYFYIELSPPIWAKK 590          

HSP 2 Score: 293.123 bits (749), Expect = 1.319e-83
Identity = 147/276 (53.26%), Postives = 202/276 (73.19%), Query Frame = 2
Query: 2204 GFNHVSEVKTHSDQLVSQSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPS-----CLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKI 3016
            G N   EV T    L     EI +MGKPRLG+  + ++ I+ES EF+ +VD ++++      +GT SW+EQF+EA+ VS G++D ++ +D  + +        C+DYVMH LT+ WK+ FA +PPTDY GGW +F V I +IG LTAV+GDLAS FGC +G+ +AVTAI+FVA+GTS+PDTFASKV+A+ D  AD++VGNVTGSNAVNVFLGIG+AWS+AA+YH+ +G+ F V  G+LGFSV +FC  A+  I  ++LRRN++VGGELGGP  L++
Sbjct:  675 GGNGDDEVTT---SLTPSQLEIAEMGKPRLGEFTKCQITIRESKEFQGIVDRMIKNANTRIMLGTHSWREQFMEALVVSAGDDDDDEGEDGEDGEEKEPEEPGCMDYVMHVLTVPWKLTFATIPPTDYFGGWATFVVAIFMIGVLTAVVGDLASQFGCWVGLKDAVTAISFVALGTSVPDTFASKVSAVQDKYADNAVGNVTGSNAVNVFLGIGIAWSMAAIYHWNQGTKFLVDPGNLGFSVLIFCTEAVLCIIVLVLRRNKKVGGELGGPIALRV 947          

HSP 3 Score: 56.225 bits (134), Expect = 1.641e-7
Identity = 33/104 (31.73%), Postives = 55/104 (52.88%), Query Frame = 2
Query: 1865 DDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGV-VLVPYRSRSDTATGGTDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGI 2173
            D+   IF  + A   V ES G  ++ V R  G  G+ V+V Y +   +A  G+DYI V+  L F  +     + + ++DD+ +E+DE+F++ L    +  K GI
Sbjct:  361 DNTCKIF-LDPAHYTVLESVGSFDVVVGRDGGPDGLTVMVDYFTEDGSANAGSDYIPVKGTLTFYPEDKHQKVTIEVVDDDVFEEDEHFYLRLCNLRVRTKDGI 463          
BLAST of slc8a-1 vs. Ensembl Fly
Match: Calx (gene:FBgn0013995 transcript:FBtr0309205)

HSP 1 Score: 766.148 bits (1977), Expect = 0.000e+0
Identity = 437/902 (48.45%), Postives = 592/902 (65.63%), Query Frame = 2
Query:  461 CKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALEGDH---ELHCNHSLEDAHLDGDKKENLTELEKTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLERRLSQDPDKL------GLKEKENNNQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGGTDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVSQSSEIED--------------MGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRR-NRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIK 3094
            C +G+VLPLW P   +S+GD++ R FVYFV L+YLF+GVSIIADRFMA+IE ITS ER V+V+  N   Q ++VRIWNETV+NLTLMALGSSAPEILLSVIEI   +FE+GDLGPGTIVGSAA+NLF+II  C+  IP GEVRRI+HL VF +TA +SVFAY+WL+LI++ F+P VI VWEA++T  FF LTVL AY+A+ ++ + K++ + Y R N +   + G+H   E+      +   +   +  +    ++ R +YI ++ E+R K P+ D + LE  AQ +VL R  KSRAFYR+QATR + GSGN+++  K++ R   D  ++      G  E+ ++  +++F+PGHYTVMEN G F V V R G       T   VEY T+DGTA+AG D++   G++ F  G D++   I +IDDD+FE DE F+I L +P                     GV+L  P IAT+M+LDDDHAGIF F ++   + ES G  E+KV R SGARG V+VPY + +DTAT   DY      L F N+++E FI + I++++ YEKD  F + +GEP L       +S   + F    H  E  TH D+L ++  E+E               + KPR G++    V I+ES EFK  VD L+    +S  +GTSSWKEQF +A+TV P +  +E  +D  EE++PSC  YV HF+ LFWKVLFAFVPPTD  GG+V+F V I VIG +TA+IGD AS FGC + + ++VTAI FVA+GTS+PDTFAS +AA +D+ AD+ +GNVTGSNAVNVFLGIGLAW+IAAVYH   G TF V+ G++GF+V +FC  AL AI  ++ RR ++ +G ELGGP+  K  +    V LW+ YV++  LE Y  I+
Sbjct:  100 CSEGLVLPLWMPQRNISVGDRLVRGFVYFVLLIYLFVGVSIIADRFMAAIEAITSIERAVVVKGPNNTKQVMHVRIWNETVANLTLMALGSSAPEILLSVIEIYAKDFESGDLGPGTIVGSAAYNLFMIIAVCMIWIPAGEVRRIRHLRVFFVTALFSVFAYVWLWLILSVFTPGVILVWEAIVTLLFFPLTVLWAYIAERRLLVYKYMDKNY-RVNKRGTVVAGEHDQVEMDAEKGPKQPMVTSARGNDAEAFDEARREYITLLTELRQKYPDADLEQLEMMAQEQVLARSSKSRAFYRIQATRKMVGSGNLMR--KIQERAHSDLTEVKAQLHAGDDEEADDPIRMYFEPGHYTVMENCGEFEVRVVRRGD----ISTYASVEYETQDGTASAGTDFVGRKGLLSFPPGVDEQRFRIEVIDDDVFEEDECFYIRLFNPSE-------------------GVKLAVPMIATVMILDDDHAGIFAFTDSVFEITESVGRFELKVMRYSGARGTVIVPYWTENDTATESKDYEGARGELVFENNESEKFIDLFILEESSYEKDVSFKVHIGEPRLAPDDTNKESFFNRFFEKHEHSGE-PTH-DELAAKIKEVEKKPVQDLTELDRILLLSKPRNGELTTAYVRIRESQEFKATVDKLVAKANVSAVLGTSSWKEQFKDALTVIPADE-SEFDNDDEEEEVPSCFSYVSHFVCLFWKVLFAFVPPTDICGGYVTFVVSIFVIGVITAIIGDAASYFGCALNIKDSVTAILFVALGTSIPDTFASMIAAKHDEGADNCIGNVTGSNAVNVFLGIGLAWTIAAVYHSSHGMTFNVEPGTIGFAVALFCGEALIAIMLIMFRRWHKGIGAELGGPKVSKYISAAILVFLWVFYVVICILEAYDVIR 972          
BLAST of slc8a-1 vs. Ensembl Fly
Match: Calx (gene:FBgn0013995 transcript:FBtr0309202)

HSP 1 Score: 764.992 bits (1974), Expect = 0.000e+0
Identity = 431/888 (48.54%), Postives = 588/888 (66.22%), Query Frame = 2
Query:  461 CKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALEGDH---ELHCNHSLEDAHLDGDKKENLTELEKTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLERRLSQDPDKL------GLKEKENNNQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGGTDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVSQSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRR-NRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIK 3094
            C +G+VLPLW P   +S+GD++ R FVYFV L+YLF+GVSIIADRFMA+IE ITS ER V+V+  N   Q ++VRIWNETV+NLTLMALGSSAPEILLSVIEI   +FE+GDLGPGTIVGSAA+NLF+II  C+  IP GEVRRI+HL VF +TA +SVFAY+WL+LI++ F+P VI VWEA++T  FF LTVL AY+A+ ++ + K++ + Y R N +   + G+H   E+      +   +   +  +    ++ R +YI ++ E+R K P+ D + LE  AQ +VL R  KSRAFYR+QATR + GSGN+++  K++ R   D  ++      G  E+ ++  +++F+PGHYTVMEN G F V V R G       T   VEY T+DGTA+AG D++   G++ F  G D++   I +IDDD+FE DE F+I L +P                     GV+L  P IAT+M+LDDDHAGIF F ++   + ES G  E+KV R SGARG V+VPY + +DTAT   DY      L F N+++E FI + I++++ YEKD  F + +GEP            +  + T +  + EV+    Q +++   I  + KPR G++    V I+ES EFK  VD L+    +S  +GTSSWKEQF +A+TV P +  +E  +D  EE++PSC  YV HF+ LFWKVLFAFVPPTD  GG+V+F V I VIG +TA+IGD AS FGC + + ++VTAI FVA+GTS+PDTFAS +AA +D+ AD+ +GNVTGSNAVNVFLGIGLAW+IAAVYH   G TF V+ G++GF+V +FC  AL AI  ++ RR ++ +G ELGGP+  K  +    V LW+ YV++  LE Y  I+
Sbjct:  100 CSEGLVLPLWMPQRNISVGDRLVRGFVYFVLLIYLFVGVSIIADRFMAAIEAITSIERAVVVKGPNNTKQVMHVRIWNETVANLTLMALGSSAPEILLSVIEIYAKDFESGDLGPGTIVGSAAYNLFMIIAVCMIWIPAGEVRRIRHLRVFFVTALFSVFAYVWLWLILSVFTPGVILVWEAIVTLLFFPLTVLWAYIAERRLLVYKYMDKNY-RVNKRGTVVAGEHDQVEMDAEKGPKQPMVTSARGNDAEAFDEARREYITLLTELRQKYPDADLEQLEMMAQEQVLARSSKSRAFYRIQATRKMVGSGNLMR--KIQERAHSDLTEVKAQLHAGDDEEADDPIRMYFEPGHYTVMENCGEFEVRVVRRGD----ISTYASVEYETQDGTASAGTDFVGRKGLLSFPPGVDEQRFRIEVIDDDVFEEDECFYIRLFNPSE-------------------GVKLAVPMIATVMILDDDHAGIFAFTDSVFEITESVGRFELKVMRYSGARGTVIVPYWTENDTATESKDYEGARGELVFENNESEKFIDLFILEESSYEKDVSFKVHIGEP-----------RLAPDSTHYPKIKEVEKKPVQDLTELDRILLLSKPRNGELTTAYVRIRESQEFKATVDKLVAKANVSAVLGTSSWKEQFKDALTVIPADE-SEFDNDDEEEEVPSCFSYVSHFVCLFWKVLFAFVPPTDICGGYVTFVVSIFVIGVITAIIGDAASYFGCALNIKDSVTAILFVALGTSIPDTFASMIAAKHDEGADNCIGNVTGSNAVNVFLGIGLAWTIAAVYHSSHGMTFNVEPGTIGFAVALFCGEALIAIMLIMFRRWHKGIGAELGGPKVSKYISAAILVFLWVFYVVICILEAYDVIR 949          
BLAST of slc8a-1 vs. Ensembl Fly
Match: Calx (gene:FBgn0013995 transcript:FBtr0309204)

HSP 1 Score: 763.837 bits (1971), Expect = 0.000e+0
Identity = 433/888 (48.76%), Postives = 588/888 (66.22%), Query Frame = 2
Query:  461 CKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALEGDH---ELHCNHSLEDAHLDGDKKENLTELEKTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLERRLSQDPDKL------GLKEKENNNQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGGTDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVSQSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRR-NRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIK 3094
            C +G+VLPLW P   +S+GD++ R FVYFV L+YLF+GVSIIADRFMA+IE ITS ER V+V+  N   Q ++VRIWNETV+NLTLMALGSSAPEILLSVIEI   +FE+GDLGPGTIVGSAA+NLF+II  C+  IP GEVRRI+HL VF +TA +SVFAY+WL+LI++ F+P VI VWEA++T  FF LTVL AY+A+ ++ + K++ + Y R N +   + G+H   E+      +   +   +  +    ++ R +YI ++ E+R K P+ D + LE  AQ +VL R  KSRAFYR+QATR + GSGN+++  K++ R   D  ++      G  E+ ++  +++F+PGHYTVMEN G F V V R G       T   VEY T+DGTA+AG D++   G++ F  G D++   I +IDDD+FE DE F+I L +P                     GV+L  P IAT+M+LDDDHAGIF F ++   + ES G  E+KV R SGARG V+VPY + +DTAT   DY      L F N+++E FI + I++++ YEKD  F + +GEP L  +     S  P        + EV+    Q +++   I  + KPR G++    V I+ES EFK  VD L+    +S  +GTSSWKEQF +A+TV P +  +E  +D  EE++PSC  YV HF+ LFWKVLFAFVPPTD  GG+V+F V I VIG +TA+IGD AS FGC + + ++VTAI FVA+GTS+PDTFAS +AA +D+ AD+ +GNVTGSNAVNVFLGIGLAW+IAAVYH   G TF V+ G++GF+V +FC  AL AI  ++ RR ++ +G ELGGP+  K  +    V LW+ YV++  LE Y  I+
Sbjct:  100 CSEGLVLPLWMPQRNISVGDRLVRGFVYFVLLIYLFVGVSIIADRFMAAIEAITSIERAVVVKGPNNTKQVMHVRIWNETVANLTLMALGSSAPEILLSVIEIYAKDFESGDLGPGTIVGSAAYNLFMIIAVCMIWIPAGEVRRIRHLRVFFVTALFSVFAYVWLWLILSVFTPGVILVWEAIVTLLFFPLTVLWAYIAERRLLVYKYMDKNY-RVNKRGTVVAGEHDQVEMDAEKGPKQPMVTSARGNDAEAFDEARREYITLLTELRQKYPDADLEQLEMMAQEQVLARSSKSRAFYRIQATRKMVGSGNLMR--KIQERAHSDLTEVKAQLHAGDDEEADDPIRMYFEPGHYTVMENCGEFEVRVVRRGD----ISTYASVEYETQDGTASAGTDFVGRKGLLSFPPGVDEQRFRIEVIDDDVFEEDECFYIRLFNPSE-------------------GVKLAVPMIATVMILDDDHAGIFAFTDSVFEITESVGRFELKVMRYSGARGTVIVPYWTENDTATESKDYEGARGELVFENNESEKFIDLFILEESSYEKDVSFKVHIGEPRLAPEKH-EHSGEPTHDELAAKIKEVEKKPVQDLTELDRILLLSKPRNGELTTAYVRIRESQEFKATVDKLVAKANVSAVLGTSSWKEQFKDALTVIPADE-SEFDNDDEEEEVPSCFSYVSHFVCLFWKVLFAFVPPTDICGGYVTFVVSIFVIGVITAIIGDAASYFGCALNIKDSVTAILFVALGTSIPDTFASMIAAKHDEGADNCIGNVTGSNAVNVFLGIGLAWTIAAVYHSSHGMTFNVEPGTIGFAVALFCGEALIAIMLIMFRRWHKGIGAELGGPKVSKYISAAILVFLWVFYVVICILEAYDVIR 959          
BLAST of slc8a-1 vs. Ensembl Fly
Match: Calx (gene:FBgn0013995 transcript:FBtr0309203)

HSP 1 Score: 763.451 bits (1970), Expect = 0.000e+0
Identity = 433/890 (48.65%), Postives = 589/890 (66.18%), Query Frame = 2
Query:  461 CKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALEGDH---ELHCNHSLEDAHLDGDKKENLTELEKTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLERRLSQDPDKL------GLKEKENNNQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGGTDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTG--FNHVSEVKTHSDQLVSQSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRR-NRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIK 3094
            C +G+VLPLW P   +S+GD++ R FVYFV L+YLF+GVSIIADRFMA+IE ITS ER V+V+  N   Q ++VRIWNETV+NLTLMALGSSAPEILLSVIEI   +FE+GDLGPGTIVGSAA+NLF+II  C+  IP GEVRRI+HL VF +TA +SVFAY+WL+LI++ F+P VI VWEA++T  FF LTVL AY+A+ ++ + K++ + Y R N +   + G+H   E+      +   +   +  +    ++ R +YI ++ E+R K P+ D + LE  AQ +VL R  KSRAFYR+QATR + GSGN+++  K++ R   D  ++      G  E+ ++  +++F+PGHYTVMEN G F V V R G       T   VEY T+DGTA+AG D++   G++ F  G D++   I +IDDD+FE DE F+I L +P                     GV+L  P IAT+M+LDDDHAGIF F ++   + ES G  E+KV R SGARG V+VPY + +DTAT   DY      L F N+++E FI + I++++ YEKD  F + +GEP L       +S   + F       + EV+    Q +++   I  + KPR G++    V I+ES EFK  VD L+    +S  +GTSSWKEQF +A+TV P +  +E  +D  EE++PSC  YV HF+ LFWKVLFAFVPPTD  GG+V+F V I VIG +TA+IGD AS FGC + + ++VTAI FVA+GTS+PDTFAS +AA +D+ AD+ +GNVTGSNAVNVFLGIGLAW+IAAVYH   G TF V+ G++GF+V +FC  AL AI  ++ RR ++ +G ELGGP+  K  +    V LW+ YV++  LE Y  I+
Sbjct:  100 CSEGLVLPLWMPQRNISVGDRLVRGFVYFVLLIYLFVGVSIIADRFMAAIEAITSIERAVVVKGPNNTKQVMHVRIWNETVANLTLMALGSSAPEILLSVIEIYAKDFESGDLGPGTIVGSAAYNLFMIIAVCMIWIPAGEVRRIRHLRVFFVTALFSVFAYVWLWLILSVFTPGVILVWEAIVTLLFFPLTVLWAYIAERRLLVYKYMDKNY-RVNKRGTVVAGEHDQVEMDAEKGPKQPMVTSARGNDAEAFDEARREYITLLTELRQKYPDADLEQLEMMAQEQVLARSSKSRAFYRIQATRKMVGSGNLMR--KIQERAHSDLTEVKAQLHAGDDEEADDPIRMYFEPGHYTVMENCGEFEVRVVRRGD----ISTYASVEYETQDGTASAGTDFVGRKGLLSFPPGVDEQRFRIEVIDDDVFEEDECFYIRLFNPSE-------------------GVKLAVPMIATVMILDDDHAGIFAFTDSVFEITESVGRFELKVMRYSGARGTVIVPYWTENDTATESKDYEGARGELVFENNESEKFIDLFILEESSYEKDVSFKVHIGEPRLAPDDTNKESFFNRFFDDELAAKIKEVEKKPVQDLTELDRILLLSKPRNGELTTAYVRIRESQEFKATVDKLVAKANVSAVLGTSSWKEQFKDALTVIPADE-SEFDNDDEEEEVPSCFSYVSHFVCLFWKVLFAFVPPTDICGGYVTFVVSIFVIGVITAIIGDAASYFGCALNIKDSVTAILFVALGTSIPDTFASMIAAKHDEGADNCIGNVTGSNAVNVFLGIGLAWTIAAVYHSSHGMTFNVEPGTIGFAVALFCGEALIAIMLIMFRRWHKGIGAELGGPKVSKYISAAILVFLWVFYVVICILEAYDVIR 962          
BLAST of slc8a-1 vs. Ensembl Fly
Match: Calx (gene:FBgn0013995 transcript:FBtr0083999)

HSP 1 Score: 763.451 bits (1970), Expect = 0.000e+0
Identity = 431/888 (48.54%), Postives = 586/888 (65.99%), Query Frame = 2
Query:  461 CKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALEGDH---ELHCNHSLEDAHLDGDKKENLTELEKTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLERRLSQDPDKL------GLKEKENNNQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGGTDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVSQSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRR-NRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIK 3094
            C +G+VLPLW P   +S+GD++ R FVYFV L+YLF+GVSIIADRFMA+IE ITS ER V+V+  N   Q ++VRIWNETV+NLTLMALGSSAPEILLSVIEI   +FE+GDLGPGTIVGSAA+NLF+II  C+  IP GEVRRI+HL VF +TA +SVFAY+WL+LI++ F+P VI VWEA++T  FF LTVL AY+A+ ++ + K++ + Y R N +   + G+H   E+      +   +   +  +    ++ R +YI ++ E+R K P+ D + LE  AQ +VL R  KSRAFYR+QATR + GSGN+++  K++ R   D  ++      G  E+ ++  +++F+PGHYTVMEN G F V V R G       T   VEY T+DGTA+AG D++   G++ F  G D++   I +IDDD+FE DE F+I L +P                     GV+L  P IAT+M+LDDDHAGIF F ++   + ES G  E+KV R SGARG V+VPY + +DTAT   DY      L F N+++E FI + I++++ YEKD  F + +GEP L     +              + EV+    Q +++   I  + KPR G++    V I+ES EFK  VD L+    +S  +GTSSWKEQF +A+TV P +  +E  +D  EE++PSC  YV HF+ LFWKVLFAFVPPTD  GG+V+F V I VIG +TA+IGD AS FGC + + ++VTAI FVA+GTS+PDTFAS +AA +D+ AD+ +GNVTGSNAVNVFLGIGLAW+IAAVYH   G TF V+ G++GF+V +FC  AL AI  ++ RR ++ +G ELGGP+  K  +    V LW+ YV++  LE Y  I+
Sbjct:  100 CSEGLVLPLWMPQRNISVGDRLVRGFVYFVLLIYLFVGVSIIADRFMAAIEAITSIERAVVVKGPNNTKQVMHVRIWNETVANLTLMALGSSAPEILLSVIEIYAKDFESGDLGPGTIVGSAAYNLFMIIAVCMIWIPAGEVRRIRHLRVFFVTALFSVFAYVWLWLILSVFTPGVILVWEAIVTLLFFPLTVLWAYIAERRLLVYKYMDKNY-RVNKRGTVVAGEHDQVEMDAEKGPKQPMVTSARGNDAEAFDEARREYITLLTELRQKYPDADLEQLEMMAQEQVLARSSKSRAFYRIQATRKMVGSGNLMR--KIQERAHSDLTEVKAQLHAGDDEEADDPIRMYFEPGHYTVMENCGEFEVRVVRRGD----ISTYASVEYETQDGTASAGTDFVGRKGLLSFPPGVDEQRFRIEVIDDDVFEEDECFYIRLFNPSE-------------------GVKLAVPMIATVMILDDDHAGIFAFTDSVFEITESVGRFELKVMRYSGARGTVIVPYWTENDTATESKDYEGARGELVFENNESEKFIDLFILEESSYEKDVSFKVHIGEPRLAPDDELAAK-----------IKEVEKKPVQDLTELDRILLLSKPRNGELTTAYVRIRESQEFKATVDKLVAKANVSAVLGTSSWKEQFKDALTVIPADE-SEFDNDDEEEEVPSCFSYVSHFVCLFWKVLFAFVPPTDICGGYVTFVVSIFVIGVITAIIGDAASYFGCALNIKDSVTAILFVALGTSIPDTFASMIAAKHDEGADNCIGNVTGSNAVNVFLGIGLAWTIAAVYHSSHGMTFNVEPGTIGFAVALFCGEALIAIMLIMFRRWHKGIGAELGGPKVSKYISAAILVFLWVFYVVICILEAYDVIR 949          
BLAST of slc8a-1 vs. Ensembl Zebrafish
Match: slc8a1a (solute carrier family 8 member 1a [Source:ZFIN;Acc:ZDB-GENE-050809-1])

HSP 1 Score: 856.284 bits (2211), Expect = 0.000e+0
Identity = 470/901 (52.16%), Postives = 623/901 (69.15%), Query Frame = 2
Query:  461 CKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYL--RKNVKSYALEGDHELHCNHSLE------DAH----LDG--DKKENLTELEKTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLERRLSQDPDKLGLKEKENN------NQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGG-TDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVSQSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            CK+G++LP+W PV+  S GDK+ARA VYFV L Y+FLGVSIIADRFMASIEVITS+E+++ ++K NGE  T  VRIWNETVSNLTLMALGSSAPEILLSV+E+CG NF+AG+LGP TIVGSAAFN+F+IIG CV VIP+GE R++KHL VF +TA+WS+FAY WLYLI+A  SP +++VWE LLT FFF + VL A+VAD ++   K++ +RY   +K       EG+ EL     +E      ++H    LDG  D ++   + ++ R +  ++++E++ K+P  + + L E A   VL++  KSRAFYR QATR +TG+GN++KK   +    Q    LG+ E  +       + KIFFDPG Y  +EN GT  + V R G D     + + VEY TEDGTA AG DY  T GV++F+ GE +K I + IIDDDIFE DEHF ++L + + +++     +        + G+ L  P  AT+ + DDDHAGIF FEE    ++ES G  E+KV R+SGARGVV++PY++   TA GG  D+ +    LEF ND+    I++NIIDD EYEK++ F +E+GEP LV+     +    +  T        K   D+       I +MG+P LG+  +++VII+ES EFK  VD L++   L+  +GT+SW++QFVEAITV+ G++D E+     +EK+PSC DYVMHFLT+FWKVLFAFVPPTDY  GW  F V I++IG LTA IGD+AS FGCTIG+ ++VTA+ FVA+GTS+PDTFASKVAAI D  AD+S+GNVTGSNAVNVFLGIG+AWSIAA++H  +G  FRV  G+L FSVT+F IFA   IA ++ RR   +GGELGGPRH KI TT  F  LW++Y+ILSS+E YC IKGF
Sbjct:   59 CKEGVILPIWTPVNP-SFGDKLARATVYFVGLFYMFLGVSIIADRFMASIEVITSQEKEITIKKPNGETTTTTVRIWNETVSNLTLMALGSSAPEILLSVVEVCGHNFDAGELGPNTIVGSAAFNMFVIIGLCVSVIPEGEHRKVKHLRVFFVTATWSIFAYTWLYLILAVISPGIVEVWEGLLTLFFFPICVLFAWVADRRLLFYKYVYKRYRVGKKRGIIIETEGEPELQSKADIEMDGGMLNSHAEEFLDGAVDNEDKDADEDEARREMAKILKELKQKHPEKEMEQLVELANYHVLSQQQKSRAFYRCQATRLMTGAGNILKKHAAD----QARKALGIHELRSEVSDNDISSKIFFDPGTYQCLENCGTVALNVVRRGGD---LTSTVSVEYRTEDGTANAGSDYQFTEGVIIFKPGETEKEIRVDIIDDDIFEEDEHFLVHLSNVKVISEGANNGNPGTNHVDALAGLGL--PSTATVTIFDDDHAGIFLFEEPIVHISESIGMMEVKVVRTSGARGVVVIPYKTIEGTAKGGGEDFEDTHGVLEFQNDEISKTIQINIIDDEEYEKNKNFFLEIGEPQLVEMSERKEDGEEETLT--------KKEKDE-----RRIAEMGRPTLGEHVKLEVIIEESYEFKSTVDKLIKKTNLALLVGTNSWRDQFVEAITVNSGDDDDEEC---GQEKMPSCFDYVMHFLTVFWKVLFAFVPPTDYWNGWACFIVSIMMIGVLTAFIGDIASHFGCTIGLKDSVTAVVFVALGTSVPDTFASKVAAIQDQYADASIGNVTGSNAVNVFLGIGVAWSIAAIFHQSQGRQFRVDPGTLAFSVTLFTIFAFVCIAVLMYRRRPEIGGELGGPRHPKIITTTLFFSLWLMYIILSSMEAYCIIKGF 933          
BLAST of slc8a-1 vs. Ensembl Zebrafish
Match: slc8a1a (solute carrier family 8 member 1a [Source:ZFIN;Acc:ZDB-GENE-050809-1])

HSP 1 Score: 852.432 bits (2201), Expect = 0.000e+0
Identity = 477/930 (51.29%), Postives = 632/930 (67.96%), Query Frame = 2
Query:  461 CKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYL--RKNVKSYALEGDHELHCNHSLE------DAH----LDG--DKKENLTELEKTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLERRLSQDPDKLGLKEKENN------NQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGG-TDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFNHVSEVKTHSD--------------QLVSQSSE---------------IEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            CK+G++LP+W PV+  S GDK+ARA VYFV L Y+FLGVSIIADRFMASIEVITS+E+++ ++K NGE  T  VRIWNETVSNLTLMALGSSAPEILLSV+E+CG NF+AG+LGP TIVGSAAFN+F+IIG CV VIP+GE R++KHL VF +TA+WS+FAY WLYLI+A  SP +++VWE LLT FFF + VL A+VAD ++   K++ +RY   +K       EG+ EL     +E      ++H    LDG  D ++   + ++ R +  ++++E++ K+P  + + L E A   VL++  KSRAFYR QATR +TG+GN++KK   +    Q    LG+ E  +       + KIFFDPG Y  +EN GT  + V R G D     + + VEY TEDGTA AG DY  T GV++F+ GE +K I + IIDDDIFE DEHF ++L + + +++     +        + G+ L  P  AT+ + DDDHAGIF FEE    ++ES G  E+KV R+SGARGVV++PY++   TA GG  D+ +    LEF ND+    I++NIIDD EYEK++ F +E+GEP LV+     K+ +  E  GF     VKT  D               ++S S +               I +MG+P LG+  +++VII+ES EFK  VD L++   L+  +GT+SW++QFVEAITV+ G++D E+     +EK+PSC DYVMHFLT+FWKVLFAFVPPTDY  GW  F V I++IG LTA IGD+AS FGCTIG+ ++VTA+ FVA+GTS+PDTFASKVAAI D  AD+S+GNVTGSNAVNVFLGIG+AWSIAA++H  +G  FRV  G+L FSVT+F IFA   IA ++ RR   +GGELGGPRH KI TT  F  LW++Y+ILSS+E YC IKGF
Sbjct:   59 CKEGVILPIWTPVNP-SFGDKLARATVYFVGLFYMFLGVSIIADRFMASIEVITSQEKEITIKKPNGETTTTTVRIWNETVSNLTLMALGSSAPEILLSVVEVCGHNFDAGELGPNTIVGSAAFNMFVIIGLCVSVIPEGEHRKVKHLRVFFVTATWSIFAYTWLYLILAVISPGIVEVWEGLLTLFFFPICVLFAWVADRRLLFYKYVYKRYRVGKKRGIIIETEGEPELQSKADIEMDGGMLNSHAEEFLDGAVDNEDKDADEDEARREMAKILKELKQKHPEKEMEQLVELANYHVLSQQQKSRAFYRCQATRLMTGAGNILKKHAAD----QARKALGIHELRSEVSDNDISSKIFFDPGTYQCLENCGTVALNVVRRGGD---LTSTVSVEYRTEDGTANAGSDYQFTEGVIIFKPGETEKEIRVDIIDDDIFEEDEHFLVHLSNVKVISEGANNGNPGTNHVDALAGLGL--PSTATVTIFDDDHAGIFLFEEPIVHISESIGMMEVKVVRTSGARGVVVIPYKTIEGTAKGGGEDFEDTHGVLEFQNDEISKTIQINIIDDEEYEKNKNFFLEIGEPQLVEMSE-RKAMLLHECGGF-----VKTGRDVYRKVQGRDKPIPSTIISISEDGEEETLTKKEKDERRIAEMGRPTLGEHVKLEVIIEESYEFKSTVDKLIKKTNLALLVGTNSWRDQFVEAITVNSGDDDDEEC---GQEKMPSCFDYVMHFLTVFWKVLFAFVPPTDYWNGWACFIVSIMMIGVLTAFIGDIASHFGCTIGLKDSVTAVVFVALGTSVPDTFASKVAAIQDQYADASIGNVTGSNAVNVFLGIGVAWSIAAIFHQSQGRQFRVDPGTLAFSVTLFTIFAFVCIAVLMYRRRPEIGGELGGPRHPKIITTTLFFSLWLMYIILSSMEAYCIIKGF 969          
BLAST of slc8a-1 vs. Ensembl Zebrafish
Match: slc8a1a (solute carrier family 8 member 1a [Source:ZFIN;Acc:ZDB-GENE-050809-1])

HSP 1 Score: 850.892 bits (2197), Expect = 0.000e+0
Identity = 474/931 (50.91%), Postives = 633/931 (67.99%), Query Frame = 2
Query:  461 CKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYL--RKNVKSYALEGDHELHCNHSLE------DAH----LDG--DKKENLTELEKTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLERRLSQDPDKLGLKEKENN------NQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTAT-GGTDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKP-----------GIGKSNIPKEFTGFNHVSEVKTHSDQL------VSQSSE-------------IEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            CK+G++LP+W PV+  S GDK+ARA VYFV L Y+FLGVSIIADRFMASIEVITS+E+++ ++K NGE  T  VRIWNETVSNLTLMALGSSAPEILLSV+E+CG NF+AG+LGP TIVGSAAFN+F+IIG CV VIP+GE R++KHL VF +TA+WS+FAY WLYLI+A  SP +++VWE LLT FFF + VL A+VAD ++   K++ +RY   +K       EG+ EL     +E      ++H    LDG  D ++   + ++ R +  ++++E++ K+P  + + L E A   VL++  KSRAFYR QATR +TG+GN++KK   +    Q    LG+ E  +       + KIFFDPG Y  +EN GT  + V R G D     + + VEY TEDGTA AG DY  T GV++F+ GE +K I + IIDDDIFE DEHF ++L + + +++     +        + G+ L  P  AT+ + DDDHAGIF FEE    ++ES G  E+KV R+SGARGVV++PY++   TA  GG D+ +    LEF ND+    I++NIIDD EYEK++ F +E+GEP LV+             G  K++  K+  G +   +V+     +      +S+  E             I +MG+P LG+  +++VII+ES EFK  VD L++   L+  +GT+SW++QFVEAITV+ G++D E+     +EK+PSC DYVMHFLT+FWKVLFAFVPPTDY  GW  F V I++IG LTA IGD+AS FGCTIG+ ++VTA+ FVA+GTS+PDTFASKVAAI D  AD+S+GNVTGSNAVNVFLGIG+AWSIAA++H  +G  FRV  G+L FSVT+F IFA   IA ++ RR   +GGELGGPRH KI TT  F  LW++Y+ILSS+E YC IKGF
Sbjct:   59 CKEGVILPIWTPVNP-SFGDKLARATVYFVGLFYMFLGVSIIADRFMASIEVITSQEKEITIKKPNGETTTTTVRIWNETVSNLTLMALGSSAPEILLSVVEVCGHNFDAGELGPNTIVGSAAFNMFVIIGLCVSVIPEGEHRKVKHLRVFFVTATWSIFAYTWLYLILAVISPGIVEVWEGLLTLFFFPICVLFAWVADRRLLFYKYVYKRYRVGKKRGIIIETEGEPELQSKADIEMDGGMLNSHAEEFLDGAVDNEDKDADEDEARREMAKILKELKQKHPEKEMEQLVELANYHVLSQQQKSRAFYRCQATRLMTGAGNILKKHAAD----QARKALGIHELRSEVSDNDISSKIFFDPGTYQCLENCGTVALNVVRRGGD---LTSTVSVEYRTEDGTANAGSDYQFTEGVIIFKPGETEKEIRVDIIDDDIFEEDEHFLVHLSNVKVISEGANNGNPGTNHVDALAGLGL--PSTATVTIFDDDHAGIFLFEEPIVHISESIGMMEVKVVRTSGARGVVVIPYKTIEGTAKGGGEDFEDTHGVLEFQNDEISKTIQINIIDDEEYEKNKNFFLEIGEPQLVEMSERKAMLLHECGGFVKTD--KQLYGRDVYRKVQGRDKPIPSTIISISEDGEEETLTKKEKDERRIAEMGRPTLGEHVKLEVIIEESYEFKSTVDKLIKKTNLALLVGTNSWRDQFVEAITVNSGDDDDEEC---GQEKMPSCFDYVMHFLTVFWKVLFAFVPPTDYWNGWACFIVSIMMIGVLTAFIGDIASHFGCTIGLKDSVTAVVFVALGTSVPDTFASKVAAIQDQYADASIGNVTGSNAVNVFLGIGVAWSIAAIFHQSQGRQFRVDPGTLAFSVTLFTIFAFVCIAVLMYRRRPEIGGELGGPRHPKIITTTLFFSLWLMYIILSSMEAYCIIKGF 974          
BLAST of slc8a-1 vs. Ensembl Zebrafish
Match: slc8a1b (solute carrier family 8 member 1b [Source:ZFIN;Acc:ZDB-GENE-060110-3])

HSP 1 Score: 845.499 bits (2183), Expect = 0.000e+0
Identity = 483/904 (53.43%), Postives = 628/904 (69.47%), Query Frame = 2
Query:  461 CKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALE--GDHELHCNHSLE------DAH----LDGD-----KKENLTELEKTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLER-RLSQDPDKLGLKEKENNN-QKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDGKKVSINQLTEQNIYGVELIE----PFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGG-TDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVSQSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            C  G++LP+W+P +  S GDK+ARA VYFV+L+Y+FLGVSIIADRFMASIEVITS+E+++ ++K NGE  T  VRIWNETVSNLTLMALGSSAPEILLSVIE+CG NFEAGDLGP TIVGSAAFN+F+IIG CVYV+PDGE R++KHL VF +TA+WS+FAY+W+YLI+A  SP ++QVWE LLT FFF + V+ A++AD ++   K++ +RY     +   +E  GD  L     +E      ++H    LDG      + ++L E ++ R +  ++++E++ K+P+ + + L E A  +VL++  KSRAFYR QATR +TG+GN++KK   ++ R +    ++     EN+   KIFFDP  Y  +EN GT  V V R G D       + VE+ TEDGTA AG DY  T G V+F+ GE QK I + IIDDDIFE DE+F I+L + R V +  +     + TE N   VE I     P  AT+ + DDDHAGIF FEE  T V+ES G  E+KV R+SGARGVV VPY++   TA GG  D+ +   +LEF ND+    IKV IIDD EYEK++ F +E+G+P LV+          K       V E +        +   I +MGKP LGD   ++VII+ES EFK+ VD L++   L+  +GT+SW++QF+EAITVS GE+D ++     EEKLPSC DYVMHFLT+FWKVLFAFVPPTDY  GW  F V I++IG LTA IGDLAS FGCTIG+ ++VTA+ FVA+GTS+PDTFASKVAAI D  AD+S+GNVTGSNAVNVFLGIG+AWSIAA+YH  KG+ FRV+ G+L FSVT+F IFA   +A ++ RR   +GGELGGPR  K  TT+ FV LW++Y++ SSLE YCHIKGF
Sbjct:   59 CAPGVILPVWEPPNP-SFGDKVARATVYFVALVYMFLGVSIIADRFMASIEVITSQEKEITIKKPNGETTTTTVRIWNETVSNLTLMALGSSAPEILLSVIEVCGHNFEAGDLGPSTIVGSAAFNMFVIIGICVYVVPDGEHRKVKHLRVFFVTAAWSIFAYLWMYLILAVLSPGIVQVWEGLLTLFFFPICVVFAWIADRRLLFYKYVYKRYRAGKHRGMIIETEGDRPLPSKVDIEMDGKMLNSHAVDFLDGTLALELEDKDLDE-DEARREMAKILKELKQKHPDKEVEQLIELANYQVLSQQQKSRAFYRCQATRLMTGAGNILKKHAADQARKAVSMHEVRSDTGENDPISKIFFDPCSYQCLENCGTVAVNVIRRGGD---LNQTVSVEFRTEDGTANAGSDYEFTEGTVVFKPGETQKEIRVGIIDDDIFEEDENFLIHLSNVRVVHEGDEP----ETTEAN--HVETIATLGLPSTATVTIFDDDHAGIFTFEEPVTHVSESVGVMEVKVLRTSGARGVVSVPYKTIEGTARGGGEDFEDSHGFLEFQNDEIFKTIKVRIIDDEEYEKNKSFFLEIGDPQLVETD-------EKRDEEKEVVKEEEEPLTGEEEEERRIAEMGKPMLGDHPRVEVIIEESYEFKNTVDKLIKKTNLALLVGTNSWRDQFIEAITVSAGEDDDDEE--CGEEKLPSCFDYVMHFLTVFWKVLFAFVPPTDYWNGWACFVVSIIMIGVLTAFIGDLASHFGCTIGLKDSVTAVVFVALGTSVPDTFASKVAAIQDQYADASIGNVTGSNAVNVFLGIGVAWSIAAIYHNSKGNDFRVEPGNLAFSVTLFTIFAFICVAVLMYRRRPDIGGELGGPRTAKALTTMLFVSLWLLYILFSSLEAYCHIKGF 942          
BLAST of slc8a-1 vs. Ensembl Zebrafish
Match: slc8a1a (solute carrier family 8 member 1a [Source:ZFIN;Acc:ZDB-GENE-050809-1])

HSP 1 Score: 845.499 bits (2183), Expect = 0.000e+0
Identity = 467/901 (51.83%), Postives = 618/901 (68.59%), Query Frame = 2
Query:  461 CKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYL--RKNVKSYALEGDHELHCNHSLE------DAH----LDG--DKKENLTELEKTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLERRLSQDPDKLGLKEKENN------NQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGG-TDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVSQSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            CK+G++LP+W PV+  S GDK+ARA VYFV L Y+FLGVSIIADRFMASIEVITS+E+++ ++K NGE  T  VRIWNETVSNLTLMALGSSAPEILLSV+E+CG NF+AG+LGP TIVGSAAFN+F+IIG CV VIP+GE R++KHL VF +TA+WS+FAY WLYLI+A  SP +++VWE LLT FFF + VL A+VAD ++   K++ +RY   +K       EG+ EL     +E      ++H    LDG  D ++   + ++ R +  ++++E++ K+P  + + L E A   VL++  KSRAFYR QATR +TG+GN++KK   +    Q    LG+ E  +       + KIFFDPG Y  +EN GT  + V R G D     + + VEY TEDGTA AG DY  T GV++F+ GE +K I + IIDDDIFE DEHF ++L + + +++     +        + G+ L  P  AT+ + DDDHAGIF FEE    ++ES G  E+KV R+SGARGVV++PY++   TA GG  D+ +    LEF ND+    IKV I+D  EY+K   F IEL EP   ++             G+    E +T + +       I +MG+P LG+  +++VII+ES EFK  VD L++   L+  +GT+SW++QFVEAITV+ G++D E+     +EK+PSC DYVMHFLT+FWKVLFAFVPPTDY  GW  F V I++IG LTA IGD+AS FGCTIG+ ++VTA+ FVA+GTS+PDTFASKVAAI D  AD+S+GNVTGSNAVNVFLGIG+AWSIAA++H  +G  FRV  G+L FSVT+F IFA   IA ++ RR   +GGELGGPRH KI TT  F  LW++Y+ILSS+E YC IKGF
Sbjct:   59 CKEGVILPIWTPVNP-SFGDKLARATVYFVGLFYMFLGVSIIADRFMASIEVITSQEKEITIKKPNGETTTTTVRIWNETVSNLTLMALGSSAPEILLSVVEVCGHNFDAGELGPNTIVGSAAFNMFVIIGLCVSVIPEGEHRKVKHLRVFFVTATWSIFAYTWLYLILAVISPGIVEVWEGLLTLFFFPICVLFAWVADRRLLFYKYVYKRYRVGKKRGIIIETEGEPELQSKADIEMDGGMLNSHAEEFLDGAVDNEDKDADEDEARREMAKILKELKQKHPEKEMEQLVELANYHVLSQQQKSRAFYRCQATRLMTGAGNILKKHAAD----QARKALGIHELRSEVSDNDISSKIFFDPGTYQCLENCGTVALNVVRRGGD---LTSTVSVEYRTEDGTANAGSDYQFTEGVIIFKPGETEKEIRVDIIDDDIFEEDEHFLVHLSNVKVISEGANNGNPGTNHVDALAGLGL--PSTATVTIFDDDHAGIFLFEEPIVHISESIGMMEVKVVRTSGARGVVVIPYKTIEGTAKGGGEDFEDTHGVLEFQNDEISKTIKVKILDHEEYDKHANFFIELQEPEWRRR-------------GWTEDGEEETLTKK-EKDERRIAEMGRPTLGEHVKLEVIIEESYEFKSTVDKLIKKTNLALLVGTNSWRDQFVEAITVNSGDDDDEEC---GQEKMPSCFDYVMHFLTVFWKVLFAFVPPTDYWNGWACFIVSIMMIGVLTAFIGDIASHFGCTIGLKDSVTAVVFVALGTSVPDTFASKVAAIQDQYADASIGNVTGSNAVNVFLGIGVAWSIAAIFHQSQGRQFRVDPGTLAFSVTLFTIFAFVCIAVLMYRRRPEIGGELGGPRHPKIITTTLFFSLWLMYIILSSMEAYCIIKGF 932          
BLAST of slc8a-1 vs. Ensembl Xenopus
Match: SLC8A3 (solute carrier family 8 (sodium/calcium exchanger), member 3 [Source:NCBI gene;Acc:100487508])

HSP 1 Score: 832.787 bits (2150), Expect = 0.000e+0
Identity = 472/905 (52.15%), Postives = 631/905 (69.72%), Query Frame = 2
Query:  422 LKNGACESLNDTSCKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALE--GDH--------ELHCNHSLEDAHLDGDKKENLTELEKTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLER-RLSQDPDKLGLKEKENNNQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGG-TDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVSQSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            ++N +C       CK+G++LP+W P    S+GDKIAR  VYFV+++Y+FLGVSIIADRFMASIEVITS+ER+++++K NGE  T  +RIWNETVSNLTLMALGSSAPEILLS+IE+CG  F AGDLGP TIVGSAAFN+FIII  CVYVIPDGEVR++KHL VF +TA+WS+FAYIWLY+I+A FSP V+QVWE LLT FFF + V+ A+VAD ++   K++ ++Y     ++  +E   DH        ++  +H L+   L+ D KE    ++++R D I +++E++ K+P  D   L E A    L+   KSRAFYR+QATR +TG+GN++KK   E+ + S     + L E E    KI+FDP  Y  +EN G   + V R G D  I+KT+  V+Y TEDG+A AG DY  T G ++F+SGE QK   + IIDDDIFE DEHFF+ L + R +T+  +    N  +        L+ P+IA+I +LDDDHAGIF FE     V+ES G  E+KV R+SGARG V+VP+R+   TA GG  DY +    LEF ND+T   I+V IID+ EYE+ E F I LGEP  +K+ GI  +++          +E K   ++   ++  I +MGKP LG+  +++V+I+ES EFK  VD L++   L+  +GT SW++QF+EAITVS   ++ ED     EE+LPSC DYVMHFLT+FWKVLFA VPPT+YL GW  F V I++IG LTA+IGDLAS FGCTIG+ ++VTA+ FVA GTS+PDTFASKVAA  D  AD+S+GNVTGSNAVNVFLGIGLAWS+AA+Y  ++G  F V +G+L FSVT+F IFA   I+ +L RR   +GGELGGP+  ++AT++ FV LW++Y++ ++LE YC+IKGF
Sbjct:   42 VQNNSCS--GSYECKEGVILPIWYP-ENPSMGDKIARVIVYFVAMIYMFLGVSIIADRFMASIEVITSQEREIVIKKPNGETSTTTIRIWNETVSNLTLMALGSSAPEILLSLIEVCGHGFLAGDLGPSTIVGSAAFNMFIIIALCVYVIPDGEVRKVKHLRVFFVTAAWSIFAYIWLYMILAVFSPGVVQVWEGLLTLFFFPVCVVLAWVADKRLLFYKYMHKKYRTDKHRAIMIETEADHPKGIEMDGKVMNSHFLDGNLLNMDGKE----VDESRRDMIRILKELKQKHPEKDLDQLVEMANYYALSHQQKSRAFYRIQATRMMTGAGNILKKHAAEQSKRSSSLQDICLDESEEFVSKIYFDPCSYQCLENCGAVLLTVVRKGGD--ISKTVF-VDYKTEDGSANAGADYEFTEGTLVFKSGETQKEFSVGIIDDDIFEEDEHFFVRLSNIR-ITEAPEPAEPNSFSYPK---AVLVSPYIASITILDDDHAGIFTFECDIIRVSESIGVMEVKVLRTSGARGTVIVPFRTIEGTAKGGGEDYEDSYGELEFKNDETVKTIRVKIIDEEEYERQESFFIALGEPKWMKR-GISAADL----------TERKLSVEE--EEAKRIAEMGKPILGEHPKLEVVIEESYEFKSTVDKLIKKTNLALVVGTHSWRDQFMEAITVSAAGDEEEDE--SGEERLPSCFDYVMHFLTVFWKVLFACVPPTEYLNGWACFVVSIIIIGILTAIIGDLASHFGCTIGLKDSVTAVVFVAFGTSVPDTFASKVAATQDVYADASIGNVTGSNAVNVFLGIGLAWSVAAIYWAYQGQEFHVSAGTLAFSVTLFTIFAFVCISVLLYRRRPHIGGELGGPKGYRLATSLLFVSLWLLYILFATLEAYCYIKGF 917          
BLAST of slc8a-1 vs. Ensembl Xenopus
Match: SLC8A3 (solute carrier family 8 (sodium/calcium exchanger), member 3 [Source:NCBI gene;Acc:100487508])

HSP 1 Score: 830.861 bits (2145), Expect = 0.000e+0
Identity = 471/905 (52.04%), Postives = 628/905 (69.39%), Query Frame = 2
Query:  422 LKNGACESLNDTSCKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALE--GDH--------ELHCNHSLEDAHLDGDKKENLTELEKTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLER-RLSQDPDKLGLKEKENNNQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGG-TDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVSQSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            ++N +C       CK+G++LP+W P    S+GDKIAR  VYFV+++Y+FLGVSIIADRFMASIEVITS+ER+++++K NGE  T  +RIWNETVSNLTLMALGSSAPEILLS+IE+CG  F AGDLGP TIVGSAAFN+FIII  CVYVIPDGEVR++KHL VF +TA+WS+FAYIWLY+I+A FSP V+QVWE LLT FFF + V+ A+VAD ++   K++ ++Y     ++  +E   DH        ++  +H L+   L+ D KE    ++++R D I +++E++ K+P  D   L E A    L+   KSRAFYR+QATR +TG+GN++KK   E+ + S     + L E E    KI+FDP  Y  +EN G   + V R G D  I+KT+  V+Y TEDG+A AG DY  T G ++F+SGE QK   + IIDDDIFE DEHFF+ L + R +T+  +    N  +        L+ P+IA+I +LDDDHAGIF FE     V+ES G  E+KV R+SGARG V+VP+R+   TA GG  DY +    LEF ND+T   I+V IID+ EYE+ E F I LGEP  +K+       I         ++E K   ++   ++  I +MGKP LG+  +++V+I+ES EFK  VD L++   L+  +GT SW++QF+EAITVS   ++ ED     EE+LPSC DYVMHFLT+FWKVLFA VPPT+YL GW  F V I++IG LTA+IGDLAS FGCTIG+ ++VTA+ FVA GTS+PDTFASKVAA  D  AD+S+GNVTGSNAVNVFLGIGLAWS+AA+Y  ++G  F V +G+L FSVT+F IFA   I+ +L RR   +GGELGGP+  ++AT++ FV LW++Y++ ++LE YC+IKGF
Sbjct:   42 VQNNSCS--GSYECKEGVILPIWYP-ENPSMGDKIARVIVYFVAMIYMFLGVSIIADRFMASIEVITSQEREIVIKKPNGETSTTTIRIWNETVSNLTLMALGSSAPEILLSLIEVCGHGFLAGDLGPSTIVGSAAFNMFIIIALCVYVIPDGEVRKVKHLRVFFVTAAWSIFAYIWLYMILAVFSPGVVQVWEGLLTLFFFPVCVVLAWVADKRLLFYKYMHKKYRTDKHRAIMIETEADHPKGIEMDGKVMNSHFLDGNLLNMDGKE----VDESRRDMIRILKELKQKHPEKDLDQLVEMANYYALSHQQKSRAFYRIQATRMMTGAGNILKKHAAEQSKRSSSLQDICLDESEEFVSKIYFDPCSYQCLENCGAVLLTVVRKGGD--ISKTVF-VDYKTEDGSANAGADYEFTEGTLVFKSGETQKEFSVGIIDDDIFEEDEHFFVRLSNIR-ITEAPEPAEPNSFSYPK---AVLVSPYIASITILDDDHAGIFTFECDIIRVSESIGVMEVKVLRTSGARGTVIVPFRTIEGTAKGGGEDYEDSYGELEFKNDETVKTIRVKIIDEEEYERQESFFIALGEPKWMKR------GISALLLNQADLTERKLSVEE--EEAKRIAEMGKPILGEHPKLEVVIEESYEFKSTVDKLIKKTNLALVVGTHSWRDQFMEAITVSAAGDEEEDE--SGEERLPSCFDYVMHFLTVFWKVLFACVPPTEYLNGWACFVVSIIIIGILTAIIGDLASHFGCTIGLKDSVTAVVFVAFGTSVPDTFASKVAATQDVYADASIGNVTGSNAVNVFLGIGLAWSVAAIYWAYQGQEFHVSAGTLAFSVTLFTIFAFVCISVLLYRRRPHIGGELGGPKGYRLATSLLFVSLWLLYILFATLEAYCYIKGF 922          
BLAST of slc8a-1 vs. Ensembl Xenopus
Match: SLC8A2 (solute carrier family 8 member A2 [Source:NCBI gene;Acc:100495074])

HSP 1 Score: 829.321 bits (2141), Expect = 0.000e+0
Identity = 471/933 (50.48%), Postives = 622/933 (66.67%), Query Frame = 2
Query:  362 LLFGSCIVVIEFLSWIQCEPLKNGACESLNDTSCKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSY----------ALEGDHELHCNHSLEDAHLDGDKKENLT------ELEKTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLERRLSQDPDKLG---LKEKENNNQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGG-TDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVSQSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            LL  S +++I  L+    + L+NG CE+  D  C+ GI+LP+W+P    S+GDK+ARA VYFV+++YLFLGVSIIADRFMASIEVITS+E+++ + K NGE     VRIWNETVSNLTLMALGSSAPEILLSVIE+CG  F AG+LGPGTIVGSAAFN+F+II  CVYVIP+GE R+IKH  VF +TA+WS+FAYIWLY+I+A  SP+ +QVWEAL+T  FF   V+ A++AD ++   K++ +RY     +            ++E D +L  +  +     D   +++        EL+++R + I +++E++ K P  +   L E A    L    KSRAFYR+QATR + G+GNV+KK   +   S+ P  L        E N  KIFF P +Y  +EN G   + V   G D     +   V+Y TEDG+A AG DY  + G ++F+ GE QK +++ IIDDDIFE DEHFF+ L + R    +G    + +   +      L+ P IAT+ +LDDDHAGIF FEE    V+ES G  E+KV R+SGARG V++PYR+   TA GG  DY +    LEF ND+T   ++V I+DD EYEK E F I L EP  +K+ GI    + ++       +E +        ++  I +MGKP LG+  +++VII+ES EFK  VD L++   L+  IGT SW+EQF EAITVS    D E+ DD  EE+LPSC DYVMHFLT+FWKVLFAFVPPT+Y  GW  F+VCI ++G LTAVIGDLAS FGCT+G+ ++VTA+ FVA+GTSLPDTFASKVAA+ D  AD+ +GNVTGSNAVNVFLGIG+AWS+AA+Y   +G  F V++GSL FSVT+F IFA   I  +L RR   +GGELGG R  K  T + F+GLW++Y++ SSLE YCHIKGF
Sbjct:    4 LLRISALMLI-ILTLTSSKELENGTCEAAKDGKCQPGILLPVWEP-QNPSMGDKVARAVVYFVAMLYLFLGVSIIADRFMASIEVITSQEKEITLTKPNGETSVATVRIWNETVSNLTLMALGSSAPEILLSVIEVCGHGFHAGELGPGTIVGSAAFNMFVIIAICVYVIPNGESRKIKHPRVFFVTATWSIFAYIWLYIILAVTSPKRVQVWEALVTLLFFPACVVLAWIADKRLLFYKYVYKRYRADKRRGIIIETEGEFPKSIEMDGKLGASAVVAPETKDAGMQDSAAAAAEAKELDESRKEVIRILKELKQKYPERELDQLVEMANYYALLHQQKSRAFYRIQATRMMIGAGNVLKKHAADH--SRKPATLQEVTSDSSEENTSKIFFQPSNYQCLENCGFVTLNVACQGGD---GASTFYVDYKTEDGSANAGSDYEYSEGTLIFKPGETQKELKVGIIDDDIFEEDEHFFVRLMNLRVGDAEG----MFEPDGEGRPKARLVSPLIATVTILDDDHAGIFTFEEKLVHVSESVGILEVKVVRNSGARGTVVIPYRTMEGTARGGGVDYEDAYGELEFQNDETLKTLQVKIVDDEEYEKQENFFIILEEPRWMKR-GISALLLNQDEDDKKLTAEEE--------EAKRIAEMGKPILGEHSKLEVIIEESYEFKSTVDKLIKKTNLALVIGTHSWREQFTEAITVSA--GDEEEEDDGREERLPSCFDYVMHFLTVFWKVLFAFVPPTEYWNGWACFFVCISIVGILTAVIGDLASHFGCTVGLKDSVTAVVFVALGTSLPDTFASKVAAMQDQYADACIGNVTGSNAVNVFLGIGVAWSVAAIYWAIQGKDFIVETGSLAFSVTLFTIFAFINIGVLLYRRRPHIGGELGGSRLSKTLTAMLFIGLWLLYILFSSLEAYCHIKGF 914          
BLAST of slc8a-1 vs. Ensembl Xenopus
Match: SLC8A3 (solute carrier family 8 (sodium/calcium exchanger), member 3 [Source:NCBI gene;Acc:100487508])

HSP 1 Score: 828.935 bits (2140), Expect = 0.000e+0
Identity = 471/905 (52.04%), Postives = 631/905 (69.72%), Query Frame = 2
Query:  422 LKNGACESLNDTSCKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALE--GDH--------ELHCNHSLEDAHLDGDKKENLTELEKTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLER-RLSQDPDKLGLKEKENNNQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGG-TDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVSQSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            ++N +C       CK+G++LP+W P    S+GDKIAR  VYFV+++Y+FLGVSIIADRFMASIEVITS+ER+++++K NGE  T  +RIWNETVSNLTLMALGSSAPEILLS+IE+CG  F AGDLGP TIVGSAAFN+FIII  CVYVIPDGEVR++KHL VF +TA+WS+FAYIWLY+I+A FSP V+QVWE LLT FFF + V+ A+VAD ++   K++ ++Y     ++  +E   DH        ++  +H L+   L+ D KE    ++++R D I +++E++ K+P  D   L E A    L+   KSRAFYR+QATR +TG+GN++KK   E+ + S     + L E E    KI+FDP  Y  +EN G   + V R G D  I+KT+  V+Y TEDG+A AG DY  T G ++F+SGE QK   + IIDDDIFE DEHFF+ L + R +T+  +    N  +        L+ P+IA+I +LDDDHAGIF FE     V+ES G  E+KV R+SGARG V+VP+R+   TA GG  DY +    LEF ND+T   I++ I DD EYEK++ F IEL EP LV    + K+ +  +      ++E K   ++   ++  I +MGKP LG+  +++V+I+ES EFK  VD L++   L+  +GT SW++QF+EAITVS   ++ ED     EE+LPSC DYVMHFLT+FWKVLFA VPPT+YL GW  F V I++IG LTA+IGDLAS FGCTIG+ ++VTA+ FVA GTS+PDTFASKVAA  D  AD+S+GNVTGSNAVNVFLGIGLAWS+AA+Y  ++G  F V +G+L FSVT+F IFA   I+ +L RR   +GGELGGP+  ++AT++ FV LW++Y++ ++LE YC+IKGF
Sbjct:   42 VQNNSCS--GSYECKEGVILPIWYP-ENPSMGDKIARVIVYFVAMIYMFLGVSIIADRFMASIEVITSQEREIVIKKPNGETSTTTIRIWNETVSNLTLMALGSSAPEILLSLIEVCGHGFLAGDLGPSTIVGSAAFNMFIIIALCVYVIPDGEVRKVKHLRVFFVTAAWSIFAYIWLYMILAVFSPGVVQVWEGLLTLFFFPVCVVLAWVADKRLLFYKYMHKKYRTDKHRAIMIETEADHPKGIEMDGKVMNSHFLDGNLLNMDGKE----VDESRRDMIRILKELKQKHPEKDLDQLVEMANYYALSHQQKSRAFYRIQATRMMTGAGNILKKHAAEQSKRSSSLQDICLDESEEFVSKIYFDPCSYQCLENCGAVLLTVVRKGGD--ISKTVF-VDYKTEDGSANAGADYEFTEGTLVFKSGETQKEFSVGIIDDDIFEEDEHFFVRLSNIR-ITEAPEPAEPNSFSYPK---AVLVSPYIASITILDDDHAGIFTFECDIIRVSESIGVMEVKVLRTSGARGTVIVPFRTIEGTAKGGGEDYEDSYGELEFKNDETVKTIQIKIFDDEEYEKNKTFFIELREPHLVDL-SVQKALLLNQ----ADLTERKLSVEE--EEAKRIAEMGKPILGEHPKLEVVIEESYEFKSTVDKLIKKTNLALVVGTHSWRDQFMEAITVSAAGDEEEDE--SGEERLPSCFDYVMHFLTVFWKVLFACVPPTEYLNGWACFVVSIIIIGILTAIIGDLASHFGCTIGLKDSVTAVVFVAFGTSVPDTFASKVAATQDVYADASIGNVTGSNAVNVFLGIGLAWSVAAIYWAYQGQEFHVSAGTLAFSVTLFTIFAFVCISVLLYRRRPHIGGELGGPKGYRLATSLLFVSLWLLYILFATLEAYCYIKGF 923          
BLAST of slc8a-1 vs. Ensembl Xenopus
Match: SLC8A3 (solute carrier family 8 (sodium/calcium exchanger), member 3 [Source:NCBI gene;Acc:100487508])

HSP 1 Score: 828.55 bits (2139), Expect = 0.000e+0
Identity = 470/905 (51.93%), Postives = 628/905 (69.39%), Query Frame = 2
Query:  422 LKNGACESLNDTSCKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALE--GDH--------ELHCNHSLEDAHLDGDKKENLTELEKTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLER-RLSQDPDKLGLKEKENNNQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGG-TDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVSQSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            ++N +C       CK+G++LP+W P    S+GDKIAR  VYFV+++Y+FLGVSIIADRFMASIEVITS+ER+++++K NGE  T  +RIWNETVSNLTLMALGSSAPEILLS+IE+CG  F AGDLGP TIVGSAAFN+FIII  CVYVIPDGEVR++KHL VF +TA+WS+FAYIWLY+I+A FSP V+QVWE LLT FFF + V+ A+VAD ++   K++ ++Y     ++  +E   DH        ++  +H L+   L+ D KE    ++++R D I +++E++ K+P  D   L E A    L+   KSRAFYR+QATR +TG+GN++KK   E+ + S     + L E E    KI+FDP  Y  +EN G   + V R G D  I+KT+  V+Y TEDG+A AG DY  T G ++F+SGE QK   + IIDDDIFE DEHFF+ L + R +T+  +    N  +        L+ P+IA+I +LDDDHAGIF FE     V+ES G  E+KV R+SGARG V+VP+R+   TA GG  DY +    LEF ND+T   I++ I DD EYEK++ F IEL EP LV       +++          +E K   ++   ++  I +MGKP LG+  +++V+I+ES EFK  VD L++   L+  +GT SW++QF+EAITVS   ++ ED     EE+LPSC DYVMHFLT+FWKVLFA VPPT+YL GW  F V I++IG LTA+IGDLAS FGCTIG+ ++VTA+ FVA GTS+PDTFASKVAA  D  AD+S+GNVTGSNAVNVFLGIGLAWS+AA+Y  ++G  F V +G+L FSVT+F IFA   I+ +L RR   +GGELGGP+  ++AT++ FV LW++Y++ ++LE YC+IKGF
Sbjct:   42 VQNNSCS--GSYECKEGVILPIWYP-ENPSMGDKIARVIVYFVAMIYMFLGVSIIADRFMASIEVITSQEREIVIKKPNGETSTTTIRIWNETVSNLTLMALGSSAPEILLSLIEVCGHGFLAGDLGPSTIVGSAAFNMFIIIALCVYVIPDGEVRKVKHLRVFFVTAAWSIFAYIWLYMILAVFSPGVVQVWEGLLTLFFFPVCVVLAWVADKRLLFYKYMHKKYRTDKHRAIMIETEADHPKGIEMDGKVMNSHFLDGNLLNMDGKE----VDESRRDMIRILKELKQKHPEKDLDQLVEMANYYALSHQQKSRAFYRIQATRMMTGAGNILKKHAAEQSKRSSSLQDICLDESEEFVSKIYFDPCSYQCLENCGAVLLTVVRKGGD--ISKTVF-VDYKTEDGSANAGADYEFTEGTLVFKSGETQKEFSVGIIDDDIFEEDEHFFVRLSNIR-ITEAPEPAEPNSFSYPK---AVLVSPYIASITILDDDHAGIFTFECDIIRVSESIGVMEVKVLRTSGARGTVIVPFRTIEGTAKGGGEDYEDSYGELEFKNDETVKTIQIKIFDDEEYEKNKTFFIELREPHLVDLSVQKAADL----------TERKLSVEE--EEAKRIAEMGKPILGEHPKLEVVIEESYEFKSTVDKLIKKTNLALVVGTHSWRDQFMEAITVSAAGDEEEDE--SGEERLPSCFDYVMHFLTVFWKVLFACVPPTEYLNGWACFVVSIIIIGILTAIIGDLASHFGCTIGLKDSVTAVVFVAFGTSVPDTFASKVAATQDVYADASIGNVTGSNAVNVFLGIGLAWSVAAIYWAYQGQEFHVSAGTLAFSVTLFTIFAFVCISVLLYRRRPHIGGELGGPKGYRLATSLLFVSLWLLYILFATLEAYCYIKGF 918          
BLAST of slc8a-1 vs. Ensembl Mouse
Match: Slc8a3 (solute carrier family 8 (sodium/calcium exchanger), member 3 [Source:MGI Symbol;Acc:MGI:107976])

HSP 1 Score: 833.943 bits (2153), Expect = 0.000e+0
Identity = 473/906 (52.21%), Postives = 623/906 (68.76%), Query Frame = 2
Query:  428 NGACESLNDTSCKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALE--GDHE--LHCNHSLEDAH-LDGDKKENLTELE-----KTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLER-RLSQDPDKLGLKEKENNNQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQ---DGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGG-TDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVSQSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            N +C   +D  CK+G++LP+W P    S+GDKIAR  VYFV+L+Y+FLGVSIIADRFMASIEVITS+ER+V ++K NGE  T  +R+WNETVSNLTLMALGSSAPEILLS+IE+CG  F AGDLGP TIVGSAAFN+FIIIG CVYVIPDGE R+IKHL VF +TA+WS+FAYIWLY+I+A FSP V+QVWE LLT FFF + VL A+VAD ++   K++ ++Y     +   +E  GDH   +  +  + ++H LDG    N T LE     ++R + I ++++++ K+P  D   L E A    L+   KSRAFYR+QATR +TG+GN++KK   E+ + +    ++   E E+   K+FFDP  Y  +EN G   + V R G D  I+KTM  V+Y TEDG+A AG DY  T G V+ + GE QK   + IIDDDIFE DEHFF+ L + R   +   +G   +I  L    +    L  P +AT+ +LDDDHAGIF FE     V+ES G  E+KV R+SGARG V+VP+R+   TA GG  D+ +    LEF ND+T   I+V I+D+ EYE+ E F I LGEP  +++             G + V++ K   ++   ++  I +MGKP LG+  +++VII+ES EFK  VD L++   L+  +GT SW++QF+EAITVS      ED D+  EE+LPSC DYVMHFLT+FWKVLFA VPPT+Y  GW  F V I++IG LTA+IGDLAS FGCTIG+ ++VTA+ FVA GTS+PDTFASK AA+ D  AD+S+GNVTGSNAVNVFLGIGLAWS+AA+Y   +G  F V +G+L FSVT+F IFA   ++ +L RR   +GGELGGPR  K+ATT  FV LW++Y++ ++LE YC+IKGF
Sbjct:   45 NESCSGSSD--CKEGVILPIWYP-ENPSLGDKIARVIVYFVALIYMFLGVSIIADRFMASIEVITSQEREVTIKKPNGETSTTTIRVWNETVSNLTLMALGSSAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFIIIGICVYVIPDGETRKIKHLRVFFVTAAWSIFAYIWLYMILAVFSPGVVQVWEGLLTLFFFPVCVLLAWVADKRLLFYKYMHKKYRTDKHRGIIIETEGDHPKGIEMDGKMMNSHFLDG----NFTPLEGKEVDESRREMIRILKDLKQKHPEKDLDQLVEMANYYALSHQQKSRAFYRIQATRMMTGAGNILKKHAAEQAKKTSSMSEVHTDEPEDFASKVFFDPCSYQCLENCGAVLLTVVRKGGD--ISKTMY-VDYKTEDGSANAGADYEFTEGTVVLKPGETQKEFSVGIIDDDIFEEDEHFFVRLSNVRVEEEQLAEGMLPAI--LNSLPLPRAVLASPCVATVTILDDDHAGIFTFECDTIHVSESIGVMEVKVLRTSGARGTVIVPFRTVEGTAKGGGEDFEDAYGELEFKNDETVKTIRVKIVDEEEYERQENFFIALGEPKWMER-------------GISEVTDRKLTVEE--EEAKRIAEMGKPVLGEHPKLEVIIEESYEFKSTVDKLIKKTNLALVVGTHSWRDQFMEAITVSA--GGDEDEDESGEERLPSCFDYVMHFLTVFWKVLFACVPPTEYCHGWACFVVSILIIGMLTAIIGDLASHFGCTIGLKDSVTAVVFVAFGTSVPDTFASKAAALQDVYADASIGNVTGSNAVNVFLGIGLAWSVAAIYWAMQGQEFHVSAGTLAFSVTLFTIFAFVCLSVLLYRRRPHLGGELGGPRGCKLATTWLFVSLWLLYILFATLEAYCYIKGF 921          
BLAST of slc8a-1 vs. Ensembl Mouse
Match: Slc8a3 (solute carrier family 8 (sodium/calcium exchanger), member 3 [Source:MGI Symbol;Acc:MGI:107976])

HSP 1 Score: 833.558 bits (2152), Expect = 0.000e+0
Identity = 475/906 (52.43%), Postives = 622/906 (68.65%), Query Frame = 2
Query:  428 NGACESLNDTSCKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALE--GDHE--LHCNHSLEDAH-LDGDKKENLTELE-----KTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLER-RLSQDPDKLGLKEKENNNQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQ---DGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGG-TDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVSQSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            N +C   +D  CK+G++LP+W P    S+GDKIAR  VYFV+L+Y+FLGVSIIADRFMASIEVITS+ER+V ++K NGE  T  +R+WNETVSNLTLMALGSSAPEILLS+IE+CG  F AGDLGP TIVGSAAFN+FIIIG CVYVIPDGE R+IKHL VF +TA+WS+FAYIWLY+I+A FSP V+QVWE LLT FFF + VL A+VAD ++   K++ ++Y     +   +E  GDH   +  +  + ++H LDG    N T LE     ++R + I ++++++ K+P  D   L E A    L+   KSRAFYR+QATR +TG+GN++KK   E+ + +    ++   E E+   K+FFDP  Y  +EN G   + V R G D  I+KTM  V+Y TEDG+A AG DY  T G V+ + GE QK   + IIDDDIFE DEHFF+ L + R   +   +G   +I  L    +    L  P +AT+ +LDDDHAGIF FE     V+ES G  E+KV R+SGARG V+VP+R+   TA GG  D+ +    LEF ND+T   I+V I+D+ EYE+ E F I LGEP  +++ GI    +  E T      E +        ++  I +MGKP LG+  +++VII+ES EFK  VD L++   L+  +GT SW++QF+EAITVS      ED D+  EE+LPSC DYVMHFLT+FWKVLFA VPPT+Y  GW  F V I++IG LTA+IGDLAS FGCTIG+ ++VTA+ FVA GTS+PDTFASK AA+ D  AD+S+GNVTGSNAVNVFLGIGLAWS+AA+Y   +G  F V +G+L FSVT+F IFA   ++ +L RR   +GGELGGPR  K+ATT  FV LW++Y++ ++LE YC+IKGF
Sbjct:   45 NESCSGSSD--CKEGVILPIWYP-ENPSLGDKIARVIVYFVALIYMFLGVSIIADRFMASIEVITSQEREVTIKKPNGETSTTTIRVWNETVSNLTLMALGSSAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFIIIGICVYVIPDGETRKIKHLRVFFVTAAWSIFAYIWLYMILAVFSPGVVQVWEGLLTLFFFPVCVLLAWVADKRLLFYKYMHKKYRTDKHRGIIIETEGDHPKGIEMDGKMMNSHFLDG----NFTPLEGKEVDESRREMIRILKDLKQKHPEKDLDQLVEMANYYALSHQQKSRAFYRIQATRMMTGAGNILKKHAAEQAKKTSSMSEVHTDEPEDFASKVFFDPCSYQCLENCGAVLLTVVRKGGD--ISKTMY-VDYKTEDGSANAGADYEFTEGTVVLKPGETQKEFSVGIIDDDIFEEDEHFFVRLSNVRVEEEQLAEGMLPAI--LNSLPLPRAVLASPCVATVTILDDDHAGIFTFECDTIHVSESIGVMEVKVLRTSGARGTVIVPFRTVEGTAKGGGEDFEDAYGELEFKNDETVKTIRVKIVDEEEYERQENFFIALGEPKWMER-GISALLLSPEVTDRKLTVEEE--------EAKRIAEMGKPVLGEHPKLEVIIEESYEFKSTVDKLIKKTNLALVVGTHSWRDQFMEAITVSA--GGDEDEDESGEERLPSCFDYVMHFLTVFWKVLFACVPPTEYCHGWACFVVSILIIGMLTAIIGDLASHFGCTIGLKDSVTAVVFVAFGTSVPDTFASKAAALQDVYADASIGNVTGSNAVNVFLGIGLAWSVAAIYWAMQGQEFHVSAGTLAFSVTLFTIFAFVCLSVLLYRRRPHLGGELGGPRGCKLATTWLFVSLWLLYILFATLEAYCYIKGF 927          
BLAST of slc8a-1 vs. Ensembl Mouse
Match: Slc8a1 (solute carrier family 8 (sodium/calcium exchanger), member 1 [Source:MGI Symbol;Acc:MGI:107956])

HSP 1 Score: 830.091 bits (2143), Expect = 0.000e+0
Identity = 477/935 (51.02%), Postives = 630/935 (67.38%), Query Frame = 2
Query:  410 QCEPLKNGACESLNDTSCKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALE--GDH-----ELHCNHSLEDAHLDG--------DKKENLTELEKTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLER-RLSQDPDKLGLKEKENNN-QKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRA---VTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGG-TDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILV----KKPGIGKSNIP--KEFTGFNH--------VSEVKTHSDQLVSQSSE---IEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            + E   N   E      CKKG++LP+W+P    S GDKIARA VYFV+++Y+FLGVSIIADRFM+SIEVITS+E+++ ++K NGE     VRIWNETVSNLTLMALGSSAPEILLSVIE+CG NF AGDLGP TIVGSAAFN+FIII  CVYV+PDGE R+IKHL VF +TA+WS+FAY WLY+I++  SP V++VWE LLTFFFF + V+ A+VAD ++   K++ +RY     +   +E  GD      E+  +  + ++H+D         +  E   + E+ R +   +++E++ K+P  + + L E A  +VL++  KSRAFYR+QATR +TG+GN++K+   ++ R +    ++ ++  EN+   KIFF+ G Y  +EN GT  + + R G D     T + V++ TEDGTA AG DY  T G V+F+ GE QK I + IIDDDIFE DE+F ++L + R    V++DG   S N  +     G     P  ATI + DDDHAGIF FEE  T V+ES G  E+KV R+SGARG V++PY++   TA GG  D+ +    LEF ND+    I V +IDD EYEK++ F IE+GEP LV    KK G   +  P  ++    +H        +SE       L S+  E   I +MG+P LG+  +++VII+ES EFK  VD L++   L+  +GT+SW+EQF+EAITVS    + +D D+  EEKLPSC DYVMHFLT+FWKVLFAFVPPT+Y  GW  F V I++IG LTA IGDLAS FGCTIG+ ++VTA+ FVA+GTS+PDTFASKVAA  D  AD+S+GNVTGSNAVNVFLGIG+AWSIAA+YH   G  F+V  G+L FSVT+F IFA   +  +L RR   +GGELGGPR  K+ T+  FV LW++Y+  SSLE YCHIKGF
Sbjct:   35 EAETGGNETTECTGSYYCKKGVILPIWEP-QDPSFGDKIARATVYFVAMVYMFLGVSIIADRFMSSIEVITSQEKEITIKKPNGETTKTTVRIWNETVSNLTLMALGSSAPEILLSVIEVCGHNFTAGDLGPSTIVGSAAFNMFIIIALCVYVVPDGETRKIKHLRVFFVTAAWSIFAYTWLYIILSVSSPGVVEVWEGLLTFFFFPICVVFAWVADRRLLFYKYVYKRYRAGKQRGMIIEHEGDRPASKTEIEMDGKVVNSHVDNFLDGALVLEVDERDQDDEEARREMARILKELKQKHPEKEIEQLIELANYQVLSQQQKSRAFYRIQATRLMTGAGNILKRHAADQARKAVSMHEVNMEMAENDPVSKIFFEQGTYQCLENCGTVALTIMRRGGD---LSTTVFVDFRTEDGTANAGSDYEFTEGTVIFKPGETQKEIRVGIIDDDIFEEDENFLVHLSNVRVSSDVSEDGILES-NHASSIACLG----SPSTATITIFDDDHAGIFTFEEPVTHVSESIGIMEVKVLRTSGARGNVIIPYKTIEGTARGGGEDFEDTCGELEFQNDEIVKTISVKVIDDEEYEKNKTFFIEIGEPRLVEMSEKKGGFTLTGQPIFRKVHARDHPIPSTVITISEEYDDKQPLTSKEEEERRIAEMGRPILGEHTKLEVIIEESYEFKSTVDKLIKKTNLALVVGTNSWREQFIEAITVSA--GEDDDDDECGEEKLPSCFDYVMHFLTVFWKVLFAFVPPTEYWNGWACFIVSILMIGLLTAFIGDLASHFGCTIGLKDSVTAVVFVALGTSVPDTFASKVAATQDQYADASIGNVTGSNAVNVFLGIGVAWSIAAIYHAANGEQFKVSPGTLAFSVTLFTIFAFINVGVLLYRRRPEIGGELGGPRTAKLLTSSLFVLLWLLYIFFSSLEAYCHIKGF 958          
BLAST of slc8a-1 vs. Ensembl Mouse
Match: Slc8a1 (solute carrier family 8 (sodium/calcium exchanger), member 1 [Source:MGI Symbol;Acc:MGI:107956])

HSP 1 Score: 826.624 bits (2134), Expect = 0.000e+0
Identity = 480/948 (50.63%), Postives = 632/948 (66.67%), Query Frame = 2
Query:  410 QCEPLKNGACESLNDTSCKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALE--GDH-----ELHCNHSLEDAHLDG--------DKKENLTELEKTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLER-RLSQDPDKLGLKEKENNN-QKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRA---VTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGG-TDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVK---KPGIGKSNIPKEFT----------------GFNH--------VSEVKTHSDQLVSQSSE---IEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            + E   N   E      CKKG++LP+W+P    S GDKIARA VYFV+++Y+FLGVSIIADRFM+SIEVITS+E+++ ++K NGE     VRIWNETVSNLTLMALGSSAPEILLSVIE+CG NF AGDLGP TIVGSAAFN+FIII  CVYV+PDGE R+IKHL VF +TA+WS+FAY WLY+I++  SP V++VWE LLTFFFF + V+ A+VAD ++   K++ +RY     +   +E  GD      E+  +  + ++H+D         +  E   + E+ R +   +++E++ K+P  + + L E A  +VL++  KSRAFYR+QATR +TG+GN++K+   ++ R +    ++ ++  EN+   KIFF+ G Y  +EN GT  + + R G D     T + V++ TEDGTA AG DY  T G V+F+ GE QK I + IIDDDIFE DE+F ++L + R    V++DG   S N  +     G     P  ATI + DDDHAGIF FEE  T V+ES G  E+KV R+SGARG V++PY++   TA GG  D+ +    LEF ND+    I V +IDD EYEK++ F IE+GEP LV+   K G G SN+   FT                  +H        +SE       L S+  E   I +MG+P LG+  +++VII+ES EFK  VD L++   L+  +GT+SW+EQF+EAITVS    + +D D+  EEKLPSC DYVMHFLT+FWKVLFAFVPPT+Y  GW  F V I++IG LTA IGDLAS FGCTIG+ ++VTA+ FVA+GTS+PDTFASKVAA  D  AD+S+GNVTGSNAVNVFLGIG+AWSIAA+YH   G  F+V  G+L FSVT+F IFA   +  +L RR   +GGELGGPR  K+ T+  FV LW++Y+  SSLE YCHIKGF
Sbjct:   35 EAETGGNETTECTGSYYCKKGVILPIWEP-QDPSFGDKIARATVYFVAMVYMFLGVSIIADRFMSSIEVITSQEKEITIKKPNGETTKTTVRIWNETVSNLTLMALGSSAPEILLSVIEVCGHNFTAGDLGPSTIVGSAAFNMFIIIALCVYVVPDGETRKIKHLRVFFVTAAWSIFAYTWLYIILSVSSPGVVEVWEGLLTFFFFPICVVFAWVADRRLLFYKYVYKRYRAGKQRGMIIEHEGDRPASKTEIEMDGKVVNSHVDNFLDGALVLEVDERDQDDEEARREMARILKELKQKHPEKEIEQLIELANYQVLSQQQKSRAFYRIQATRLMTGAGNILKRHAADQARKAVSMHEVNMEMAENDPVSKIFFEQGTYQCLENCGTVALTIMRRGGD---LSTTVFVDFRTEDGTANAGSDYEFTEGTVIFKPGETQKEIRVGIIDDDIFEEDENFLVHLSNVRVSSDVSEDGILES-NHASSIACLG----SPSTATITIFDDDHAGIFTFEEPVTHVSESIGIMEVKVLRTSGARGNVIIPYKTIEGTARGGGEDFEDTCGELEFQNDEIVKTISVKVIDDEEYEKNKTFFIEIGEPRLVEMSEKKG-GLSNVLCGFTLTGKEMYGQPIFRKVHARDHPIPSTVITISEEYDDKQPLTSKEEEERRIAEMGRPILGEHTKLEVIIEESYEFKSTVDKLIKKTNLALVVGTNSWREQFIEAITVSA--GEDDDDDECGEEKLPSCFDYVMHFLTVFWKVLFAFVPPTEYWNGWACFIVSILMIGLLTAFIGDLASHFGCTIGLKDSVTAVVFVALGTSVPDTFASKVAATQDQYADASIGNVTGSNAVNVFLGIGVAWSIAAIYHAANGEQFKVSPGTLAFSVTLFTIFAFINVGVLLYRRRPEIGGELGGPRTAKLLTSSLFVLLWLLYIFFSSLEAYCHIKGF 970          
BLAST of slc8a-1 vs. Ensembl Mouse
Match: Slc8a3 (solute carrier family 8 (sodium/calcium exchanger), member 3 [Source:MGI Symbol;Acc:MGI:107976])

HSP 1 Score: 825.469 bits (2131), Expect = 0.000e+0
Identity = 470/906 (51.88%), Postives = 621/906 (68.54%), Query Frame = 2
Query:  428 NGACESLNDTSCKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALE--GDHE--LHCNHSLEDAH-LDGDKKENLTELE-----KTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLER-RLSQDPDKLGLKEKENNNQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQ---DGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGG-TDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVSQSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            N +C   +D  CK+G++LP+W P    S+GDKIAR  VYFV+L+Y+FLGVSIIADRFMASIEVITS+ER+V ++K NGE  T  +R+WNETVSNLTLMALGSSAPEILLS+IE+CG  F AGDLGP TIVGSAAFN+FIIIG CVYVIPDGE R+IKHL VF +TA+WS+FAYIWLY+I+A FSP V+QVWE LLT FFF + VL A+VAD ++   K++ ++Y     +   +E  GDH   +  +  + ++H LDG    N T LE     ++R + I ++++++ K+P  D   L E A    L+   KSRAFYR+QATR +TG+GN++KK   E+ + +    ++   E E+   K+FFDP  Y  +EN G   + V R G D  I+KTM  V+Y TEDG+A AG DY  T G V+ + GE QK   + IIDDDIFE DEHFF+ L + R   +   +G   +I  L    +    L  P +AT+ +LDDDHAGIF FE     V+ES G  E+KV R+SGARG V+VP+R+   TA GG  D+ +    LEF ND+T   I + +IDD  YEK++ + IE+  P +V        ++ K       V++ K   ++   ++  I +MGKP LG+  +++VII+ES EFK  VD L++   L+  +GT SW++QF+EAITVS      ED D+  EE+LPSC DYVMHFLT+FWKVLFA VPPT+Y  GW  F V I++IG LTA+IGDLAS FGCTIG+ ++VTA+ FVA GTS+PDTFASK AA+ D  AD+S+GNVTGSNAVNVFLGIGLAWS+AA+Y   +G  F V +G+L FSVT+F IFA   ++ +L RR   +GGELGGPR  K+ATT  FV LW++Y++ ++LE YC+IKGF
Sbjct:   45 NESCSGSSD--CKEGVILPIWYP-ENPSLGDKIARVIVYFVALIYMFLGVSIIADRFMASIEVITSQEREVTIKKPNGETSTTTIRVWNETVSNLTLMALGSSAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFIIIGICVYVIPDGETRKIKHLRVFFVTAAWSIFAYIWLYMILAVFSPGVVQVWEGLLTLFFFPVCVLLAWVADKRLLFYKYMHKKYRTDKHRGIIIETEGDHPKGIEMDGKMMNSHFLDG----NFTPLEGKEVDESRREMIRILKDLKQKHPEKDLDQLVEMANYYALSHQQKSRAFYRIQATRMMTGAGNILKKHAAEQAKKTSSMSEVHTDEPEDFASKVFFDPCSYQCLENCGAVLLTVVRKGGD--ISKTMY-VDYKTEDGSANAGADYEFTEGTVVLKPGETQKEFSVGIIDDDIFEEDEHFFVRLSNVRVEEEQLAEGMLPAI--LNSLPLPRAVLASPCVATVTILDDDHAGIFTFECDTIHVSESIGVMEVKVLRTSGARGTVIVPFRTVEGTAKGGGEDFEDAYGELEFKNDETVKTIHIKVIDDKAYEKNKNYVIEMMGPRMVDM------SVQKALLLSPEVTDRKLTVEE--EEAKRIAEMGKPVLGEHPKLEVIIEESYEFKSTVDKLIKKTNLALVVGTHSWRDQFMEAITVSA--GGDEDEDESGEERLPSCFDYVMHFLTVFWKVLFACVPPTEYCHGWACFVVSILIIGMLTAIIGDLASHFGCTIGLKDSVTAVVFVAFGTSVPDTFASKAAALQDVYADASIGNVTGSNAVNVFLGIGLAWSVAAIYWAMQGQEFHVSAGTLAFSVTLFTIFAFVCLSVLLYRRRPHLGGELGGPRGCKLATTWLFVSLWLLYILFATLEAYCYIKGF 928          
BLAST of slc8a-1 vs. UniProt/SwissProt
Match: sp|P70549|NAC3_RAT (Sodium/calcium exchanger 3 OS=Rattus norvegicus OX=10116 GN=Slc8a3 PE=1 SV=1)

HSP 1 Score: 837.025 bits (2161), Expect = 0.000e+0
Identity = 476/906 (52.54%), Postives = 622/906 (68.65%), Query Frame = 2
Query:  428 NGACESLNDTSCKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALE--GDHE--LHCNHSLEDAH-LDGDKKENLTELE-----KTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLER-RLSQDPDKLGLKEKENNNQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRA---VTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGG-TDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVSQSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            N +C   +D  CK+G++LP+W P    S+GDKIAR  VYFV+L+Y+FLGVSIIADRFMASIEVITS+ER+V ++K NGE  T  +R+WNETVSNLTLMALGSSAPEILLS+IE+CG  F AGDLGP TIVGSAAFN+FIIIG CVYVIPDGE R+IKHL VF +TA+WSVFAYIWLY+I+A FSP V+QVWE LLT FFF + VL A+VAD ++   K++ +RY     +   +E  G+H   +  +  + ++H LDG    NL  LE     ++R + I ++++++ K+P  D   L E A    L+   KSRAFYR+QATR +TG+GN++KK   E+ + +    ++   E E+   K+FFDP  Y  +EN G   + V R G D  I+KTM  V+Y TEDG+A AG DY  T G V+ + GE QK   + IIDDDIFE DEHFF+ L + R      ++G   +I  L    +    L  P +AT+ +LDDDHAGIF FE     V+ES G  E+KV R+SGARG V+VP+R+   TA GG  D+ +    LEF ND+T   I+V I+D+ EYE+ E F I LGEP  +++ GI    +  E T      E +        ++  I +MGKP LG+  +++VII+ES EFK  VD L++   L+  +GT SW++QF+EAITVS   ++ ED     EE+LPSC DYVMHFLT+FWKVLFA VPPT+Y  GW  F V I++IG LTA+IGDLAS FGCTIG+ ++VTA+ FVA GTS+PDTFASK AA+ D  AD+S+GNVTGSNAVNVFLGIGLAWS+AA+Y   +G  F V +G+L FSVT+F IFA   ++ +L RR   +GGELGGPR  K+ATT  FV LW++YV+ ++LE YC+IKGF
Sbjct:   45 NESCSGSSD--CKEGVILPIWYP-ENPSLGDKIARVIVYFVALIYMFLGVSIIADRFMASIEVITSQEREVTIKKPNGETSTTTIRVWNETVSNLTLMALGSSAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFIIIGICVYVIPDGETRKIKHLRVFFVTAAWSVFAYIWLYMILAVFSPGVVQVWEGLLTLFFFPVCVLLAWVADKRLLFYKYMHKRYRTDKHRGIIIETEGEHPKGIEMDGKMMNSHFLDG----NLIPLEGKEVDESRREMIRILKDLKQKHPEKDLDQLVEMANYYALSHQQKSRAFYRIQATRMMTGAGNILKKHAAEQAKKTASMSEVHTDEPEDFASKVFFDPCSYQCLENCGAVLLTVVRKGGD--ISKTMY-VDYKTEDGSANAGADYEFTEGTVVLKPGETQKEFSVGIIDDDIFEEDEHFFVRLSNVRVEEEQLEEGMTPAI--LNSLPLPRAVLASPCVATVTILDDDHAGIFTFECDTIHVSESIGVMEVKVLRTSGARGTVIVPFRTVEGTAKGGGEDFEDTYGELEFKNDETVKTIRVKIVDEEEYERQENFFIALGEPKWMER-GISALLLSPEVTDRKLTMEEE--------EAKRIAEMGKPVLGEHPKLEVIIEESYEFKSTVDKLIKKTNLALVVGTHSWRDQFMEAITVSAAGDEEEDE--SGEERLPSCFDYVMHFLTVFWKVLFACVPPTEYCHGWACFVVSILIIGMLTAIIGDLASHFGCTIGLKDSVTAVVFVAFGTSVPDTFASKAAALQDVYADASIGNVTGSNAVNVFLGIGLAWSVAAIYWAMQGQEFHVSAGTLAFSVTLFTIFAFVCLSVLLYRRRPHLGGELGGPRGCKLATTWLFVSLWLLYVLFATLEAYCYIKGF 927          
BLAST of slc8a-1 vs. UniProt/SwissProt
Match: sp|P57103|NAC3_HUMAN (Sodium/calcium exchanger 3 OS=Homo sapiens OX=9606 GN=SLC8A3 PE=1 SV=2)

HSP 1 Score: 830.861 bits (2145), Expect = 0.000e+0
Identity = 475/907 (52.37%), Postives = 622/907 (68.58%), Query Frame = 2
Query:  428 NGACESLNDTSCKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALE--GDHE--LHCNHSLEDAH-LDGDKKENLTELE-----KTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLER-RLSQDPDKLGLKEKENNNQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPR---AVTQDGKKVSI-NQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGG-TDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVSQSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            N +C   +D  CK+G++LP+W P    S+GDKIAR  VYFV+L+Y+FLGVSIIADRFMASIEVITS+ER+V ++K NGE  T  +R+WNETVSNLTLMALGSSAPEILLS+IE+CG  F AGDLGP TIVGSAAFN+FIIIG CVYVIPDGE R+IKHL VF ITA+WS+FAYIWLY+I+A FSP V+QVWE LLT FFF + VL A+VAD ++   K++ ++Y     +   +E  GDH   +  +  + ++H LDG    NL  LE     ++R + I ++++++ K+P  D   L E A    L+   KSRAFYR+QATR +TG+GN++KK   E+ + +    ++   E E+   K+FFDP  Y  +EN G   + V R G D  ++KTM  V+Y TEDG+A AG DY  T G V+ + GE QK   + IIDDDIFE DEHFF+ L + R      ++G   +I N L         L  P +AT+ +LDDDHAGIF FE     V+ES G  E+KV R+SGARG V+VP+R+   TA GG  D+ +    LEF ND+T   I+V I+D+ EYE+ E F I LGEP  +++ GI    +  + T      E +        ++  I +MGKP LG+  +++VII+ES EFK  VD L++   L+  +GT SW++QF+EAITVS   ++ ED     EE+LPSC DYVMHFLT+FWKVLFA VPPT+Y  GW  F V I++IG LTA+IGDLAS FGCTIG+ ++VTA+ FVA GTS+PDTFASK AA+ D  AD+S+GNVTGSNAVNVFLGIGLAWS+AA+Y   +G  F V +G+L FSVT+F IFA   I+ +L RR   +GGELGGPR  K+ATT  FV LW++Y++ ++LE YC+IKGF
Sbjct:   45 NESCSGSSD--CKEGVILPIWYP-ENPSLGDKIARVIVYFVALIYMFLGVSIIADRFMASIEVITSQEREVTIKKPNGETSTTTIRVWNETVSNLTLMALGSSAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFIIIGICVYVIPDGETRKIKHLRVFFITAAWSIFAYIWLYMILAVFSPGVVQVWEGLLTLFFFPVCVLLAWVADKRLLFYKYMHKKYRTDKHRGIIIETEGDHPKGIEMDGKMMNSHFLDG----NLVPLEGKEVDESRREMIRILKDLKQKHPEKDLDQLVEMANYYALSHQQKSRAFYRIQATRMMTGAGNILKKHAAEQAKKASSMSEVHTDEPEDFISKVFFDPCSYQCLENCGAVLLTVVRKGGD--MSKTMY-VDYKTEDGSANAGADYEFTEGTVVLKPGETQKEFSVGIIDDDIFEEDEHFFVRLSNVRIEEEQPEEGMPPAIFNSLPLPRAV---LASPCVATVTILDDDHAGIFTFECDTIHVSESIGVMEVKVLRTSGARGTVIVPFRTVEGTAKGGGEDFEDTYGELEFKNDETVKTIRVKIVDEEEYERQENFFIALGEPKWMER-GISALLLSPDVTDRKLTMEEE--------EAKRIAEMGKPVLGEHPKLEVIIEESYEFKTTVDKLIKKTNLALVVGTHSWRDQFMEAITVSAAGDEDEDE--SGEERLPSCFDYVMHFLTVFWKVLFACVPPTEYCHGWACFAVSILIIGMLTAIIGDLASHFGCTIGLKDSVTAVVFVAFGTSVPDTFASKAAALQDVYADASIGNVTGSNAVNVFLGIGLAWSVAAIYWALQGQEFHVSAGTLAFSVTLFTIFAFVCISVLLYRRRPHLGGELGGPRGCKLATTWLFVSLWLLYILFATLEAYCYIKGF 927          
BLAST of slc8a-1 vs. UniProt/SwissProt
Match: sp|S4R2P9|NAC3_MOUSE (Sodium/calcium exchanger 3 OS=Mus musculus OX=10090 GN=Slc8a3 PE=1 SV=1)

HSP 1 Score: 825.469 bits (2131), Expect = 0.000e+0
Identity = 470/906 (51.88%), Postives = 621/906 (68.54%), Query Frame = 2
Query:  428 NGACESLNDTSCKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALE--GDHE--LHCNHSLEDAH-LDGDKKENLTELE-----KTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLER-RLSQDPDKLGLKEKENNNQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQ---DGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGG-TDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVSQSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            N +C   +D  CK+G++LP+W P    S+GDKIAR  VYFV+L+Y+FLGVSIIADRFMASIEVITS+ER+V ++K NGE  T  +R+WNETVSNLTLMALGSSAPEILLS+IE+CG  F AGDLGP TIVGSAAFN+FIIIG CVYVIPDGE R+IKHL VF +TA+WS+FAYIWLY+I+A FSP V+QVWE LLT FFF + VL A+VAD ++   K++ ++Y     +   +E  GDH   +  +  + ++H LDG    N T LE     ++R + I ++++++ K+P  D   L E A    L+   KSRAFYR+QATR +TG+GN++KK   E+ + +    ++   E E+   K+FFDP  Y  +EN G   + V R G D  I+KTM  V+Y TEDG+A AG DY  T G V+ + GE QK   + IIDDDIFE DEHFF+ L + R   +   +G   +I  L    +    L  P +AT+ +LDDDHAGIF FE     V+ES G  E+KV R+SGARG V+VP+R+   TA GG  D+ +    LEF ND+T   I + +IDD  YEK++ + IE+  P +V        ++ K       V++ K   ++   ++  I +MGKP LG+  +++VII+ES EFK  VD L++   L+  +GT SW++QF+EAITVS      ED D+  EE+LPSC DYVMHFLT+FWKVLFA VPPT+Y  GW  F V I++IG LTA+IGDLAS FGCTIG+ ++VTA+ FVA GTS+PDTFASK AA+ D  AD+S+GNVTGSNAVNVFLGIGLAWS+AA+Y   +G  F V +G+L FSVT+F IFA   ++ +L RR   +GGELGGPR  K+ATT  FV LW++Y++ ++LE YC+IKGF
Sbjct:   45 NESCSGSSD--CKEGVILPIWYP-ENPSLGDKIARVIVYFVALIYMFLGVSIIADRFMASIEVITSQEREVTIKKPNGETSTTTIRVWNETVSNLTLMALGSSAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFIIIGICVYVIPDGETRKIKHLRVFFVTAAWSIFAYIWLYMILAVFSPGVVQVWEGLLTLFFFPVCVLLAWVADKRLLFYKYMHKKYRTDKHRGIIIETEGDHPKGIEMDGKMMNSHFLDG----NFTPLEGKEVDESRREMIRILKDLKQKHPEKDLDQLVEMANYYALSHQQKSRAFYRIQATRMMTGAGNILKKHAAEQAKKTSSMSEVHTDEPEDFASKVFFDPCSYQCLENCGAVLLTVVRKGGD--ISKTMY-VDYKTEDGSANAGADYEFTEGTVVLKPGETQKEFSVGIIDDDIFEEDEHFFVRLSNVRVEEEQLAEGMLPAI--LNSLPLPRAVLASPCVATVTILDDDHAGIFTFECDTIHVSESIGVMEVKVLRTSGARGTVIVPFRTVEGTAKGGGEDFEDAYGELEFKNDETVKTIHIKVIDDKAYEKNKNYVIEMMGPRMVDM------SVQKALLLSPEVTDRKLTVEE--EEAKRIAEMGKPVLGEHPKLEVIIEESYEFKSTVDKLIKKTNLALVVGTHSWRDQFMEAITVSA--GGDEDEDESGEERLPSCFDYVMHFLTVFWKVLFACVPPTEYCHGWACFVVSILIIGMLTAIIGDLASHFGCTIGLKDSVTAVVFVAFGTSVPDTFASKAAALQDVYADASIGNVTGSNAVNVFLGIGLAWSVAAIYWAMQGQEFHVSAGTLAFSVTLFTIFAFVCLSVLLYRRRPHLGGELGGPRGCKLATTWLFVSLWLLYILFATLEAYCYIKGF 928          
BLAST of slc8a-1 vs. UniProt/SwissProt
Match: sp|Q8K596|NAC2_MOUSE (Sodium/calcium exchanger 2 OS=Mus musculus OX=10090 GN=Slc8a2 PE=1 SV=1)

HSP 1 Score: 822.002 bits (2122), Expect = 0.000e+0
Identity = 450/899 (50.06%), Postives = 615/899 (68.41%), Query Frame = 2
Query:  461 CKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKS---YALEGD--HELHCNHSLEDAHLDGD------KKENLTELEKTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLERRLSQDPDKLGLKEKENNNQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDGKKVSINQLTEQNIYGV---ELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGG-TDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVSQSSE----IEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            C+ G++LP+W+P    S+GDK+ARA VYFV+++Y+FLGVSIIADRFMASIEVITSKE+++ + K NGE     VRIWNETVSNLTLMALGSSAPEILL+VIE+CG NF+AG+LGPGTIVGSAAFN+F++I  CVYVIP GE R+IKHL VF +TASWS+FAY+WLYLI+A FSP V+QVWEALLT  FF + V+ A++AD ++   K++ +RY R + +S      EGD    +  + +     + G+            EL+ +R + I+++++++ K+P+ D + L   A+   L    KSRAFYR+QATR +TG+GNV+++   +             ++++   +IFF+P  Y  +EN G+  + V   G +     +   V+Y TEDG+A AG DY  + G ++F+ GE QK + I IIDDDIFE DEHFF+ L + R     G       + E +  G     L+ P +AT+ +LDDDHAGIF+F++    V+E  G  +++V RSSGARG V +PYR+   TA GG   Y +    LEF +D+T   ++V I+DD EYEK + F IELG+P  +K+             G + +   + + D+ ++   E    I +MGKP LG+   ++VII+ES +FK+ VD L++   L+  IGT SW+EQF+EA+TVS G+ + ED D   EE+LPSC DYVMHFLT+FWKVLFA VPPT+Y  GW  F VCI+VIG LTA+IGDLAS FGCT+G+ ++V A+ FVA+GTS+PDTFASKVAA+ D  AD+S+GNVTGSNAVNVFLG+G+AWS+AAVY   +G  F V++G+L FSVT+F +FA   IA +L RR  ++GGELGGPR  K+ATT  F+GLW +Y++ SSLE YCHI+GF
Sbjct:   49 CQPGVLLPVWEP-EDPSLGDKVARAVVYFVAMVYMFLGVSIIADRFMASIEVITSKEKEITITKANGETSVGTVRIWNETVSNLTLMALGSSAPEILLTVIEVCGHNFQAGELGPGTIVGSAAFNMFVVIAVCVYVIPAGESRKIKHLRVFFVTASWSIFAYVWLYLILAVFSPGVVQVWEALLTLIFFPVCVVFAWMADKRLLFYKYVYKRY-RTDPRSGIIIGAEGDPPKSIELDGTFVGTEVPGELGALGTGPAEARELDASRREVIQILKDLKQKHPDKDLEQLMGIAKYYALLHQQKSRAFYRIQATRLMTGAGNVLRRHAADAARRPGATDGAPDDEDDGASRIFFEPSLYHCLENCGSVLLSVACQGGE---GNSTFYVDYRTEDGSAKAGSDYEYSEGTLVFKPGETQKDLRIGIIDDDIFEEDEHFFVRLLNLRVGDAQG-------MFEPDGGGRPKGRLVAPLLATVTILDDDHAGIFSFQDRLLHVSECMGTVDVRVVRSSGARGTVRLPYRTVDGTARGGGVHYEDACGELEFGDDETMKTLQVKIVDDEEYEKKDNFFIELGQPQWLKR-------------GISALLLNQGNGDKKITAEQEEAQRIAEMGKPVLGENNRLEVIIEESYDFKNTVDKLIKKTNLALVIGTHSWREQFIEAVTVSAGDEE-EDEDGPREERLPSCFDYVMHFLTVFWKVLFACVPPTEYCNGWACFGVCILVIGVLTALIGDLASHFGCTVGLKDSVNAVVFVALGTSIPDTFASKVAALQDQCADASIGNVTGSNAVNVFLGLGVAWSVAAVYWAVQGRPFEVRAGTLAFSVTLFTVFAFVCIAVLLYRRRPQIGGELGGPRGPKLATTALFLGLWFLYILFSSLEAYCHIRGF 921          
BLAST of slc8a-1 vs. UniProt/SwissProt
Match: sp|P70414|NAC1_MOUSE (Sodium/calcium exchanger 1 OS=Mus musculus OX=10090 GN=Slc8a1 PE=1 SV=1)

HSP 1 Score: 821.617 bits (2121), Expect = 0.000e+0
Identity = 475/948 (50.11%), Postives = 628/948 (66.24%), Query Frame = 2
Query:  410 QCEPLKNGACESLNDTSCKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALE--GDH-----ELHCNHSLEDAHLDG--------DKKENLTELEKTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLER-RLSQDPDKLGLKEKENNN-QKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRA---VTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGG-TDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGF-------------------NH--------VSEVKTHSDQLVSQSSE---IEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            + E   N   E      CKKG++LP+W+P    S GDKIARA VYFV+++Y+FLGVSIIADRFM+SIEVITS+E+++ ++K NGE     VRIWNETVSNLTLMALGSSAPEILLSVIE+CG NF AGDLGP TIVGSAAFN+FIII  CVYV+PDGE R+IKHL VF +TA+WS+FAY WLY+I++  SP V++VWE LLTFFFF + V+ A+VAD ++   K++ +RY     +   +E  GD      E+  +  + ++H+D         +  E   + E+ R +   +++E++ K+P  + + L E A  +VL++  KSRAFYR+QATR +TG+GN++K+   ++ R +    ++ ++  EN+   KIFF+ G Y  +EN GT  + + R G D     T + V++ TEDGTA A  DY  T G V+F+ GE QK I + IIDDDIFE DE+F ++L + R    V++DG   S N  +     G     P  ATI + DDDHAGIF FEE  T V+ES G  E+KV R+SGARG V++PY++   TA GG  D+ +     EF ND+    I V +IDD EYEK++ F IE+GEP LV+     K+ +  E  GF                   +H        +SE       L S+  E   I +MG+P LG+  +++VII+ES EFK  VD L++   L+  +GT+SW+EQF+EAITVS    + +D D+  EEKLPSC DYVMHFLT+FWKVLFAFVPPT+Y  GW  F V I++IG LTA IGDLAS FGCTIG+ ++VTA+ FVA+GTS+PDTFASKVAA  D  AD+S+GNVTGSNAVNVFLGIG+AWSIAA+YH   G  F+V  G+L FSVT+F IFA   +  +L RR   +GGELGGPR  K+ T+  FV LW++Y+  SSLE YCHIKGF
Sbjct:   35 EAETGGNETTECTGSYYCKKGVILPIWEP-QDPSFGDKIARATVYFVAMVYMFLGVSIIADRFMSSIEVITSQEKEITIKKPNGETTKTTVRIWNETVSNLTLMALGSSAPEILLSVIEVCGHNFTAGDLGPSTIVGSAAFNMFIIIALCVYVVPDGETRKIKHLRVFFVTAAWSIFAYTWLYIILSVSSPGVVEVWEGLLTFFFFPICVVFAWVADRRLLFYKYVYKRYRAGKQRGMIIEHEGDRPASKTEIEMDGKVVNSHVDNFLDGALVLEVDERDQDDEEARREMARILKELKQKHPEKEIEQLIELANYQVLSQQQKSRAFYRIQATRLMTGAGNILKRHAADQARKAVSMHEVNMEMAENDPVSKIFFEQGTYQCLENCGTVALTIMRRGGD---LSTTVFVDFRTEDGTANAASDYEFTEGTVIFKPGETQKEIRVGIIDDDIFEEDENFLVHLSNVRVSSDVSEDGILES-NHASSIACLG----SPSTATITIFDDDHAGIFTFEEPVTHVSESIGIMEVKVLRTSGARGNVIIPYKTIEGTARGGGEDFEDTCGEPEFQNDEIVKTISVKVIDDEEYEKNKTFFIEIGEPRLVEMSE-KKALLLNELGGFTLTGKEMYGQPIFRKVHARDHPIPSTVITISEEYDDKQPLTSKEEEERRIAEMGRPILGEHTKLEVIIQESYEFKSTVDKLIKKTNLALVVGTNSWREQFIEAITVSA--GEDDDDDECGEEKLPSCFDYVMHFLTVFWKVLFAFVPPTEYWNGWACFIVSILMIGLLTAFIGDLASHFGCTIGLKDSVTAVVFVALGTSVPDTFASKVAATQDQYADASIGNVTGSNAVNVFLGIGVAWSIAAIYHAANGEQFKVSPGTLAFSVTLFTIFAFINVGVLLYRRRPEIGGELGGPRTAKLLTSSLFVLLWLLYIFFSSLEAYCHIKGF 970          
BLAST of slc8a-1 vs. TrEMBL
Match: A0A0H3YEY7 (Slc8a-1 OS=Schmidtea mediterranea OX=79327 GN=slc8a-1 PE=2 SV=1)

HSP 1 Score: 1805.42 bits (4675), Expect = 0.000e+0
Identity = 917/917 (100.00%), Postives = 917/917 (100.00%), Query Frame = 2
Query:  350 MRGNLLFGSCIVVIEFLSWIQCEPLKNGACESLNDTSCKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALEGDHELHCNHSLEDAHLDGDKKENLTELEKTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLERRLSQDPDKLGLKEKENNNQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGGTDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVSQSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            MRGNLLFGSCIVVIEFLSWIQCEPLKNGACESLNDTSCKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEALLTFFFFFLTVLTAYVADTKIFIKKFLKRRYLRKNVKSYALEGDHELHCNHSLEDAHLDGDKKENLTELEKTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLERRLSQDPDKLGLKEKENNNQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPIEISIIDDDIFEADEHFFINLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGGTDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVSQSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF
Sbjct:    1 MRGNLLFGSCIVVIEFLSWIQCEPLKNGACESLNDTSCKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEALLTFFFFFLTVLTAYVADTKIFIKKFLKRRYLRKNVKSYALEGDHELHCNHSLEDAHLDGDKKENLTELEKTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLERRLSQDPDKLGLKEKENNNQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPIEISIIDDDIFEADEHFFINLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGGTDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVSQSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 917          
BLAST of slc8a-1 vs. TrEMBL
Match: A0A075A220 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_00721 PE=3 SV=1)

HSP 1 Score: 1009.21 bits (2608), Expect = 0.000e+0
Identity = 545/914 (59.63%), Postives = 674/914 (73.74%), Query Frame = 2
Query:  416 EPLKNGACESLNDTSCKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALEGDHELHCNHSLEDAHLDGDKKENLTELEKTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLERRLSQDPDKLGLKEKENNNQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTAT-GGTDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVS------------------QSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            + L NG C S   T+C  GI++P W+P  GLS+GDK+ARA +YF  L+YLFLGVSIIADRFMA+IEVITSKE++V VRKKNGE+QTI VRIWN TVSNLTLMALGSSAPEILLSVIEI G NFEAGDLGPGTIVGSAAFNLF+IIG CV VIP+GEVRRIKHLSVF ITASWS+FAY+WLYLIIA FSP V+++WEALLTF FF + V+ AY+ADTKI   K   ++  R   +  +++ D E + NH+ E  ++       ++E E+TR++Y++ I+EIR KNPNID K LEE AQ++VL++ PKSRAFYRMQATR LTGSGNVIKK+K+ERR+S D  ++  +    + Q+IFF+PGHYTVMENVGTF + V R G D      ++ V Y T DGTA A +DY+  SGV++F++GE  K   I+IIDDDIFE DEHF + L  P  V         N   E       L+EP  ATIMVLDDDH+G+F+FE+  T V ESC  AE+KV R SG RG+V VPY++   +A  GG DY +   YLEF NDQTEA I+V ++DDN+YEK E+F ++LGEP+LV K    + ++   FT  N    + +  +++ S                   S  + D GKPRLG+   IKV I ES EFK+ VD L++ G+ +  +GTSSWKEQFVEA+TVS G  D E + DL EEKLPSC+DYVMHFLT+FWKVLFAFVPPTDY GGW  F VCI+VIG LTA+IGD+AS FGC+IG+T+AVTAITFVA+GTS PDTFASKVAAI D  ADSS+GNVTGSNAVNVFLGIG+AWSIAA+YH  +G+ F V+ GSLGFSVTVFCIFAL AI  ++LRR   VGGELGGP+ +K  + ++F+ LW+ Y+IL+ LENYCHI+GF
Sbjct:   26 DKLINGTCPSSKKTACVDGILIPKWEPSTGLSVGDKLARATIYFACLLYLFLGVSIIADRFMAAIEVITSKEKEVTVRKKNGEVQTIYVRIWNTTVSNLTLMALGSSAPEILLSVIEIIGKNFEAGDLGPGTIVGSAAFNLFVIIGICVLVIPEGEVRRIKHLSVFFITASWSIFAYLWLYLIIAAFSPGVVEIWEALLTFIFFPIIVICAYIADTKI-FFKKFLKKKFRAAGRLKSIDIDAE-YPNHTEEVTYVPESDDSQVSEFERTRLNYVDAIKEIRKKNPNIDMKQLEEMAQLDVLSKGPKSRAFYRMQATRQLTGSGNVIKKAKVERRMSSDDQRMESESYAPHVQRIFFNPGHYTVMENVGTFPITVSRVGGD---LDAVVSVNYSTVDGTAVADEDYVPVSGVLVFKAGETHKQFSITIIDDDIFEEDEHFTVILTDPTVVHS-------NTFVEP-----LLVEPTKATIMVLDDDHSGVFHFEQQATSVPESCEYAELKVLRDSGCRGIVRVPYQTIEGSAKGGGKDYEDAIGYLEFQNDQTEATIRVRVVDDNDYEKSEFFFVQLGEPLLVDKD--AQQSLLSRFT--NRRPTIPSTPEKVASPDAGKQLALPETQETGRRTSQGLIDTGKPRLGEWSRIKVTIVESNEFKNTVDRLVKQGKWALVVGTSSWKEQFVEAVTVSAG-GDGEGA-DLEEEKLPSCMDYVMHFLTVFWKVLFAFVPPTDYGGGWWCFSVCILVIGVLTAIIGDMASAFGCSIGLTDAVTAITFVALGTSPPDTFASKVAAIGDSDADSSIGNVTGSNAVNVFLGIGIAWSIAAIYHAIQGTQFYVQPGSLGFSVTVFCIFALAAITVIVLRRRPSVGGELGGPKTVKYLSGLFFITLWLCYIILAGLENYCHIEGF 916          
BLAST of slc8a-1 vs. TrEMBL
Match: G7YEK8 (Solute carrier family 8 OS=Clonorchis sinensis OX=79923 GN=CLF_106026 PE=3 SV=1)

HSP 1 Score: 1005.36 bits (2598), Expect = 0.000e+0
Identity = 548/929 (58.99%), Postives = 676/929 (72.77%), Query Frame = 2
Query:  422 LKNGACESLNDTSCKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALEGDHELHCNHSLEDAHLDGDKKENLTELEKTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLERRLSQDPDKLGLKEKENNNQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTAT-GGTDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILV-----------KKPGI------GKSNIPKEFTGFNHVSEVKTHSDQLVS------------------QSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            L NG C S   T+C  G+++P W+P  GLS+GDK+ARA +YF  L+YLFLGVSIIADRFMA+IEVITSKE++V VRKKNGE+QTI VRIWN TVSNLTLMALGSSAPEILLSVIEI G NFEAGDLGPGTIVGSAAFNLF+IIG CV VIP+GEVRRIKHLSVF ITASWS+FAY+WLYLIIA FSP V+++WEALLTF FF + V+ AY+ADTKI   K   ++  R   +  +++ D E + NH+ E  ++    +  ++E E+TR++Y++ I+EIR KNPNID K LEE AQ++VL++ PKSRAFYRMQATR LTGSGNVIKK+K+ERR+S D  ++  +    + Q+IFF+PGHYTVMENVGTF + V R G D      ++ V Y T DGTA A +DY+  SGV++F++GE  K   I+IIDDDIFE DEHF + L  P  V         N   E       L+EP  ATIMVLDDDH+G+F+FE+  T V ESC  AE+KV R SG RG+V VPY++   +A  GG DY +   YLEF NDQTEA I+V ++DDN+YEK E+F ++LGEP+LV           KK  I       + +I   FT  N    +    +++ S                   S  + D GKPRLG+   IKV I ES EFK+ VD L++ G+ +  +GTSSWKEQFVEA+TVS G  D E + DL EEKLPSC+DYVMHFLT+FWKVLFAFVPPTDY GGW  F VCI+VIG LTA+IGD+AS FGC+IG+T+AVTAITFVA+GTSLPDTFASKVAAI D  ADSS+GNVTGSNAVNVFLGIG+AWSIAA+YH  +G+ F V+ GSLGFSVTVFCIFAL AI  ++LRR   VGGELGGP+ +K  + ++F+ LW+ Y+IL+ LENYCHI+GF
Sbjct:   28 LINGTCPSSKKTACVDGVLIPKWEPSTGLSVGDKLARATIYFACLLYLFLGVSIIADRFMAAIEVITSKEKEVTVRKKNGEVQTIYVRIWNTTVSNLTLMALGSSAPEILLSVIEIIGKNFEAGDLGPGTIVGSAAFNLFVIIGICVLVIPEGEVRRIKHLSVFFITASWSIFAYLWLYLIIAAFSPGVVEIWEALLTFIFFPIIVICAYIADTKI-FFKKFLKKKFRAAGRLKSIDIDAE-YPNHTEEVTYIPESDENQVSEFERTRLNYVDAIKEIRKKNPNIDMKQLEEMAQLDVLSKGPKSRAFYRMQATRQLTGSGNVIKKAKVERRMSSDDQRMESESYAPHVQRIFFNPGHYTVMENVGTFPITVSRVGGD---LDAVVSVNYSTVDGTAVADEDYVPVSGVLVFKAGETHKQFSITIIDDDIFEEDEHFTVILTDPTVVHS-------NTFLEP-----LLVEPTKATIMVLDDDHSGVFHFEQQATSVPESCEYAELKVLRDSGCRGIVRVPYQTIEGSAKGGGKDYEDTIGYLEFQNDQTEATIRVRVVDDNDYEKSEFFFVQLGEPLLVDKDEEHEQRFMKKMNISMTESEAQQSILSRFT--NRRPTIPNTPEKVASPENGKQLALPETQESGRRTSQGLIDTGKPRLGEWSRIKVTIVESNEFKNTVDRLVKQGKWALVVGTSSWKEQFVEAVTVSAG-GDGEGA-DLEEEKLPSCMDYVMHFLTVFWKVLFAFVPPTDYGGGWWCFSVCILVIGVLTAIIGDMASAFGCSIGLTDAVTAITFVALGTSLPDTFASKVAAIGDSDADSSIGNVTGSNAVNVFLGIGIAWSIAAIYHAIQGTQFYVQPGSLGFSVTVFCIFALAAITVIVLRRRPSVGGELGGPKTVKYLSGLFFITLWLCYIILAGLENYCHIEGF 935          
BLAST of slc8a-1 vs. TrEMBL
Match: A0A4E0RE08 (Sodium calcium exchanger OS=Fasciola hepatica OX=6192 GN=D915_003293 PE=3 SV=1)

HSP 1 Score: 1005.36 bits (2598), Expect = 0.000e+0
Identity = 553/918 (60.24%), Postives = 679/918 (73.97%), Query Frame = 2
Query:  428 NGACESLNDTSCKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRR-----YLRKNVKSYALEGDHELHCNHSLEDAHLDGDKKENLTELEKTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLERRLSQDPDKLGLKEKENNNQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTAT-GGTDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKK---------------------PGIGKSNIPKEFTGFNHVSEVKTHSDQLVSQSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            NG C S   T C  GI++P W+P  GLS GDK ARA VYF  LMYLFLGVSIIADRFMA+IEVITS+E++V ++KKNGE+Q I VRIWNETVSNLTLMALGSSAPEILLSVIEICG +FEAGDLGPGTIVGSAAFNLF+IIG CV V+P+G++RRIKHLSVFLITASWSVFAY+W+YLI+A FSP V+++WEAL+TF FF + VL AYVADTKIF KKFLK+R     YL+K V         +    +SLE          +++E EK R+DY+E IREIR +NPNID K LEE AQ+EVLN+ PKSRAFYRMQATR LTGSGNVIKK+K+ERR+S+D  +L  +   ++ Q+ FF+PGHYTVMENVGTF+V V R G D      ++ V+Y T DGTAT+G+DY+  SG ++F+SGE  K I ++IIDDDIFE DEHF I L + + +   G    +            L++P +ATIMVLDDDH+GIF+FE     V+ESC  AE+KV R SG RGVV +PY++   TA  GG DY +   +LEF N+QTE +I+V I+DDN+YEK E+F ++LGEP+LV K                     P + K  +P +  G    +EVK  S        +  + GKPRLG+   IKV I ES EFK+ VD L++ G+ +  +GTSSWKEQFVEAITVS G +     D+  EEKLPSC+DYVMHFLT+FWKVLFAFVPPTDY GGW+ F VCI+VIG LTAVIGD+AS FGC++G+T+AVTAITFVA+GTSLPDTFASKVAAI D  ADSS+GNVTGSNAVNVFLGIG+AWSIAA++H  +G+ F VK GSLGFSVTVFCIFAL AI  +LLRR+  VGGELGGP+ +K  +  +F+GLW++Y+IL+ LENYCHI+GF
Sbjct:   29 NGTCLSSTKTQCVDGILIPKWEPSEGLSAGDKAARATVYFACLMYLFLGVSIIADRFMAAIEVITSQEKEVKIKKKNGEVQIIYVRIWNETVSNLTLMALGSSAPEILLSVIEICGKHFEAGDLGPGTIVGSAAFNLFVIIGLCVMVVPNGQIRRIKHLSVFLITASWSVFAYLWMYLILAVFSPGVVELWEALITFIFFPVIVLCAYVADTKIFFKKFLKKRYKAAGYLKK-VGKENELEKLKEEVTYSLE------ADDNSVSEFEKHRLDYVEAIREIRKRNPNIDMKQLEEMAQMEVLNKGPKSRAFYRMQATRQLTGSGNVIKKAKVERRMSEDSCRLEGESYPSHVQRFFFNPGHYTVMENVGTFSVTVSRIGGD---LNAVVSVDYETVDGTATSGEDYVPASGTLVFRSGESYKQIPVTIIDDDIFEEDEHFTIELSNLKVMNSHGPVEPM------------LVDPKVATIMVLDDDHSGIFHFELQTKDVSESCEYAELKVVRDSGCRGVVRLPYQTIEGTAKGGGKDYEDNVGFLEFQNNQTEDYIRVRIMDDNDYEKHEFFFVQLGEPVLVNKDAQPKLLSRFARRRSTAGSTAPTVEKVAVPDDTNG--KRAEVKDLSSGTTKLPEDFVETGKPRLGEWTRIKVNIVESYEFKNTVDRLVKQGKWALVVGTSSWKEQFVEAITVSAGGDSDPTGDE--EEKLPSCMDYVMHFLTVFWKVLFAFVPPTDYGGGWLCFSVCILVIGVLTAVIGDMASSFGCSVGLTDAVTAITFVALGTSLPDTFASKVAAIGDQYADSSIGNVTGSNAVNVFLGIGVAWSIAAIHHAIQGTQFFVKPGSLGFSVTVFCIFALVAITLILLRRHPAVGGELGGPKTIKYLSGSFFIGLWVIYIILAGLENYCHIEGF 920          
BLAST of slc8a-1 vs. TrEMBL
Match: A0A087VYY9 (Sodium calcium exchanger OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000117900 PE=3 SV=1)

HSP 1 Score: 945.266 bits (2442), Expect = 0.000e+0
Identity = 514/905 (56.80%), Postives = 668/905 (73.81%), Query Frame = 2
Query:  425 KNGACESLNDTSCKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALEGDHELHCNHSLEDAH--LDGDKKENLTELEKTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLERRLSQDPDKLGLKEKENNNQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATG-GTDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPG-------IGKSNIPKEFTGFNHVSEV-KTHSDQLVSQSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRV-GGELGGPR-HLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            ++G C S  + SCK G++LP+W+P   +S+     RA VYF+SLMY FLGVSIIADRFMA+IEVITS+E++V V+ K+GE+Q I+VRIWNETVSNLTLMALGSSAPEILLS+IEICG+NFEAG+LGPGTIVGSAAFNLF+IIG C+ VIP+GE RRIKH  VF++T+ WSVFAY+WLY II+  S  +++ WEA LTF FF +TV+TAY+AD K+F +KFLK+RY  +    Y ++   ++  N    ++    +  +     E EKTR++YIE I+EIR KNP IDPK LEE AQIEVLN+ PKSRA+YR+QATR LTGSGNVI KSKLER+LS    ++  +    + Q+++F+PGHYTVMENVG+F + + R G D    +  + ++Y TEDGTA A +DY  T+G ++F+S E  K I I+IIDDD+FE DEHF + L + R +   G       LT +     +L++P +AT+MVLDDDH+G+F+F      ++ESC  AE  V RSSGARG V VP+++   +A G G DY +   ++EF+NDQTE  I+V I+DDN+YEK EYF IELG+P LV+K G       + +   P      + V +V  T +D++    +E  D G PRLG    ++V IKES E K+ VD L++HG+    +GTSSWKEQFV+AITV+ G++D  ++    E+K+PSC DYVMHFLT+FWKVLFAFVPPT+Y GGWV F V I+VIG LTA+IGDLAS FGCT+G+T+AVT+ TFVA+GTSLPDTFASKVAAI D  ADSS+ NVTGSNAVNVFLGIG+AW+IAA+ H+ +GSTF V +GSLGFSVT+FCIFAL AIA ++LRR   + GGELGGPR  +K A+ I+F+ LW++YV+LSSLENYC+I GF
Sbjct:   27 EDGKCPSTANISCKDGLLLPVWRPKDNISVARIAGRAIVYFLSLMYCFLGVSIIADRFMAAIEVITSQEKEVRVKSKSGEVQVISVRIWNETVSNLTLMALGSSAPEILLSIIEICGTNFEAGELGPGTIVGSAAFNLFVIIGICIAVIPNGETRRIKHFGVFVVTSIWSVFAYLWLYFIISVTSKGIVEFWEAFLTFLFFPITVITAYIADIKLFQRKFLKKRYKARRKAKYMIKNASDIEANGKFANSEPVSESSEGSLEEEYEKTRLEYIETIKEIRKKNPQIDPKALEELAQIEVLNKGPKSRAYYRIQATRQLTGSGNVITKSKLERKLSIQQTEV-TELYAPDVQQLYFNPGHYTVMENVGSFQITISRKGGD---LRDEVAIDYATEDGTAVANEDYEPTNGTLVFRSNEQHKQISITIIDDDVFEEDEHFDVRLSNLRVIHTSG-------LTSE----WKLVDPVVATVMVLDDDHSGVFHFASESVDISESCEVAEFTVVRSSGARGCVYVPFKTMDGSAKGNGKDYSDTSGFVEFLNDQTEGVIRVPIVDDNDYEKSEYFFIELGQPTLVEKEGAHSFFSMMSEKLFPDTLKRRSLVRKVDPTKADEVTD--TEGLDPGLPRLGQYARLRVNIKESTELKNTVDRLVKHGKWVLLLGTSSWKEQFVDAITVNAGDDDDLEAIAEGEKKMPSCTDYVMHFLTVFWKVLFAFVPPTEYAGGWVCFVVSIIVIGFLTAIIGDLASAFGCTVGLTDAVTSTTFVALGTSLPDTFASKVAAIGDKYADSSICNVTGSNAVNVFLGIGVAWTIAAIVHWVRGSTFVVPAGSLGFSVTIFCIFALFAIALLVLRRKPSLGGGELGGPRASIKWASAIFFLLLWLIYVLLSSLENYCYIVGF 914          
BLAST of slc8a-1 vs. Ensembl Cavefish
Match: slc8a1a (sodium/calcium exchanger 1 [Source:NCBI gene;Acc:103029712])

HSP 1 Score: 848.966 bits (2192), Expect = 0.000e+0
Identity = 469/916 (51.20%), Postives = 630/916 (68.78%), Query Frame = 2
Query:  425 KNGACESLNDTSCKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALE--GDHELHCNHSLE------DAH----LDGDKKENLTEL--EKTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLER-RLSQDPDKLGLKEKENN-NQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGG-TDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFNH---VSEVKTHSDQLVSQSSE----IEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            ++G C       CK+G++LPLW P    S  DK+ARA +YFV L Y+FLGVSIIADRFMASIEVITS+E+++ ++K NGE  T  VRIWNETVSNLTLMALGSSAPEILLSV+E+CG NF+AG+LGP TIVGSAAFN+F+IIG CV VIPDG+ R++KHL VF +TA+WS+FAY WLYLI+A  SP V++VWE LLT FFF + V+ A+VAD ++   K++ +RY     +   +E  G+ EL     +E      ++H    LDG    ++ E+  E+ R +   ++++++ K+P  + + L E A  +VL++  KSRAFYR QATR +TG+GN++KK   ++ R +    +L  +  +N+ + KIFFDPG Y  +EN G+  + V R G D     + I V Y TEDGTA AG DY  + GV++F  GE +K I I IIDDDIFE DEHF ++L + + +++     S       ++ G+ L  P  AT+ + DDDHAGIF FEE    V+ES G  E+KV R+SGARG V+VPY++   TA GG  D+ +    LEF ND+    +++NIIDD EYEK++ F +ELGEP +++       ++ ++  G ++    + +    D  +SQ  +    I +MG+P LGD   ++V+I+ES EFK  VD L++   L+  +GT+SW+EQFVEAITV+ G +D E+    SEEKLPSC DYVMHFLT+FWK+LFAFVPPTDY  GW  F V I +IG LTAVIGDLAS FGCT+G+ ++VTA+ FVA+GTS+PDTFASKVAAI D  AD+ +GNVTGSNAVNVFLGIG+AWSIAA+YH + G  FRV+ G+L FSVT+F IFA   IA ++ RR   +GGELGGPR  K  T+  F  LW++Y++LSSLE YC IKGF
Sbjct:   54 ESGTCS--GSYECKEGVILPLWTP-ENPSFPDKLARATIYFVGLFYMFLGVSIIADRFMASIEVITSQEKEITIKKPNGETTTTTVRIWNETVSNLTLMALGSSAPEILLSVVEVCGHNFDAGELGPNTIVGSAAFNMFVIIGLCVSVIPDGDHRKVKHLRVFFVTAAWSIFAYTWLYLILAVISPGVVEVWEGLLTLFFFPICVVFAWVADRRLLFYKYVNKRYRVGKQRGMIIETEGEPELQSKADIEMDGQMLNSHGEDFLDGAVNTDIKEMDEEEARREMARILKDLKQKHPEKEMEQLIELANYQVLSQQQKSRAFYRCQATRLMTGAGNILKKHAADQARKAICTHELRTEVSDNDFSSKIFFDPGTYQCLENCGSVALNVVRRGGD---LTSTISVSYRTEDGTANAGSDYEFSEGVIVFNPGETEKEIRIEIIDDDIFEEDEHFLVHLSNIQVLSESRNNGSPVLNHVDSLAGLGL--PSTATVTIFDDDHAGIFAFEEQMMHVSESIGIMEVKVVRTSGARGAVVVPYKTIEGTAKGGGEDFEDTHGVLEFQNDEISKTLQINIIDDEEYEKNKNFFMELGEPRMMEMSERKGGDVYRKVQGRDNPVPSTIINLAEDISLSQKEQEERRIAEMGRPTLGDNTRLEVVIEESYEFKSTVDKLIKKTNLALLVGTNSWREQFVEAITVNSGGDDDEEC---SEEKLPSCFDYVMHFLTVFWKILFAFVPPTDYWNGWACFVVSISMIGLLTAVIGDLASHFGCTVGLKDSVTAVVFVALGTSVPDTFASKVAAIQDQYADACIGNVTGSNAVNVFLGIGVAWSIAAIYHQWNGQYFRVQPGTLAFSVTLFTIFAFVCIAVLMYRRRPEIGGELGGPRTAKRITSSLFFSLWLLYIVLSSLEAYCIIKGF 958          
BLAST of slc8a-1 vs. Ensembl Cavefish
Match: slc8a1a (sodium/calcium exchanger 1 [Source:NCBI gene;Acc:103029712])

HSP 1 Score: 846.655 bits (2186), Expect = 0.000e+0
Identity = 471/913 (51.59%), Postives = 625/913 (68.46%), Query Frame = 2
Query:  425 KNGACESLNDTSCKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALE--GDHELHCNHSLE------DAH----LDGDKKENLTEL--EKTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLER-RLSQDPDKLGLKEKENN-NQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGG-TDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVSQSSE----IEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            ++G C       CK+G++LPLW P    S  DK+ARA +YFV L Y+FLGVSIIADRFMASIEVITS+E+++ ++K NGE  T  VRIWNETVSNLTLMALGSSAPEILLSV+E+CG NF+AG+LGP TIVGSAAFN+F+IIG CV VIPDG+ R++KHL VF +TA+WS+FAY WLYLI+A  SP V++VWE LLT FFF + V+ A+VAD ++   K++ +RY     +   +E  G+ EL     +E      ++H    LDG    ++ E+  E+ R +   ++++++ K+P  + + L E A  +VL++  KSRAFYR QATR +TG+GN++KK   ++ R +    +L  +  +N+ + KIFFDPG Y  +EN G+  + V R G D     + I V Y TEDGTA AG DY  + GV++F  GE +K I I IIDDDIFE DEHF ++L + + +++     S       ++ G+ L  P  AT+ + DDDHAGIF FEE    V+ES G  E+KV R+SGARG V+VPY++   TA GG  D+ +    LEF ND+    +++NIIDD EYEK++ F +ELGEP +++                  +SE K   D  +SQ  +    I +MG+P LGD   ++V+I+ES EFK  VD L++   L+  +GT+SW+EQFVEAITV+ G +D E+    SEEKLPSC DYVMHFLT+FWK+LFAFVPPTDY  GW  F V I +IG LTAVIGDLAS FGCT+G+ ++VTA+ FVA+GTS+PDTFASKVAAI D  AD+ +GNVTGSNAVNVFLGIG+AWSIAA+YH + G  FRV+ G+L FSVT+F IFA   IA ++ RR   +GGELGGPR  K  T+  F  LW++Y++LSSLE YC IKGF
Sbjct:   65 ESGTCS--GSYECKEGVILPLWTP-ENPSFPDKLARATIYFVGLFYMFLGVSIIADRFMASIEVITSQEKEITIKKPNGETTTTTVRIWNETVSNLTLMALGSSAPEILLSVVEVCGHNFDAGELGPNTIVGSAAFNMFVIIGLCVSVIPDGDHRKVKHLRVFFVTAAWSIFAYTWLYLILAVISPGVVEVWEGLLTLFFFPICVVFAWVADRRLLFYKYVNKRYRVGKQRGMIIETEGEPELQSKADIEMDGQMLNSHGEDFLDGAVNTDIKEMDEEEARREMARILKDLKQKHPEKEMEQLIELANYQVLSQQQKSRAFYRCQATRLMTGAGNILKKHAADQARKAICTHELRTEVSDNDFSSKIFFDPGTYQCLENCGSVALNVVRRGGD---LTSTISVSYRTEDGTANAGSDYEFSEGVIVFNPGETEKEIRIEIIDDDIFEEDEHFLVHLSNIQVLSESRNNGSPVLNHVDSLAGLGL--PSTATVTIFDDDHAGIFAFEEQMMHVSESIGIMEVKVVRTSGARGAVVVPYKTIEGTAKGGGEDFEDTHGVLEFQNDEISKTLQINIIDDEEYEKNKNFFMELGEPRMME------------------MSERK--EDISLSQKEQEERRIAEMGRPTLGDNTRLEVVIEESYEFKSTVDKLIKKTNLALLVGTNSWREQFVEAITVNSGGDDDEEC---SEEKLPSCFDYVMHFLTVFWKILFAFVPPTDYWNGWACFVVSISMIGLLTAVIGDLASHFGCTVGLKDSVTAVVFVALGTSVPDTFASKVAAIQDQYADACIGNVTGSNAVNVFLGIGVAWSIAAIYHQWNGQYFRVQPGTLAFSVTLFTIFAFVCIAVLMYRRRPEIGGELGGPRTAKRITSSLFFSLWLLYIVLSSLEAYCIIKGF 946          
BLAST of slc8a-1 vs. Ensembl Cavefish
Match: slc8a1a (sodium/calcium exchanger 1 [Source:NCBI gene;Acc:103029712])

HSP 1 Score: 843.188 bits (2177), Expect = 0.000e+0
Identity = 472/935 (50.48%), Postives = 630/935 (67.38%), Query Frame = 2
Query:  425 KNGACESLNDTSCKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALE--GDHELHCNHSLE------DAH----LDGDKKENLTEL--EKTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLER-RLSQDPDKLGLKEKENN-NQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGG-TDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEP----------ILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVS----------------QSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            ++G C       CK+G++LPLW P    S  DK+ARA +YFV L Y+FLGVSIIADRFMASIEVITS+E+++ ++K NGE  T  VRIWNETVSNLTLMALGSSAPEILLSV+E+CG NF+AG+LGP TIVGSAAFN+F+IIG CV VIPDG+ R++KHL VF +TA+WS+FAY WLYLI+A  SP V++VWE LLT FFF + V+ A+VAD ++   K++ +RY     +   +E  G+ EL     +E      ++H    LDG    ++ E+  E+ R +   ++++++ K+P  + + L E A  +VL++  KSRAFYR QATR +TG+GN++KK   ++ R +    +L  +  +N+ + KIFFDPG Y  +EN G+  + V R G D     + I V Y TEDGTA AG DY  + GV++F  GE +K I I IIDDDIFE DEHF ++L + + +++     S       ++ G+ L  P  AT+ + DDDHAGIF FEE    V+ES G  E+KV R+SGARG V+VPY++   TA GG  D+ +    LEF ND+    +++NIIDD EYEK++ F +ELGEP          +L+ + G G     K+  G +   +V+   + + S                +   I +MG+P LGD   ++V+I+ES EFK  VD L++   L+  +GT+SW+EQFVEAITV+ G +D E+    SEEKLPSC DYVMHFLT+FWK+LFAFVPPTDY  GW  F V I +IG LTAVIGDLAS FGCT+G+ ++VTA+ FVA+GTS+PDTFASKVAAI D  AD+ +GNVTGSNAVNVFLGIG+AWSIAA+YH + G  FRV+ G+L FSVT+F IFA   IA ++ RR   +GGELGGPR  K  T+  F  LW++Y++LSSLE YC IKGF
Sbjct:   69 ESGTCS--GSYECKEGVILPLWTP-ENPSFPDKLARATIYFVGLFYMFLGVSIIADRFMASIEVITSQEKEITIKKPNGETTTTTVRIWNETVSNLTLMALGSSAPEILLSVVEVCGHNFDAGELGPNTIVGSAAFNMFVIIGLCVSVIPDGDHRKVKHLRVFFVTAAWSIFAYTWLYLILAVISPGVVEVWEGLLTLFFFPICVVFAWVADRRLLFYKYVNKRYRVGKQRGMIIETEGEPELQSKADIEMDGQMLNSHGEDFLDGAVNTDIKEMDEEEARREMARILKDLKQKHPEKEMEQLIELANYQVLSQQQKSRAFYRCQATRLMTGAGNILKKHAADQARKAICTHELRTEVSDNDFSSKIFFDPGTYQCLENCGSVALNVVRRGGD---LTSTISVSYRTEDGTANAGSDYEFSEGVIVFNPGETEKEIRIEIIDDDIFEEDEHFLVHLSNIQVLSESRNNGSPVLNHVDSLAGLGL--PSTATVTIFDDDHAGIFAFEEQMMHVSESIGIMEVKVVRTSGARGAVVVPYKTIEGTAKGGGEDFEDTHGVLEFQNDEISKTLQINIIDDEEYEKNKNFFMELGEPRMMEMSERKAVLLHECG-GFVKTDKQLFGRDVYRKVQGRDNPVPSTIINLAEDISLSQKEQEERRIAEMGRPTLGDNTRLEVVIEESYEFKSTVDKLIKKTNLALLVGTNSWREQFVEAITVNSGGDDDEEC---SEEKLPSCFDYVMHFLTVFWKILFAFVPPTDYWNGWACFVVSISMIGLLTAVIGDLASHFGCTVGLKDSVTAVVFVALGTSVPDTFASKVAAIQDQYADACIGNVTGSNAVNVFLGIGVAWSIAAIYHQWNGQYFRVQPGTLAFSVTLFTIFAFVCIAVLMYRRRPEIGGELGGPRTAKRITSSLFFSLWLLYIVLSSLEAYCIIKGF 991          
BLAST of slc8a-1 vs. Ensembl Cavefish
Match: slc8a1a (sodium/calcium exchanger 1 [Source:NCBI gene;Acc:103029712])

HSP 1 Score: 842.417 bits (2175), Expect = 0.000e+0
Identity = 472/935 (50.48%), Postives = 630/935 (67.38%), Query Frame = 2
Query:  425 KNGACESLNDTSCKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALE--GDHELHCNHSLE------DAH----LDGDKKENLTEL--EKTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLER-RLSQDPDKLGLKEKENN-NQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGG-TDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEP----------ILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVS----------------QSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            ++G C       CK+G++LPLW P    S  DK+ARA +YFV L Y+FLGVSIIADRFMASIEVITS+E+++ ++K NGE  T  VRIWNETVSNLTLMALGSSAPEILLSV+E+CG NF+AG+LGP TIVGSAAFN+F+IIG CV VIPDG+ R++KHL VF +TA+WS+FAY WLYLI+A  SP V++VWE LLT FFF + V+ A+VAD ++   K++ +RY     +   +E  G+ EL     +E      ++H    LDG    ++ E+  E+ R +   ++++++ K+P  + + L E A  +VL++  KSRAFYR QATR +TG+GN++KK   ++ R +    +L  +  +N+ + KIFFDPG Y  +EN G+  + V R G D     + I V Y TEDGTA AG DY  + GV++F  GE +K I I IIDDDIFE DEHF ++L + + +++     S       ++ G+ L  P  AT+ + DDDHAGIF FEE    V+ES G  E+KV R+SGARG V+VPY++   TA GG  D+ +    LEF ND+    +++NIIDD EYEK++ F +ELGEP          +L+ + G G     K+  G +   +V+   + + S                +   I +MG+P LGD   ++V+I+ES EFK  VD L++   L+  +GT+SW+EQFVEAITV+ G +D E+    SEEKLPSC DYVMHFLT+FWK+LFAFVPPTDY  GW  F V I +IG LTAVIGDLAS FGCT+G+ ++VTA+ FVA+GTS+PDTFASKVAAI D  AD+ +GNVTGSNAVNVFLGIG+AWSIAA+YH + G  FRV+ G+L FSVT+F IFA   IA ++ RR   +GGELGGPR  K  T+  F  LW++Y++LSSLE YC IKGF
Sbjct:   54 ESGTCS--GSYECKEGVILPLWTP-ENPSFPDKLARATIYFVGLFYMFLGVSIIADRFMASIEVITSQEKEITIKKPNGETTTTTVRIWNETVSNLTLMALGSSAPEILLSVVEVCGHNFDAGELGPNTIVGSAAFNMFVIIGLCVSVIPDGDHRKVKHLRVFFVTAAWSIFAYTWLYLILAVISPGVVEVWEGLLTLFFFPICVVFAWVADRRLLFYKYVNKRYRVGKQRGMIIETEGEPELQSKADIEMDGQMLNSHGEDFLDGAVNTDIKEMDEEEARREMARILKDLKQKHPEKEMEQLIELANYQVLSQQQKSRAFYRCQATRLMTGAGNILKKHAADQARKAICTHELRTEVSDNDFSSKIFFDPGTYQCLENCGSVALNVVRRGGD---LTSTISVSYRTEDGTANAGSDYEFSEGVIVFNPGETEKEIRIEIIDDDIFEEDEHFLVHLSNIQVLSESRNNGSPVLNHVDSLAGLGL--PSTATVTIFDDDHAGIFAFEEQMMHVSESIGIMEVKVVRTSGARGAVVVPYKTIEGTAKGGGEDFEDTHGVLEFQNDEISKTLQINIIDDEEYEKNKNFFMELGEPRMMEMSERKAVLLHECG-GFVKTDKQLFGRDVYRKVQGRDNPVPSTIINLAEDISLSQKEQEERRIAEMGRPTLGDNTRLEVVIEESYEFKSTVDKLIKKTNLALLVGTNSWREQFVEAITVNSGGDDDEEC---SEEKLPSCFDYVMHFLTVFWKILFAFVPPTDYWNGWACFVVSISMIGLLTAVIGDLASHFGCTVGLKDSVTAVVFVALGTSVPDTFASKVAAIQDQYADACIGNVTGSNAVNVFLGIGVAWSIAAIYHQWNGQYFRVQPGTLAFSVTLFTIFAFVCIAVLMYRRRPEIGGELGGPRTAKRITSSLFFSLWLLYIVLSSLEAYCIIKGF 976          
BLAST of slc8a-1 vs. Ensembl Cavefish
Match: slc8a1a (sodium/calcium exchanger 1 [Source:NCBI gene;Acc:103029712])

HSP 1 Score: 835.484 bits (2157), Expect = 0.000e+0
Identity = 467/926 (50.43%), Postives = 624/926 (67.39%), Query Frame = 2
Query:  425 KNGACESLNDTSCKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALE--GDHELHCNHSLE------DAH----LDGDKKENLTEL--EKTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLER-RLSQDPDKLGLKEKENN-NQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGG-TDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGK-SNIPKEFTGFNHVSEVKTHSDQLVS----------------QSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            ++G C       CK+G++LPLW P    S  DK+ARA +YFV L Y+FLGVSIIADRFMASIEVITS+E+++ ++K NGE  T  VRIWNETVSNLTLMALGSSAPEILLSV+E+CG NF+AG+LGP TIVGSAAFN+F+IIG CV VIPDG+ R++KHL VF +TA+WS+FAY WLYLI+A  SP V++VWE LLT FFF + V+ A+VAD ++   K++ +RY     +   +E  G+ EL     +E      ++H    LDG    ++ E+  E+ R +   ++++++ K+P  + + L E A  +VL++  KSRAFYR QATR +TG+GN++KK   ++ R +    +L  +  +N+ + KIFFDPG Y  +EN G+  + V R G D     + I V Y TEDGTA AG DY  + GV++F  GE +K I I IIDDDIFE DEHF ++L + + +++     S       ++ G+ L  P  AT+ + DDDHAGIF FEE    V+ES G  E+KV R+SGARG V+VPY++   TA GG  D+ +    LEF ND+    IKV I+D +EY+K   F+++L EP   ++   G      K+  G +   +V+   + + S                +   I +MG+P LGD   ++V+I+ES EFK  VD L++   L+  +GT+SW+EQFVEAITV+ G +D E+    SEEKLPSC DYVMHFLT+FWK+LFAFVPPTDY  GW  F V I +IG LTAVIGDLAS FGCT+G+ ++VTA+ FVA+GTS+PDTFASKVAAI D  AD+ +GNVTGSNAVNVFLGIG+AWSIAA+YH + G  FRV+ G+L FSVT+F IFA   IA ++ RR   +GGELGGPR  K  T+  F  LW++Y++LSSLE YC IKGF
Sbjct:   69 ESGTCS--GSYECKEGVILPLWTP-ENPSFPDKLARATIYFVGLFYMFLGVSIIADRFMASIEVITSQEKEITIKKPNGETTTTTVRIWNETVSNLTLMALGSSAPEILLSVVEVCGHNFDAGELGPNTIVGSAAFNMFVIIGLCVSVIPDGDHRKVKHLRVFFVTAAWSIFAYTWLYLILAVISPGVVEVWEGLLTLFFFPICVVFAWVADRRLLFYKYVNKRYRVGKQRGMIIETEGEPELQSKADIEMDGQMLNSHGEDFLDGAVNTDIKEMDEEEARREMARILKDLKQKHPEKEMEQLIELANYQVLSQQQKSRAFYRCQATRLMTGAGNILKKHAADQARKAICTHELRTEVSDNDFSSKIFFDPGTYQCLENCGSVALNVVRRGGD---LTSTISVSYRTEDGTANAGSDYEFSEGVIVFNPGETEKEIRIEIIDDDIFEEDEHFLVHLSNIQVLSESRNNGSPVLNHVDSLAGLGL--PSTATVTIFDDDHAGIFAFEEQMMHVSESIGIMEVKVVRTSGARGAVVVPYKTIEGTAKGGGEDFEDTHGVLEFQNDEISKTIKVKIVDHDEYDKQASFYLQLQEPEWRRRGWTGGFVKTDKQLFGRDVYRKVQGRDNPVPSTIINLAEDISLSQKEQEERRIAEMGRPTLGDNTRLEVVIEESYEFKSTVDKLIKKTNLALLVGTNSWREQFVEAITVNSGGDDDEEC---SEEKLPSCFDYVMHFLTVFWKILFAFVPPTDYWNGWACFVVSISMIGLLTAVIGDLASHFGCTVGLKDSVTAVVFVALGTSVPDTFASKVAAIQDQYADACIGNVTGSNAVNVFLGIGVAWSIAAIYHQWNGQYFRVQPGTLAFSVTLFTIFAFVCIAVLMYRRRPEIGGELGGPRTAKRITSSLFFSLWLLYIVLSSLEAYCIIKGF 983          
BLAST of slc8a-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000794.1 (pep scaffold:Pmarinus_7.0:GL477892:73629:76552:-1 gene:ENSPMAG00000000728.1 transcript:ENSPMAT00000000794.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 459.529 bits (1181), Expect = 1.628e-149
Identity = 276/557 (49.55%), Postives = 371/557 (66.61%), Query Frame = 2
Query:  461 CKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYAL--EGDHELHCNHSLEDAHL-------------DGDKKENLTELEKTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLERRLSQDPDKLGLKEKENNNQ-----KIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRA-VTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATG-GTDYIEVESYLEFMNDQ 2065
            C +GI+LP+W P +  S+GDK+ARA VYFV+L+Y+FLGVSIIADRFMASIEVITS+E+++ +++ +GE  T  VR+WNETVSNLTLMALGSSAPEILLS+IEICG  FEAGDLGP TIVGSAAFN+F+II  CVY IPDGE R+IKHL VF +TA+WS+FAYIWLYLI+A  SP V+ +WEALLTF FF + V+ A+VAD ++   K++ ++Y     +   +  EGD     N  ++   L             DG++K    +++++R D I++++E++ K P  D   L E A  + L +  KSRAFYR+QA R +TG+GN++KK   +    Q    + ++  E++ +     KI F+PG Y   EN G+  + V R G D       + V Y TE+GTATAG D+  + G ++F+ GE QK I ISIIDDDIFE DEHF++ L    A VT+DG +++   L +       L+EP +AT+ + DDDHAGIF FEE    V+ES G  E KV R+SGARG V+VPYR+   TA G G DY +    LEF ND+
Sbjct:   58 CARGIILPIWVP-NNPSVGDKVARAIVYFVALIYMFLGVSIIADRFMASIEVITSQEKEITIKRPDGETTTTTVRVWNETVSNLTLMALGSSAPEILLSIIEICGHGFEAGDLGPSTIVGSAAFNMFVIIAICVYSIPDGETRKIKHLRVFFVTAAWSIFAYIWLYLILAVISPNVVDIWEALLTFMFFPICVVFAWVADRRLLFYKYMYKKYRADKHRGIIIETEGDRP-RMNIEMDGRMLNYETDVVPDGMLVDGEEK----DIDESRRDMIKLLKELKQKYPEKDLDQLVELANYQALTQQQKSRAFYRIQAIRMMTGAGNILKKHAAD----QARKAMSVQNIESDGESDFVSKICFEPGAYQCFENCGSCILTVSRKGGD---TSGFVSVRYKTENGTATAGSDFEFSEGKIVFKPGETQKEISISIIDDDIFEEDEHFYVRLSDVEAEVTEDGPEINHVSLPK-----ALLVEPTVATVTIFDDDHAGIFMFEEKVMRVSESVGVMEAKVMRTSGARGTVVVPYRTMEGTARGSGDDYEDSFGELEFHNDE 596          
BLAST of slc8a-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006683.1 (pep scaffold:Pmarinus_7.0:GL476710:281470:285756:-1 gene:ENSPMAG00000006040.1 transcript:ENSPMAT00000006683.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 333.569 bits (854), Expect = 4.761e-106
Identity = 166/297 (55.89%), Postives = 220/297 (74.07%), Query Frame = 2
Query: 2210 NHVSEVKTHSDQLVSQSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
             H + ++  +D+   ++  I +MG+P LG+   ++VII+ES EFK  VD L++   L+  +GT+SWKEQF +AITVS    D +D ++  EEKLPSC DYVMHFLT+FWKVLFAFVPPTD   GW  F V I VIG LTA+IGDLAS FGCT+G+ ++VTA+ FVA+GTS+PDTFASKVAA+ D  AD+SVGNVTGSNAVNVFLGIG+AW+IA+V+ +     F V  G+L FSVT+F +FA   +  ++ RR   VGGELGGPR++K+ TT  F+ LW++Y++ + LE YCH+K F
Sbjct:    3 KHENGLQAETDK--EEAQRIAEMGRPILGENSRLEVIIEESYEFKSTVDKLIKKTNLALVVGTNSWKEQFKDAITVSA--GDDDDDEESGEEKLPSCFDYVMHFLTVFWKVLFAFVPPTDVWNGWACFLVSISVIGLLTAMIGDLASHFGCTVGLKDSVTAVVFVALGTSIPDTFASKVAAVQDQFADASVGNVTGSNAVNVFLGIGIAWTIASVHCWANNKKFYVDPGTLAFSVTLFTVFAFICVGVLMWRRRPSVGGELGGPRNMKLMTTGLFILLWLIYILFAGLEAYCHVKAF 295          
BLAST of slc8a-1 vs. Ensembl Sea Lamprey
Match: adgrv1 (adhesion G protein-coupled receptor V1 [Source:NCBI gene;Acc:415105])

HSP 1 Score: 72.7886 bits (177), Expect = 4.806e-13
Identity = 76/224 (33.93%), Postives = 114/224 (50.89%), Query Frame = 2
Query: 1577 IEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDG--KKVSINQLTEQNIYGVELIEPFIATIMVLDDDHA-GIFNFEEAETV-VAESCGEAEIKVCRSSGARGVVLVPYRSRSDTA-TGGTDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIEL----GEPI----LVKKPGIGKSNIPKEFTGF 2209
            + + Y T  GTAT G DY    G ++F+ GE  K + + I++D+I E  E F++N+   + ++ DG  K+   +   E    GV    PF   +++  DD A G+  F+ A  + VAE  G   + + R  G  G V+V Y SR  TA  GG DY+  +    FM+ Q  +FI V+I DD+E E +E F I+L    G  +    L+    I KS+ P    GF
Sbjct: 4312 VRLLYLTVPGTATEGRDYERLHGDLVFEEGERLKLLGLKILNDEISEGPEDFYLNITQVQLIS-DGYTKREHGSGAEEPPALGV----PFSLRVLIEKDDGAEGVIEFDSASGMSVAEEDGVLLVPLARHKGTYGSVMVLYVSRGVTAQPGGEDYLLPDGAALFMDGQNVSFINVSITDDDEREFEETFEIQLVSTTGGAVLGSRLIATITIAKSDAPNGLIGF 4530          
BLAST of slc8a-1 vs. Ensembl Sea Lamprey
Match: slc24a4b (solute carrier family 24 member 4b [Source:ZFIN;Acc:ZDB-GENE-081031-75])

HSP 1 Score: 70.4774 bits (171), Expect = 1.379e-12
Identity = 53/152 (34.87%), Postives = 76/152 (50.00%), Query Frame = 2
Query:  557 MYLFLGVSIIADRFMA-SIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEIC-GSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEA 1006
            MY+F  ++++ D F   S+E I+ + +                   +E V+  T MA GSSAPE+  SVI  C G     GD+G GTIVGSA FN+  IIG C      G++ R+   S+F      SVF  I +  +I F   E++  WE+
Sbjct:   32 MYMFYALALVCDDFFVPSLEKISERLQL------------------SEDVAGATFMAAGSSAPELFTSVIVWCEGVFVTKGDVGVGTIVGSAVFNILCIIGVCGLF--AGQIVRLTWWSLFRD----SVFYTISIIALILFICDEIVSWWES 159          

HSP 2 Score: 57.3806 bits (137), Expect = 1.374e-8
Identity = 35/112 (31.25%), Postives = 60/112 (53.57%), Query Frame = 2
Query: 2588 SFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVF 2923
            SF +  + I   + V+  + +  G T+G+ + +  ITF+A GTS+PD  AS + A      D +V N  GSN  ++ +G+GL W++  +   + GS   + S  L +SV + 
Sbjct:  382 SFVISTIWIAVFSYVMVWMVTVIGYTLGIPDVIMGITFLAAGTSVPDCMASLIVA-RQGMGDMAVSNSIGSNVFDILVGLGLPWALQTLLVDY-GSHVEINSRGLIYSVVLL 491          
BLAST of slc8a-1 vs. Ensembl Sea Lamprey
Match: slc24a1 (solute carrier family 24 member 1 [Source:ZFIN;Acc:ZDB-GENE-060503-191])

HSP 1 Score: 61.2326 bits (147), Expect = 9.020e-10
Identity = 48/162 (29.63%), Postives = 80/162 (49.38%), Query Frame = 2
Query:  539 VYFVSLMYLFLGVSIIADRF-MASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLI-----IAFFSPEVIQVWEA 1006
            ++ + ++Y+F+ ++I+ D F + ++ VIT  E+  I                ++ V+  T MA G SAPE+  S+I +  S+    ++G GTIVGSA FN+  +IG C         R I      L+   W +F  +  Y++     I FF   +IQ WE+
Sbjct:   36 LHMLGMIYMFIALAIVCDEFFVPALGVIT--EKLAI----------------SDDVAGATFMAAGGSAPELFTSLIGVFISH---SNVGIGTIVGSAVFNILFVIGMCAVF-----SREI------LVLTWWPLFRDVSFYIVGLSMLIIFFLDNLIQWWES 165          
BLAST of slc8a-1 vs. Ensembl Nematostella
Match: EDO46793 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP49])

HSP 1 Score: 775.778 bits (2002), Expect = 0.000e+0
Identity = 471/940 (50.11%), Postives = 625/940 (66.49%), Query Frame = 2
Query:  374 SCIVVIEFLSWIQCEP-LKNGACESLNDTSCKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKK-NGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFL--KRRYLRKNVKSYALEGDHEL--------------------HCNHSLEDAHLDGDKKENLTELEKTRMD-YIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIK--KSKLERRLSQDPD-KLGLKEKENNNQ---KIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDGKKVSINQLTEQNIY---GVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGG-TDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVSQSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCH 3088
            S ++++  + W+  +P L    C+ LN T CK+G++LP W      S G +I RAFVY +SL++ FLGVSII+DRFM+SIE+ITSKE+ V ++ K +G+ + + V+IWNETVSNLTLMALGSSAPEILLSVIEI G+NF+AGDLGP TIVGSAAFNLF+IIG CVYVIPD EVR+IKHL VF+ITA+ SVFAYIWLY+IIA  S  VI++WE +LTF  F   V  AY+AD ++   + L  KRR  ++   S    GD ++                    +   ++E A  D +    L +L + R D  I+V+R+I+ K PN D +T+E   + E L   PKSRAFYR++ATR + GSGN++K    KLE+  S   D KL LK+ E ++    K++F P  Y V EN G+  + + R G D       + V++ TEDGTA AGDDY  T G + F+ GE +K I + IIDDD+FE DEHF + L + R    DG  V       +N Y     ++ +   ATI++LDDD+ G+F FE+A   V E+   A +KV R++GARG V +PY +   TA GG  DY +    LEF++D+T   I + IIDD +YEK E F + LGEP +VK+     ++ P +            H +++  +   IE++GKPRLG+  +I+VII ES EF++ VD +L    L+  +GTSSW+EQF +A TV  G +D  + DD  E   P+  DY+MHFLT+FWK+LFAFVPPTD  GGW  F V I+ IG LTAVIGDLAS FGCTI + ++V AITFVA+GTSLPDTFASKVAAIND++ADSSVGNVTGSN+VNVFLGIG+AWS+AA+YH   G+ F+V  GSLGFSV VFCI A  AI  M++RR+ +VGGELGGPR +KI T+I  V LW++Y++LSSL+ YCH
Sbjct:   13 SSVLLLVLICWLIDQPVLARQDCD-LN-TECKEGVILPKWG--GDPSTGARIGRAFVYLLSLLFFFLGVSIISDRFMSSIEIITSKEKDVKIKDKVSGKERVLTVKIWNETVSNLTLMALGSSAPEILLSVIEIIGNNFKAGDLGPSTIVGSAAFNLFVIIGVCVYVIPDDEVRKIKHLRVFIITAACSVFAYIWLYIIIAVSSKGVIEIWEGILTFLMFPALVGCAYIADRRLLFYRALRGKRRKQKRGGVSVIQTGDFDVIGVRIKQDGLTPEEGAEENGYPLQTVEGAE-DLEDDYALHDLTEERKDKAIQVLRDIKAKYPNADRETVERLLEQENLRLQPKSRAFYRIEATRKMVGSGNIVKMKHDKLEKASSSVADVKLELKDLEYDDPEVVKVYFSPEEYEVKENCGSVFMTITRAGGD---VNNTVFVDFKTEDGTAKAGDDYDKTEGTICFRPGETEKTISVVIIDDDVFEEDEHFTVALSNVRIAGPDGDLV-------RNTYRGPAGKVAKGGRATIVILDDDYPGLFTFEDASMEVPEADRVARVKVTRNTGARGTVRLPYHTVEGTAKGGGQDYEDAVGELEFLDDETHKIIDIAIIDDEDYEKKETFSVILGEPYVVKE----DAHFPTD------------HDEEMDEEKKRIEELGKPRLGEFPKIEVIIIESKEFRNTVDKMLAKANLALVVGTSSWREQFKDAFTVG-GSDD--NGDDEGEPAPPTYGDYMMHFLTVFWKILFAFVPPTDIWGGWACFVVSILWIGVLTAVIGDLASHFGCTIYLADSVVAITFVALGTSLPDTFASKVAAINDETADSSVGNVTGSNSVNVFLGIGIAWSVAAIYHAVNGNEFKVDPGSLGFSVCVFCIGAAFAITLMMVRRSAKVGGELGGPRQIKIITSILLVALWVLYILLSSLQTYCH 918          
BLAST of slc8a-1 vs. Ensembl Nematostella
Match: EDO35472 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLD3])

HSP 1 Score: 421.779 bits (1083), Expect = 4.264e-133
Identity = 301/800 (37.62%), Postives = 431/800 (53.87%), Query Frame = 2
Query:  530 RAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNG-EMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSN-FEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALEGDHELHCNHSLEDAHLDGDKKENLTELEKTRMDYIEVIREIRLKN-----PNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLERRLSQDPDKLG------------LKEKENNNQK--IFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGGTDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVSQSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNL--LRHGQLSEF-IGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVY 2857
            R F+Y ++L++ F+GV+I+AD FM +IE ITSK +KV + K+N  E+  + VR+WNETV+NLTLMALGSSAPEILLS+IEI   N FEAG LGP TIVGSAAFNL  I G CV  +P  E RRIK ++VF +TA  S+ AYIWL++I++  + +V+++WEA+LTF FF + V+ AY+ D                  K+Y   G  E      L      GD      EL      ++ ++ +I +KN     P+I      +     +  + PK+  +YR+ A R + G   +  K K++ RL+   ++L             L  K++  +   I F      VMEN     + V R+G     A     V + T DGTA +G DY+A   V++F+ GE  K ++I IIDD+ +E +E FF+ L +P  +   G  V    +TE               I +++DD  G+ + ++   V+ ES G+A   V R+ G  G + V +++   +A  G DY      L F + +    I + I+DD  +EKDE F +E+ +P                                           G   LG I    V I    E+K + D +  L H  L    +G+SSW +QF +A++V+ G  D E++         + +DY+MHFLTL WKV+FA VPP  + GGWV+F V +  IG LTA++GDLA+ FGC +G+ N VTA TFVA+GTSLPD FASK AAIN+  AD+ +GNVTGSN+VNVFLG+G  W IA +Y
Sbjct:   40 RTFIYLIALLWCFMGVAIVADIFMCAIETITSKTKKVKIAKQNSSEIIEVEVRVWNETVANLTLMALGSSAPEILLSIIEITIMNGFEAGALGPSTIVGSAAFNLLCITGVCVMAVPKFETRRIKSMNVFAVTAITSLLAYIWLFIILSVNTKDVVELWEAILTFLFFPILVIIAYIMD------------------KNYCCPGRVEPEGMLEL------GDNSHG--ELFVISKIFLMILNKI-MKNEVSQIPDITEDDTAKLVAAHIKAKQPKNYGYYRVGAIRNIGGGHKL--KPKMDPRLNMIYEELSEVGFSTSGASTILHGKKDAIKPAVIEFATTKCAVMENDKLVKIGVMRSGNLNVSA----SVNFETIDGTAESGSDYVAKKDVMVFKPGETLKHLDIEIIDDNEWEENEIFFVKL-APYDMKDAGTVVGKQSITE---------------ITIINDDEPGVLSLQKPSFVIKESIGKANFLVERTGGTDGTIKVTWKTTDQSAINGKDYHGGIGELVFEHGEQMKDITIEIMDDKAFEKDECFLLEIMDP------------------------------------------TGGATLGKITRSVVTIVNDDEYKRLFDRVVALTHLNLDRLELGSSSWGQQFRDALSVNGG--DIENA---------TTMDYIMHFLTLAWKVIFAAVPPCTWAGGWVTFSVALCFIGILTAIVGDLATIFGCLVGLKNEVTAFTFVALGTSLPDLFASKAAAINEKYADACIGNVTGSNSVNVFLGLGTPWVIATIY 737          
BLAST of slc8a-1 vs. Ensembl Nematostella
Match: EDO45642 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSI7])

HSP 1 Score: 222.246 bits (565), Expect = 2.868e-60
Identity = 144/430 (33.49%), Postives = 223/430 (51.86%), Query Frame = 2
Query: 1952 SSGARGVVLVPYRSRSDTATGGTDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHI-----------ELGEPILVKKPGIGKSNIPKEFT---GFNHVSEVKTHSDQLVSQSSEIEDM---------GKPRLGDIKEIKVIIKESLEFKHVVDNLL--RHGQLSEFI----GTSSWKEQFV-----------------EAITVSPG-ENDTEDSDDLSEEKLP-SCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKG 3097
            S G+     V Y +   +A  G +Y  V+  + F     +  +++ I+   ++ K++ F++           +LGEP L +   I   ++P EF+      H + V   +   V +    +           G  + G   E++    ++ +++ V D LL   HG++S+ I     T +    FV                   + +S G     +  +D    +LP + +D++MHFLT FWKVLFAF+PP   LGGW +F V ++ I ALTAVI  L    GC + + N+VT IT +A+GTSLPDT AS+ AA+ D  AD+++GN+TG N+VNVFLG+GL W ++  YH  +G+ ++V SG+L FSV VF +     +  ++LRR     GELGGP   K  T +  + LW +YV+LSSL  Y HI G
Sbjct:  411 SPGSSQRFSVDYETHDGSAKNGKEYQTVKGTMAFRAGINKHILRIPILPCEDFSKNKDFYVLLKNPSPEGITDLGEPNLTRITII-DDDMPGEFSFEQASYHANFVTGEATCTVVRRKGCDGTVTLKYHTMNGTAKGGTKNELEA---KTCDYEQVTDGLLTFHHGEMSKHITVKINTETQDTNFVVLLHDPSTGARIGNRTATVVHISSGIAMIIQGDEDKDGNELPLNSIDFIMHFLTFFWKVLFAFIPPRPLLGGWPAFVVSLLFIAALTAVIEQLGKLLGCVVDLRNSVTGITIIAIGTSLPDTMASRSAALQDTGADAAIGNITGYNSVNVFLGLGLPWVMSTCYHAARGTVYKVSSGNLAFSVLVFALCGGVCLFLLVLRR-YLYKGELGGPTLSKWMTGLLLLFLWFIYVVLSSLMAYGHISG 835          

HSP 2 Score: 208.764 bits (530), Expect = 7.640e-56
Identity = 187/608 (30.76%), Postives = 279/608 (45.89%), Query Frame = 2
Query:  530 RAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVI-VRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEI-----CGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALEGDHELHCNHSLEDAHLDGDKKENLTELEKTRMDYIEVIREIRLKNPNIDPKTLE-EQAQIEVL--NRVPKSRAF-YRMQATRTLTGSGNVIKKSKLER------RLSQDPDKL-----GLKEKENNNQKIFFDPGHYTVMENVGTFNVMVKRT-------------GTDEQIAKTMIE-------------------VEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDGKK-----VSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGGT---------DYIEV-ESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEP 2149
            R F+Y + ++YLFLG++I+AD FM+ IEVITSK+RKV     + GE   I V +WNETV+NLTLMALGSSAPEILL+V+E       G       LG  TIVGSA+FNL +I   CV  +P+G V+RI+   VF++TA WS+FAY+W+  +I + SPEVI++WEA +T  FF L VLTA+  D   + +        R  + S        +     L D       + +L  L      ++  +++ R  N ++  KT      Q+ VL     P S A  +R    R L      ++ S  +R      R      KL     G   +++N  +  F    Y+V+++    ++ +                  ++ IA T+ E                   V+Y T DG+A  G +Y    G + F++G ++                      L+ P    +D  K     V +   + + I   +L EP +  I ++DDD  G F+FE+A        GEA   V R  G  G V + Y + + TA GGT         DY +V +  L F + +    I V I   N   +D  F + L +P
Sbjct:   37 RGFLYILGMLYLFLGIAIVADIFMSCIEVITSKKRKVTRYDHEKGESVEIEVFVWNETVANLTLMALGSSAPEILLAVVETGQELALGQTTATDGLGTFTIVGSASFNLLLITAVCVVSVPNGTVKRIREFGVFVVTAVWSMFAYVWMLFVIQWNSPEVIELWEAFMTLAFFPLLVLTAWCTDHGWWCRN-------RGKILSVDPPQVIVIIFTKGLVD-------RNSLALLR-----FVRFVKQAR--NCDVVSKTSRFSHLQVRVLGFTDAPSSHAMIHRSMELRALEQHRGSVRNSSFDRFRHAALRSVTRSKKLIKINEGEDVEDDNLNRFVFGTSSYSVLKSAKHIDLEIILLQNNNNNKNKEMIYAHNDSIADTISENSFEDGVTPSSPGSSQRFSVDYETHDGSAKNGKEYQTVKGTMAFRAGINKHI--------------------LRIPILPCEDFSKNKDFYVLLKNPSPEGI--TDLGEPNLTRITIIDDDMPGEFSFEQASYHANFVTGEATCTVVRRKGCDGTVTLKYHTMNGTAKGGTKNELEAKTCDYEQVTDGLLTFHHGEMSKHITVKI---NTETQDTNFVVLLHDP 598          
BLAST of slc8a-1 vs. Ensembl Nematostella
Match: EDO42266 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1V5])

HSP 1 Score: 73.1738 bits (178), Expect = 5.976e-13
Identity = 69/229 (30.13%), Postives = 104/229 (45.41%), Query Frame = 2
Query: 1475 IFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDGKKVSINQLTEQNIYGVELIEP-------FIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGGTDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIEL 2140
            +F  P  Y V E+VGT N+ VKR   D  I +  +   Y     +A  G DY A SGV+ F   E  K + + I+ D   E DE   + L+S R + +         L    + G++L  P        ++  ++ +D+  GI  F      V ES G   + + R+ G  G++ V Y   + TAT G DY      + F   Q+ A + V IIDD   E+ E F ++L
Sbjct: 3480 VFEPPYAYNVSEDVGTVNMTVKRNKGD--IGR--LSANYSVTSSSAMPGQDYEAMSGVLEFADKEQTKKLTLKILQDVSPELDETILVQLQSVRLLDR--------TLNYSTVQGLQLNMPPRIGDQSAVSVTLLKNDEAHGIVQFVVTSATVRESDGHVSLGLQRTGGTFGIIQVNYNVLNGTATHGEDYNVSSGVIVFKAGQSSAQLIVGIIDDVIPEQAETFSVQL 3696          

HSP 2 Score: 51.6026 bits (122), Expect = 2.275e-6
Identity = 38/116 (32.76%), Postives = 54/116 (46.55%), Query Frame = 2
Query: 1862 DDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGGTDYIEVESY------LEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIP 2191
            +DD AG+  F +    V ES G   + V RS G+ G V V Y  +  +     DY  + S+      L F++ Q E  I+V I DD   E +E         IL  KPG+G + +P
Sbjct: 2147 NDDPAGVIGFSQTRIDVNESIGAFNVTVLRSQGSLGTVTVKYFIKLTSTAIPNDY-SIPSFGGGEETLTFVDGQREQNIEVKITDDTIPEDNESI-------ILGLKPGVGAALVP 2254          
BLAST of slc8a-1 vs. Ensembl Nematostella
Match: EDO32048 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW69])

HSP 1 Score: 61.2326 bits (147), Expect = 1.518e-9
Identity = 40/106 (37.74%), Postives = 56/106 (52.83%), Query Frame = 2
Query:  545 FVSLMYLFLGVSIIAD-RFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYC 859
            F+  +Y+F  V+I+ D  F+  +E+I  +            +QT         V+  T MALGSSAPE+  SVI   G     GD+G GTI+GSA FN+  +IG C
Sbjct:   29 FIISLYMFWAVAIVCDDYFVPCLEIICDRLG----------LQT--------DVAGATFMALGSSAPELFASVI---GVFITKGDIGVGTILGSAVFNVLFVIGVC 113          

HSP 2 Score: 55.0694 bits (131), Expect = 1.089e-7
Identity = 45/144 (31.25%), Postives = 72/144 (50.00%), Query Frame = 2
Query: 2582 WV--SFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSI-AAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLL-------RRNRRVG 2983
            WV  SF +CIV IG  + V+  + +  G T  + ++V  ++ VA G+S+PD  +S   A   D  D +V +  GSN  ++ L +G+ W I   V+ +   S+  + S  L  S    C F L +IA  L+         N++VG
Sbjct:  320 WVVLSFIICIVWIGVTSYVLVWMVTVIGYTFLIPDSVMGLSLVAFGSSVPDCLSSLFVARKGD-GDMAVSHTVGSNVFDILLCLGIPWLIKTTVWEY--DSSVVINSHGLFIS----CFFILGSIAVTLIIIWYYKWTLNKKVG 456          
BLAST of slc8a-1 vs. Ensembl Medaka
Match: slc8a1a (sodium/calcium exchanger 1 [Source:NCBI gene;Acc:101162981])

HSP 1 Score: 848.966 bits (2192), Expect = 0.000e+0
Identity = 460/897 (51.28%), Postives = 608/897 (67.78%), Query Frame = 2
Query:  455 TSCKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALEGDHELHCNHSLE------------DAHLDGDKKENLTELEK--TRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLERRLSQDPDKLGLKEKENNNQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGG-TDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVSQSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            T C +G++L +WKP    +  +++ARA +YF+ L+Y+FLGVSIIADRFMASIEVITS+ERK+ ++K NGE  T  VRIWNETVSNLTLMALGSSAPEILLSV+E+CG  F+AG+LGP TIVGSAAFN+F+IIG CV VIPDGE R++KHL VF +TA WSVFAY WLYLI+A FSP V+++WE LLT FFF   V  AYVAD ++   K++ +RY     K   +E + +L     +E            D  +DG+ K  + E+++   R +   +++E++ K+P  + + L E A  +VL +  KSRAFYR QATR +TG+GNV+KK   ++      +        + + K+FFDPG Y  +EN G+  + V R G D     T I V+Y TEDGTA AG DY  T G ++F+ GE +K I + IIDDDIFE DEHF ++L + R ++        N +      G+    P  A++ + DDDHAG+F F+E    V+ES G  E+KV R++GARG V+VPY++   TA GG  D+ +    LEF ND+    I++NIIDD EYEK++ F +E+GEP+L++       +     T   H+ E +            + +MG+P LG+   ++VII+ES EFK VVD L++   L+  IGT+SW+EQFVEAITVS G+ D    D+ SE+KLPS  DYVMHFLT+FWK+LFAFVPPTDY  GW  F + IVVIG LTA IGDLAS FGCTIG+ ++VTA+ FVA+GTS+PDTFASKVAAI D  AD+S+GNVTGSNAVNVFLGIG+AWSIAA+YH+ +G  F+V  G+L FSVT+F IFA   I+ ++ RR   +GGELGGPR  KI TT  F  LW++Y+I SSLE YCH+KGF
Sbjct:   50 TECMQGVILSVWKP-DNPTFSERLARATIYFLGLIYMFLGVSIIADRFMASIEVITSQERKITIKKPNGEKITTTVRIWNETVSNLTLMALGSSAPEILLSVVEVCGHGFQAGELGPNTIVGSAAFNMFVIIGLCVSVIPDGETRKVKHLRVFFVTAFWSVFAYTWLYLILAVFSPGVVEIWEGLLTLFFFPFCVGFAYVADRRLLFYKYVYKRYRAGKRKGVIIETEGQLELPLKVEVETDNKMLNSQVDKFMDGESKVEVKEVDEDEARREVARILKELKQKHPEKEMEQLMELANYQVLTQQQKSRAFYRCQATRIMTGAGNVLKKHATDQAKRAQLNICSEVPTNSFSSKVFFDPGTYQCLENCGSVALNVVRKGGD---FTTAIAVDYWTEDGTANAGSDYKFTEGTLVFKPGETEKEIHVDIIDDDIFEEDEHFLVHLSNVRVISGGPHCQETNHVDALAGLGL----PCSASVTIFDDDHAGVFTFKEPVITVSESIGVLEVKVMRTAGARGAVVVPYKTIEGTAKGGGEDFEDTHGALEFENDEVLKTIRINIIDDEEYEKNKNFFLEMGEPLLLEMTCSVADDATDCVTAVGHIGEER-----------RVAEMGRPVLGEHVRLEVIIEESYEFKSVVDKLIKKTNLALVIGTNSWREQFVEAITVSTGDED----DECSEQKLPSGFDYVMHFLTVFWKLLFAFVPPTDYCNGWACFVISIVVIGLLTAWIGDLASHFGCTIGLKDSVTAVVFVALGTSVPDTFASKVAAIQDQYADASIGNVTGSNAVNVFLGIGVAWSIAAIYHYSQGEEFKVDPGTLAFSVTLFTIFAFICISVLIYRRRPSIGGELGGPRVPKILTTCLFFSLWLLYIIFSSLEAYCHVKGF 923          
BLAST of slc8a-1 vs. Ensembl Medaka
Match: slc8a1a (sodium/calcium exchanger 1 [Source:NCBI gene;Acc:101162981])

HSP 1 Score: 848.581 bits (2191), Expect = 0.000e+0
Identity = 459/895 (51.28%), Postives = 607/895 (67.82%), Query Frame = 2
Query:  461 CKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALEGDHELHCNHSLE------------DAHLDGDKKENLTELEK--TRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLERRLSQDPDKLGLKEKENNNQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGG-TDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVSQSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            C +G++L +WKP    +  +++ARA +YF+ L+Y+FLGVSIIADRFMASIEVITS+ERK+ ++K NGE  T  VRIWNETVSNLTLMALGSSAPEILLSV+E+CG  F+AG+LGP TIVGSAAFN+F+IIG CV VIPDGE R++KHL VF +TA WSVFAY WLYLI+A FSP V+++WE LLT FFF   V  AYVAD ++   K++ +RY     K   +E + +L     +E            D  +DG+ K  + E+++   R +   +++E++ K+P  + + L E A  +VL +  KSRAFYR QATR +TG+GNV+KK   ++      +        + + K+FFDPG Y  +EN G+  + V R G D     T I V+Y TEDGTA AG DY  T G ++F+ GE +K I + IIDDDIFE DEHF ++L + R ++        N +      G+    P  A++ + DDDHAG+F F+E    V+ES G  E+KV R++GARG V+VPY++   TA GG  D+ +    LEF ND+    I++NIIDD EYEK++ F +E+GEP+L++       +     T   H+ E +            + +MG+P LG+   ++VII+ES EFK VVD L++   L+  IGT+SW+EQFVEAITVS G+ D    D+ SE+KLPS  DYVMHFLT+FWK+LFAFVPPTDY  GW  F + IVVIG LTA IGDLAS FGCTIG+ ++VTA+ FVA+GTS+PDTFASKVAAI D  AD+S+GNVTGSNAVNVFLGIG+AWSIAA+YH+ +G  F+V  G+L FSVT+F IFA   I+ ++ RR   +GGELGGPR  KI TT  F  LW++Y+I SSLE YCH+KGF
Sbjct:   35 CMQGVILSVWKP-DNPTFSERLARATIYFLGLIYMFLGVSIIADRFMASIEVITSQERKITIKKPNGEKITTTVRIWNETVSNLTLMALGSSAPEILLSVVEVCGHGFQAGELGPNTIVGSAAFNMFVIIGLCVSVIPDGETRKVKHLRVFFVTAFWSVFAYTWLYLILAVFSPGVVEIWEGLLTLFFFPFCVGFAYVADRRLLFYKYVYKRYRAGKRKGVIIETEGQLELPLKVEVETDNKMLNSQVDKFMDGESKVEVKEVDEDEARREVARILKELKQKHPEKEMEQLMELANYQVLTQQQKSRAFYRCQATRIMTGAGNVLKKHATDQAKRAQLNICSEVPTNSFSSKVFFDPGTYQCLENCGSVALNVVRKGGD---FTTAIAVDYWTEDGTANAGSDYKFTEGTLVFKPGETEKEIHVDIIDDDIFEEDEHFLVHLSNVRVISGGPHCQETNHVDALAGLGL----PCSASVTIFDDDHAGVFTFKEPVITVSESIGVLEVKVMRTAGARGAVVVPYKTIEGTAKGGGEDFEDTHGALEFENDEVLKTIRINIIDDEEYEKNKNFFLEMGEPLLLEMTCSVADDATDCVTAVGHIGEER-----------RVAEMGRPVLGEHVRLEVIIEESYEFKSVVDKLIKKTNLALVIGTNSWREQFVEAITVSTGDED----DECSEQKLPSGFDYVMHFLTVFWKLLFAFVPPTDYCNGWACFVISIVVIGLLTAWIGDLASHFGCTIGLKDSVTAVVFVALGTSVPDTFASKVAAIQDQYADASIGNVTGSNAVNVFLGIGVAWSIAAIYHYSQGEEFKVDPGTLAFSVTLFTIFAFICISVLIYRRRPSIGGELGGPRVPKILTTCLFFSLWLLYIIFSSLEAYCHVKGF 906          
BLAST of slc8a-1 vs. Ensembl Medaka
Match: slc8a1a (sodium/calcium exchanger 1 [Source:NCBI gene;Acc:101162981])

HSP 1 Score: 848.195 bits (2190), Expect = 0.000e+0
Identity = 462/900 (51.33%), Postives = 612/900 (68.00%), Query Frame = 2
Query:  455 TSCKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALEGDHELHCNHSLE------------DAHLDGDKKENLTELEK--TRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLERRLSQDPDKLGLKEKENNNQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGG-TDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVSQSSE---IEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            T C +G++L +WKP    +  +++ARA +YF+ L+Y+FLGVSIIADRFMASIEVITS+ERK+ ++K NGE  T  VRIWNETVSNLTLMALGSSAPEILLSV+E+CG  F+AG+LGP TIVGSAAFN+F+IIG CV VIPDGE R++KHL VF +TA WSVFAY WLYLI+A FSP V+++WE LLT FFF   V  AYVAD ++   K++ +RY     K   +E + +L     +E            D  +DG+ K  + E+++   R +   +++E++ K+P  + + L E A  +VL +  KSRAFYR QATR +TG+GNV+KK   ++      +        + + K+FFDPG Y  +EN G+  + V R G D     T I V+Y TEDGTA AG DY  T G ++F+ GE +K I + IIDDDIFE DEHF ++L + R ++        N +      G+    P  A++ + DDDHAG+F F+E    V+ES G  E+KV R++GARG V+VPY++   TA GG  D+ +    LEF ND+    I++NIIDD EYEK++ F +E+GEP+L++          ++  G   +S    H+  L  +  E   + +MG+P LG+   ++VII+ES EFK VVD L++   L+  IGT+SW+EQFVEAITVS G+ D    D+ SE+KLPS  DYVMHFLT+FWK+LFAFVPPTDY  GW  F + IVVIG LTA IGDLAS FGCTIG+ ++VTA+ FVA+GTS+PDTFASKVAAI D  AD+S+GNVTGSNAVNVFLGIG+AWSIAA+YH+ +G  F+V  G+L FSVT+F IFA   I+ ++ RR   +GGELGGPR  KI TT  F  LW++Y+I SSLE YCH+KGF
Sbjct:   54 TECMQGVILSVWKP-DNPTFSERLARATIYFLGLIYMFLGVSIIADRFMASIEVITSQERKITIKKPNGEKITTTVRIWNETVSNLTLMALGSSAPEILLSVVEVCGHGFQAGELGPNTIVGSAAFNMFVIIGLCVSVIPDGETRKVKHLRVFFVTAFWSVFAYTWLYLILAVFSPGVVEIWEGLLTLFFFPFCVGFAYVADRRLLFYKYVYKRYRAGKRKGVIIETEGQLELPLKVEVETDNKMLNSQVDKFMDGESKVEVKEVDEDEARREVARILKELKQKHPEKEMEQLMELANYQVLTQQQKSRAFYRCQATRIMTGAGNVLKKHATDQAKRAQLNICSEVPTNSFSSKVFFDPGTYQCLENCGSVALNVVRKGGD---FTTAIAVDYWTEDGTANAGSDYKFTEGTLVFKPGETEKEIHVDIIDDDIFEEDEHFLVHLSNVRVISGGPHCQETNHVDALAGLGL----PCSASVTIFDDDHAGVFTFKEPVITVSESIGVLEVKVMRTAGARGAVVVPYKTIEGTAKGGGEDFEDTHGALEFENDEVLKTIRINIIDDEEYEKNKNFFLEMGEPLLLEMS-------ERKGGGITFLSFDPAHTRVLTKKEEEERRVAEMGRPVLGEHVRLEVIIEESYEFKSVVDKLIKKTNLALVIGTNSWREQFVEAITVSTGDED----DECSEQKLPSGFDYVMHFLTVFWKLLFAFVPPTDYCNGWACFVISIVVIGLLTAWIGDLASHFGCTIGLKDSVTAVVFVALGTSVPDTFASKVAAIQDQYADASIGNVTGSNAVNVFLGIGVAWSIAAIYHYSQGEEFKVDPGTLAFSVTLFTIFAFICISVLIYRRRPSIGGELGGPRVPKILTTCLFFSLWLLYIIFSSLEAYCHVKGF 934          
BLAST of slc8a-1 vs. Ensembl Medaka
Match: slc8a1a (sodium/calcium exchanger 1 [Source:NCBI gene;Acc:101162981])

HSP 1 Score: 845.114 bits (2182), Expect = 0.000e+0
Identity = 461/897 (51.39%), Postives = 608/897 (67.78%), Query Frame = 2
Query:  455 TSCKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALEGDHELHCNHSLE------------DAHLDGDKKENLTELEK--TRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLERRLSQDPDKLGLKEKENNNQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGG-TDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVSQSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            T C +G++L +WKP    +  +++ARA +YF+ L+Y+FLGVSIIADRFMASIEVITS+ERK+ ++K NGE  T  VRIWNETVSNLTLMALGSSAPEILLSV+E+CG  F+AG+LGP TIVGSAAFN+F+IIG CV VIPDGE R++KHL VF +TA WSVFAY WLYLI+A FSP V+++WE LLT FFF   V  AYVAD ++   K++ +RY     K   +E + +L     +E            D  +DG+ K  + E+++   R +   +++E++ K+P  + + L E A  +VL +  KSRAFYR QATR +TG+GNV+KK   ++      +        + + K+FFDPG Y  +EN G+  + V R G D     T I V+Y TEDGTA AG DY  T G ++F+ GE +K I + IIDDDIFE DEHF ++L + R ++        N +      G+    P  A++ + DDDHAG+F F+E    V+ES G  E+KV R++GARG V+VPY++   TA GG  D+ +    LEF ND+    I++NIIDD EYEK++ F +E+GEP+L++        I   F  F+   E +            + +MG+P LG+   ++VII+ES EFK VVD L++   L+  IGT+SW+EQFVEAITVS G+ D    D+ SE+KLPS  DYVMHFLT+FWK+LFAFVPPTDY  GW  F + IVVIG LTA IGDLAS FGCTIG+ ++VTA+ FVA+GTS+PDTFASKVAAI D  AD+S+GNVTGSNAVNVFLGIG+AWSIAA+YH+ +G  F+V  G+L FSVT+F IFA   I+ ++ RR   +GGELGGPR  KI TT  F  LW++Y+I SSLE YCH+KGF
Sbjct:   20 TECMQGVILSVWKP-DNPTFSERLARATIYFLGLIYMFLGVSIIADRFMASIEVITSQERKITIKKPNGEKITTTVRIWNETVSNLTLMALGSSAPEILLSVVEVCGHGFQAGELGPNTIVGSAAFNMFVIIGLCVSVIPDGETRKVKHLRVFFVTAFWSVFAYTWLYLILAVFSPGVVEIWEGLLTLFFFPFCVGFAYVADRRLLFYKYVYKRYRAGKRKGVIIETEGQLELPLKVEVETDNKMLNSQVDKFMDGESKVEVKEVDEDEARREVARILKELKQKHPEKEMEQLMELANYQVLTQQQKSRAFYRCQATRIMTGAGNVLKKHATDQAKRAQLNICSEVPTNSFSSKVFFDPGTYQCLENCGSVALNVVRKGGD---FTTAIAVDYWTEDGTANAGSDYKFTEGTLVFKPGETEKEIHVDIIDDDIFEEDEHFLVHLSNVRVISGGPHCQETNHVDALAGLGL----PCSASVTIFDDDHAGVFTFKEPVITVSESIGVLEVKVMRTAGARGAVVVPYKTIEGTAKGGGEDFEDTHGALEFENDEVLKTIRINIIDDEEYEKNKNFFLEMGEPLLLEMSERKGGGIT--FLSFDPEEEER-----------RVAEMGRPVLGEHVRLEVIIEESYEFKSVVDKLIKKTNLALVIGTNSWREQFVEAITVSTGDED----DECSEQKLPSGFDYVMHFLTVFWKLLFAFVPPTDYCNGWACFVISIVVIGLLTAWIGDLASHFGCTIGLKDSVTAVVFVALGTSVPDTFASKVAAIQDQYADASIGNVTGSNAVNVFLGIGVAWSIAAIYHYSQGEEFKVDPGTLAFSVTLFTIFAFICISVLIYRRRPSIGGELGGPRVPKILTTCLFFSLWLLYIIFSSLEAYCHVKGF 891          
BLAST of slc8a-1 vs. Ensembl Medaka
Match: slc8a1a (sodium/calcium exchanger 1 [Source:NCBI gene;Acc:101162981])

HSP 1 Score: 844.729 bits (2181), Expect = 0.000e+0
Identity = 458/897 (51.06%), Postives = 605/897 (67.45%), Query Frame = 2
Query:  455 TSCKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALEGDHELHCNHSLE------------DAHLDGDKKENLTELEK--TRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLERRLSQDPDKLGLKEKENNNQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGG-TDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVSQSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            T C +G++L +WKP    +  +++ARA +YF+ L+Y+FLGVSIIADRFMASIEVITS+ERK+ ++K NGE  T  VRIWNETVSNLTLMALGSSAPEILLSV+E+CG  F+AG+LGP TIVGSAAFN+F+IIG CV VIPDGE R++KHL VF +TA WSVFAY WLYLI+A FSP V+++WE LLT FFF   V  AYVAD ++   K++ +RY     K   +E + +L     +E            D  +DG+ K  + E+++   R +   +++E++ K+P  + + L E A  +VL +  KSRAFYR QATR +TG+GNV+KK   ++      +        + + K+FFDPG Y  +EN G+  + V R G D     T I V+Y TEDGTA AG DY  T G ++F+ GE +K I + IIDDDIFE DEHF ++L + R ++        N +      G+    P  A++ + DDDHAG+F F+E    V+ES G  E+KV R++GARG V+VPY++   TA GG  D+ +    LEF ND+    I++NIIDD EYEK++ F +E+GEP+L++   + K                         +   + +MG+P LG+   ++VII+ES EFK VVD L++   L+  IGT+SW+EQFVEAITVS G+ D    D+ SE+KLPS  DYVMHFLT+FWK+LFAFVPPTDY  GW  F + IVVIG LTA IGDLAS FGCTIG+ ++VTA+ FVA+GTS+PDTFASKVAAI D  AD+S+GNVTGSNAVNVFLGIG+AWSIAA+YH+ +G  F+V  G+L FSVT+F IFA   I+ ++ RR   +GGELGGPR  KI TT  F  LW++Y+I SSLE YCH+KGF
Sbjct:   50 TECMQGVILSVWKP-DNPTFSERLARATIYFLGLIYMFLGVSIIADRFMASIEVITSQERKITIKKPNGEKITTTVRIWNETVSNLTLMALGSSAPEILLSVVEVCGHGFQAGELGPNTIVGSAAFNMFVIIGLCVSVIPDGETRKVKHLRVFFVTAFWSVFAYTWLYLILAVFSPGVVEIWEGLLTLFFFPFCVGFAYVADRRLLFYKYVYKRYRAGKRKGVIIETEGQLELPLKVEVETDNKMLNSQVDKFMDGESKVEVKEVDEDEARREVARILKELKQKHPEKEMEQLMELANYQVLTQQQKSRAFYRCQATRIMTGAGNVLKKHATDQAKRAQLNICSEVPTNSFSSKVFFDPGTYQCLENCGSVALNVVRKGGD---FTTAIAVDYWTEDGTANAGSDYKFTEGTLVFKPGETEKEIHVDIIDDDIFEEDEHFLVHLSNVRVISGGPHCQETNHVDALAGLGL----PCSASVTIFDDDHAGVFTFKEPVITVSESIGVLEVKVMRTAGARGAVVVPYKTIEGTAKGGGEDFEDTHGALEFENDEVLKTIRINIIDDEEYEKNKNFFLEMGEPLLLEMKVLTKKE----------------------EEERRVAEMGRPVLGEHVRLEVIIEESYEFKSVVDKLIKKTNLALVIGTNSWREQFVEAITVSTGDED----DECSEQKLPSGFDYVMHFLTVFWKLLFAFVPPTDYCNGWACFVISIVVIGLLTAWIGDLASHFGCTIGLKDSVTAVVFVALGTSVPDTFASKVAAIQDQYADASIGNVTGSNAVNVFLGIGVAWSIAAIYHYSQGEEFKVDPGTLAFSVTLFTIFAFICISVLIYRRRPSIGGELGGPRVPKILTTCLFFSLWLLYIIFSSLEAYCHVKGF 912          
BLAST of slc8a-1 vs. Planmine SMEST
Match: SMESG000077236.1 (SMESG000077236.1)

HSP 1 Score: 1804.26 bits (4672), Expect = 0.000e+0
Identity = 916/917 (99.89%), Postives = 916/917 (99.89%), Query Frame = 2
Query:  350 MRGNLLFGSCIVVIEFLSWIQCEPLKNGACESLNDTSCKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALEGDHELHCNHSLEDAHLDGDKKENLTELEKTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLERRLSQDPDKLGLKEKENNNQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGGTDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVSQSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            MRGNLLFGSCIVVIEFLSWIQCEPLKNG CESLNDTSCKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEALLTFFFFFLTVLTAYVADTKIFIKKFLKRRYLRKNVKSYALEGDHELHCNHSLEDAHLDGDKKENLTELEKTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLERRLSQDPDKLGLKEKENNNQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPIEISIIDDDIFEADEHFFINLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGGTDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVSQSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF
Sbjct:    1 MRGNLLFGSCIVVIEFLSWIQCEPLKNGVCESLNDTSCKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEALLTFFFFFLTVLTAYVADTKIFIKKFLKRRYLRKNVKSYALEGDHELHCNHSLEDAHLDGDKKENLTELEKTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLERRLSQDPDKLGLKEKENNNQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPIEISIIDDDIFEADEHFFINLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGGTDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVSQSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 917          
BLAST of slc8a-1 vs. Planmine SMEST
Match: SMESG000076607.1 (SMESG000076607.1)

HSP 1 Score: 792.727 bits (2046), Expect = 0.000e+0
Identity = 448/901 (49.72%), Postives = 613/901 (68.04%), Query Frame = 2
Query:  437 CESLNDTSCKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALEGDHELHCNHSLE--DAHLD----------GDKKENLTELEKTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLERRLSQDPDKLGLKEKEN-NNQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGGTDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVSQSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            C++LN+T C  G++L +W+P  G+S  DK+ RA VYF+ + YLFLGVSIIADRFMA+IE+ITS+ERK  ++KKNGE   + V+IWNETVSNLTLMALGSSAPEILLS+IEI G NFEAG+LGPGTIVGSAAFNLF+IIG CV VIPD E R+ KHLSVF++T  WS+FAYIWLYLI+AF SP V++VWEA+LTF FF LTV++AY+ADTKIF K+F   + L    K+   +    L    SLE  D +L           G   E+ T L++ R++Y+ +I+++R  N N++   LE  A+IE+  R PKSRA+YR++A + LTG+ + I+K +    +++      +K  +N   Q++ F P HYTV EN     + +KR G  E I+ T+I+V+Y TEDGTA  G DY++  G + F+ G+  + I I IIDDDI+E DE+F++ LKSPR V    K    N+   Q    ++L     A +M+LDDD+ G F+FE+ +  ++E+ G  +IKV RSSGARG V +P ++ ++TA     Y      L F N+Q E  I V I D+NEY K   F +ELGEP                             S+Q+  QS    D G+P+LG+I ++++ + E+ + K ++DNL+  G++ + I TS+W+EQF EA+T+      + +SD+     +PSC  Y+ H+L+LFWK+LFAFVPP D L GW+ F+V + +IG LTA+IGD+AS FGC +G+T++VTAITFVA+GTSLPDTFASK AAINDD+AD+S+GNV GSNAVNVFLGIG+AW++A++YH   G  F V SGSLGFSVT+F I AL A++ MLLRR +++GGELGGP+  K  T ++F  +W++Y+I SSLE YCHIKGF
Sbjct:    7 CKALNNTKCVDGVLLSMWQPAIGISHTDKVIRAMVYFLYMCYLFLGVSIIADRFMAAIEIITSQERKFKIKKKNGETNIVYVKIWNETVSNLTLMALGSSAPEILLSIIEIIGKNFEAGELGPGTIVGSAAFNLFVIIGICVMVIPDNETRKTKHLSVFIVTTIWSLFAYIWLYLILAFISPGVVEVWEAVLTFLFFPLTVISAYLADTKIFFKQFFGTKVLGGFTKTDNSKNMPNLEDIPSLEQKDTNLKNQTELLADECGSSSESFT-LDQFRIEYMHLIKDLRKINSNLNLDDLEAMAEIELFKRRPKSRAYYRLKAMQYLTGTSDPIRKLRSISMINETE----IKYIDNLKVQEVTFFPDHYTVFENNKKVILTLKRVG--EGISTTVIDVDYYTEDGTAKDGSDYVSKIGTIRFEKGQLSQEIIIDIIDDDIYEEDEYFYVKLKSPRTV----KTFEENETALQ----IKLGSFSSAIVMILDDDYPGNFHFEKPKMKISENVGHIQIKVIRSSGARGQVKIPIKTIAETAINTIHYRMTTDELVFENNQIENHIDVYIYDENEYSKSILFSLELGEPT----------------------------SEQISIQS----DSGRPKLGNISKLEIEVTENPDLKKIIDNLIEKGKIEKVITTSTWREQFHEALTI----QKSNESDE-----MPSCTQYIFHYLSLFWKILFAFVPPADILNGWLCFFVSVFIIGVLTAIIGDVASAFGCHVGLTDSVTAITFVALGTSLPDTFASKCAAINDDTADASIGNVMGSNAVNVFLGIGIAWTLASIYHAVSGKKFLVDSGSLGFSVTLFTILALVAVSIMLLRRIKQIGGELGGPKPFKYITGVFFCFMWLIYLIFSSLEIYCHIKGF 851          
BLAST of slc8a-1 vs. Planmine SMEST
Match: SMESG000041861.1 (SMESG000041861.1)

HSP 1 Score: 474.552 bits (1220), Expect = 1.181e-153
Identity = 286/682 (41.94%), Postives = 418/682 (61.29%), Query Frame = 2
Query:  524 IARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKF---LKRRYLRKNVKSYALEGDHELHCNHSLEDAHLDGDKKENLTELEKTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLERRLSQDPDKLGLKEKENNNQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRSDTATGGTDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVSQSSEIEDMGKPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVP 2560
            I R+ VY ++L Y+F+GVSII+D+FMA+IE ITS+E+++ ++ K  +  TI VR+WNETVSNLTLMALGSSAPEI+LSVIE+CG NF++G LGPGTIVGSAAFNLFIIIG C+ V+PDGE+RRI+ L+VF +TA++SV AY+W+Y+I+   S  +I+VWEA+LTF  F LTV+ AY+ D +I  K      +RRY           G + +             +K + + E E+ R  Y+  ++E+R K PN   ++LE+    E+  +  KSRAFY+MQATR  TG GN++     + +     + L     +   Q+IFF+P HYT+MENVG   + VKR G       + I ++Y TE+GTA    DYI  +G ++F+  E +K IEI ++DD+IFE +EHF + L + R   ++GK        E   Y  E+ +   AT+++LDDDH G F FE     + ESC    + V R++GARG++ +PY     TA    DY+ +   + F N++    I + IID  +Y KD +F +ELG+P +++     KS  P+           +    + V   ++I   G P LG I  +++ I ES  FK VVD L++   LS+ I ++SWKEQF +A+TV  G     DS+D SE + P  + +++H++T+FWKVLFAF+P
Sbjct:    2 IIRSTVYILALAYIFIGVSIISDKFMAAIERITSQEKEINLQIKADQAITIRVRVWNETVSNLTLMALGSSAPEIMLSVIEVCGKNFQSGALGPGTIVGSAAFNLFIIIGVCIAVVPDGEIRRIQQLNVFFVTATFSVIAYVWMYMILGVISVGIIEVWEAVLTFLLFPLTVVLAYLTDKRILSKLCSGGCRRRY-----------GPNRILM-----------EKDDEILEFEQLRASYMVTLQEMRKKYPNARLQSLEKMTLTEIFEKAKKSRAFYKMQATRMFTGGGNLVHHGISKLKTVSIEECLSGSIADERLQRIFFEPCHYTIMENVGIVKIFVKRAG---GYLGSSILIDYETEEGTALPDSDYIHAAGTLIFKPYEIEKIIEIKVVDDEIFEEEEHFTVRLFNLRV--KNGK--------ENFSYIYEISKMNRATVLILDDDHCGTFGFEADIMHIEESCNILTLNVYRNTGARGIIKIPYTIMDGTAKADVDYVTLGRKVVFKNEEIFKTISIKIIDGAQYSKDNFFFVELGQPKVIE-----KSTNPE-----------RKDKRRFVRSRADIATKGLPTLGSISIVQIHIHESSSFKSVVDKLIKQNNLSKSISSTSWKEQFTDALTVYGG-----DSEDGSESE-PQLISFILHYITVFWKVLFAFIP 626          
BLAST of slc8a-1 vs. Planmine SMEST
Match: SMESG000050855.1 (SMESG000050855.1)

HSP 1 Score: 475.707 bits (1223), Expect = 8.204e-152
Identity = 285/517 (55.13%), Postives = 374/517 (72.34%), Query Frame = 2
Query:  437 CESLNDTSCKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYA-----LEGDHELHCNHSLEDAHLDGDKKENLTELEKTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKKSKLERRLSQDPDKLGLKEKENNN--QKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGAR 1966
            C   + T C  GI+LP W+P+HG S   KI++A +Y   + YLFLGVSII+DRFMA+IEVITSKE+ V V+K +G  + + VR+WNETVSNLTLMALGSSAPEILLS+IEI G NF++G+LGPGTIVGSAA+NLF+IIG CV +IPDGEV++IKHLSVF+IT  WS+FAY+WLYLI+A  S  V+++WEALLT  FF LTV TAYVADTK+F  KFLKRR++R N+K+       +EG      N+ LED ++    KEN  + EK R++Y+++I+EIRL+ PNID + LEE AQ E+L R  KSRAFYR+QATR LTGS  VI+KS +E  L +D +K+  K K+++N  Q+IFFDPGHYTV+EN+GT  V++KR+G    I  T  EVE+ ++DGTA+A +DYI   G ++F  G+ +  I ++IIDDD+FE DEHF+I LK+       G+K     L  Q I+  +L  P  ATIM+LDDDH G+F+F  +   V E+ G  EIKV RS+  R
Sbjct:   38 CFPDSKTDCADGIILPAWRPIHGNSNWFKISKATIYLFVMCYLFLGVSIISDRFMAAIEVITSKEKSVKVKKHDGTSELVKVRVWNETVSNLTLMALGSSAPEILLSIIEIIGKNFQSGELGPGTIVGSAAYNLFVIIGLCVLIIPDGEVKKIKHLSVFIITGLWSIFAYLWLYLILAKISVGVVEIWEALLTLAFFPLTVFTAYVADTKLFFNKFLKRRFIRNNIKTITQNTGDIEGSLTCTENYGLEDGNI--CDKENFGDFEKHRLEYLDIIKEIRLQQPNIDSRKLEELAQYEILKRSSKSRAFYRIQATRILTGSKFVIQKSNIESDLQKDFEKILCKSKKDDNIFQQIFFDPGHYTVLENIGTMQVLLKRSG--PLIENTFAEVEFYSKDGTASAHEDYIPVMGKLVFLPGQSEATINVTIIDDDVFEEDEHFYIELKNLIVYRVVGEK-----LKSQEIFPSQLANPSTATIMILDDDHPGVFHFGFSSITVPETIGMLEIKVYRSTAGR 545          

HSP 2 Score: 385.185 bits (988), Expect = 8.651e-118
Identity = 216/478 (45.19%), Postives = 285/478 (59.62%), Query Frame = 2
Query: 1862 DDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGA--RGVVLVPYRSRSDTATGGTDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILVKKPG-------IGKSNIPKEFT----------------GFNHVS--------EVKTHSDQLVSQSSE----IEDMG----------------------------KPRLGDIKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGENDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWVCIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVAAINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGSLGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWIVYVILSSLENYCHIKGF 3100
            DD+      F+     V E+ G  ++ + RS          V + S+  TA+   DYI V   L F+  Q+EA I V IIDD+ +E+DE+F+IEL   I+ +  G       I  S +    T                GF+ ++        E+K +      +SS     IED G                            KP++ D   I++ I+ES E KHVVD L+R   +S+ +GTSSWKEQF EA+TV  G       DD++  K P    Y+MH+L++FWK+LFA VPPT+  GGW+ FW  I++IG LTA++GD+ASGFGC +G+T++VTAITFVA+GTSLPDTFASKVAA+ D +ADSSVGNV GSNAVNV+LGIG++WSIAA YH+  GS F+V+SGSLGFSVT+FCI A  AIA ML RR   +GGELGGP+  KI T   F  +W +Y++LSSLENYCHI GF
Sbjct:  382 DDNIFQQIFFDPGHYTVLENIGTMQVLLKRSGPLIENTFAEVEFYSKDGTASAHEDYIPVMGKLVFLPGQSEATINVTIIDDDVFEEDEHFYIELKNLIVYRVVGEKLKSQEIFPSQLANPSTATIMILDDDHPGVFHFGFSSITVPETIGMLEIKVYRSTAGRKSSNPLNLIEDFGRRLSFSRRNSKSNQVNLLEVKKTSNNECKPKIKDNNTIEICIRESQELKHVVDQLMRKSHISQILGTSSWKEQFKEALTVVSG-------DDVN--KSPQAGTYLMHYLSVFWKLLFACVPPTELCGGWLCFWFSILIIGILTAIVGDVASGFGCNVGLTDSVTAITFVALGTSLPDTFASKVAALQDSTADSSVGNVMGSNAVNVYLGIGISWSIAACYHYANGSIFKVESGSLGFSVTLFCIMAFIAIAIMLYRRKPSIGGELGGPKKSKIFTAFLFFSMWFIYILLSSLENYCHIPGF 850          
BLAST of slc8a-1 vs. Planmine SMEST
Match: SMESG000041864.1 (SMESG000041864.1)

HSP 1 Score: 375.555 bits (963), Expect = 1.423e-118
Identity = 232/509 (45.58%), Postives = 325/509 (63.85%), Query Frame = 2
Query:  440 ESLNDTSCKKGIVLPLWKPVHGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVRKKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDLGPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYIWLYLIIAFFSPEVIQVWEAXXXXXXXXXXXXXAYVADTKIFIKKFLKRRYLRKNVKSYALEGDHELHCNHSLEDAHLDGDKKENLTELEKTRMDYIEVIREIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKK--SKLERRLSQDPDKLGLKEKENNNQKIFFDPGHYTVMENVGTFNVMVKRTGTDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPXXXXXXXXXXXXXXXXXXXNLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIATIMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSG 1960
            E  N++ C +G+++P+W PV  +   D + R+ +Y  +L Y+FLGVSII+DRFMASIE ITS+E+ V +  KNG+   I VR+WNETVSNLTLMALGSSAPEI+LSVIE CG +F++G LGPGTIVGSAAFNLFIII  C+ VIPDGE +RI ++ VF+IT+++S+ AY+WLYLI+   S  +I+VWEA++TF  F +TV+ AY+ D ++   KFL     RK      +E D                   E++ E E  R +Y+   +E+RLK+P  D + LE     E+  +  KSRAFY+MQATR LTG GN+ +   SKL+    ++ +   + + +   Q+IFFDP HYTVME+ G   V+VKR G       + + ++Y TEDGTA AG DYI  SG ++F++ E +K I I +IDD+++E  E F + L +   V  +G+K S+N       Y  E+ +   ATIM+LDDDH G FNFE     + ESCG   + + R++G
Sbjct:    9 ECYNNSKCVEGLIIPIWNPVE-IEFADTVIRSVIYIFALCYIFLGVSIISDRFMASIERITSEEKDVELVMKNGQKVNIKVRVWNETVSNLTLMALGSSAPEIMLSVIETCGKDFQSGSLGPGTIVGSAAFNLFIIIAICISVIPDGESKRIDNIGVFIITSTFSIVAYVWLYLILGVISQGIIEVWEAVITFLLFPITVMLAYMTDRQV-CSKFLNACLRRKGPVKIRMEYD-------------------EDIEEFEHLRENYMTTFKEMRLKHPTADVQNLELMTITEIFEKSKKSRAFYKMQATRMLTGGGNLFRNSLSKLKTNFLEESNSGSIADSK--LQRIFFDPVHYTVMEDAGQIQVIVKRAG---GFMGSTVFIDYKTEDGTALAGIDYIECSGTLVFKANESEKEISIDVIDDEVYEDQEFFTVLLFN--LVVINGQK-SLN-------YQYEVSKVNRATIMILDDDHCGTFNFETDIAHINESCGSVMVGITRTTG 481          

HSP 2 Score: 55.0694 bits (131), Expect = 2.586e-7
Identity = 29/91 (31.87%), Postives = 48/91 (52.75%), Query Frame = 2
Query: 1889 FEEAETVVAESCGEAEIKVCRSSGARG-VVLVPYRSRSDTATGGTDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEPILV 2158
            F+     V E  G+ ++ V R+ G  G  V + Y++   TA  G DYIE    L F  +++E  I +++IDD  YE  E+F + L   +++
Sbjct:  335 FDPVHYTVMEDAGQIQVIVKRAGGFMGSTVFIDYKTEDGTALAGIDYIECSGTLVFKANESEKEISIDVIDDEVYEDQEFFTVLLFNLVVI 425          
The following BLAST results are available for this feature:
BLAST of slc8a-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC8A30.000e+052.26solute carrier family 8 member A3 [Source:HGNC Sym... [more]
SLC8A30.000e+052.37solute carrier family 8 member A3 [Source:HGNC Sym... [more]
SLC8A30.000e+052.03solute carrier family 8 member A3 [Source:HGNC Sym... [more]
SLC8A10.000e+049.84solute carrier family 8 member A1 [Source:HGNC Sym... [more]
SLC8A30.000e+051.59solute carrier family 8 member A3 [Source:HGNC Sym... [more]
back to top
BLAST of slc8a-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ncx-20.000e+047.59Na/Ca eXchangers [Source:UniProtKB/TrEMBL;Acc:H2K... [more]
ncx-10.000e+045.19Na/Ca eXchangers; Sodium-calcium exchanger [Sourc... [more]
ncx-10.000e+045.19Na/Ca eXchangers; Sodium-calcium exchanger [Sourc... [more]
ncx-10.000e+044.36Na/Ca eXchangers; Sodium-calcium exchanger [Sourc... [more]
ncx-25.405e-16146.90Na/Ca eXchangers [Source:UniProtKB/TrEMBL;Acc:H2K... [more]
back to top
BLAST of slc8a-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Calx0.000e+048.45gene:FBgn0013995 transcript:FBtr0309205[more]
Calx0.000e+048.54gene:FBgn0013995 transcript:FBtr0309202[more]
Calx0.000e+048.76gene:FBgn0013995 transcript:FBtr0309204[more]
Calx0.000e+048.65gene:FBgn0013995 transcript:FBtr0309203[more]
Calx0.000e+048.54gene:FBgn0013995 transcript:FBtr0083999[more]
back to top
BLAST of slc8a-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc8a1a0.000e+052.16solute carrier family 8 member 1a [Source:ZFIN;Acc... [more]
slc8a1a0.000e+051.29solute carrier family 8 member 1a [Source:ZFIN;Acc... [more]
slc8a1a0.000e+050.91solute carrier family 8 member 1a [Source:ZFIN;Acc... [more]
slc8a1b0.000e+053.43solute carrier family 8 member 1b [Source:ZFIN;Acc... [more]
slc8a1a0.000e+051.83solute carrier family 8 member 1a [Source:ZFIN;Acc... [more]
back to top
BLAST of slc8a-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC8A30.000e+052.15solute carrier family 8 (sodium/calcium exchanger)... [more]
SLC8A30.000e+052.04solute carrier family 8 (sodium/calcium exchanger)... [more]
SLC8A20.000e+050.48solute carrier family 8 member A2 [Source:NCBI gen... [more]
SLC8A30.000e+052.04solute carrier family 8 (sodium/calcium exchanger)... [more]
SLC8A30.000e+051.93solute carrier family 8 (sodium/calcium exchanger)... [more]
back to top
BLAST of slc8a-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc8a30.000e+052.21solute carrier family 8 (sodium/calcium exchanger)... [more]
Slc8a30.000e+052.43solute carrier family 8 (sodium/calcium exchanger)... [more]
Slc8a10.000e+051.02solute carrier family 8 (sodium/calcium exchanger)... [more]
Slc8a10.000e+050.63solute carrier family 8 (sodium/calcium exchanger)... [more]
Slc8a30.000e+051.88solute carrier family 8 (sodium/calcium exchanger)... [more]
back to top
BLAST of slc8a-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P70549|NAC3_RAT0.000e+052.54Sodium/calcium exchanger 3 OS=Rattus norvegicus OX... [more]
sp|P57103|NAC3_HUMAN0.000e+052.37Sodium/calcium exchanger 3 OS=Homo sapiens OX=9606... [more]
sp|S4R2P9|NAC3_MOUSE0.000e+051.88Sodium/calcium exchanger 3 OS=Mus musculus OX=1009... [more]
sp|Q8K596|NAC2_MOUSE0.000e+050.06Sodium/calcium exchanger 2 OS=Mus musculus OX=1009... [more]
sp|P70414|NAC1_MOUSE0.000e+050.11Sodium/calcium exchanger 1 OS=Mus musculus OX=1009... [more]
back to top
BLAST of slc8a-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YEY70.000e+0100.00Slc8a-1 OS=Schmidtea mediterranea OX=79327 GN=slc8... [more]
A0A075A2200.000e+059.63Uncharacterized protein OS=Opisthorchis viverrini ... [more]
G7YEK80.000e+058.99Solute carrier family 8 OS=Clonorchis sinensis OX=... [more]
A0A4E0RE080.000e+060.24Sodium calcium exchanger OS=Fasciola hepatica OX=6... [more]
A0A087VYY90.000e+056.80Sodium calcium exchanger OS=Echinococcus multilocu... [more]
back to top
BLAST of slc8a-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc8a1a0.000e+051.20sodium/calcium exchanger 1 [Source:NCBI gene;Acc:1... [more]
slc8a1a0.000e+051.59sodium/calcium exchanger 1 [Source:NCBI gene;Acc:1... [more]
slc8a1a0.000e+050.48sodium/calcium exchanger 1 [Source:NCBI gene;Acc:1... [more]
slc8a1a0.000e+050.48sodium/calcium exchanger 1 [Source:NCBI gene;Acc:1... [more]
slc8a1a0.000e+050.43sodium/calcium exchanger 1 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of slc8a-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000794.11.628e-14949.55pep scaffold:Pmarinus_7.0:GL477892:73629:76552:-1 ... [more]
ENSPMAT00000006683.14.761e-10655.89pep scaffold:Pmarinus_7.0:GL476710:281470:285756:-... [more]
adgrv14.806e-1333.93adhesion G protein-coupled receptor V1 [Source:NCB... [more]
slc24a4b1.379e-1234.87solute carrier family 24 member 4b [Source:ZFIN;Ac... [more]
slc24a19.020e-1029.63solute carrier family 24 member 1 [Source:ZFIN;Acc... [more]
back to top
BLAST of slc8a-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc8a-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO467930.000e+050.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354724.264e-13337.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO456422.868e-6033.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO422665.976e-1330.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320481.518e-937.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc8a-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc8a1a0.000e+051.28sodium/calcium exchanger 1 [Source:NCBI gene;Acc:1... [more]
slc8a1a0.000e+051.28sodium/calcium exchanger 1 [Source:NCBI gene;Acc:1... [more]
slc8a1a0.000e+051.33sodium/calcium exchanger 1 [Source:NCBI gene;Acc:1... [more]
slc8a1a0.000e+051.39sodium/calcium exchanger 1 [Source:NCBI gene;Acc:1... [more]
slc8a1a0.000e+051.06sodium/calcium exchanger 1 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of slc8a-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000077236.10.000e+099.89SMESG000077236.1[more]
SMESG000076607.10.000e+049.72SMESG000076607.1[more]
SMESG000041861.11.181e-15341.94SMESG000041861.1[more]
SMESG000050855.18.204e-15255.13SMESG000050855.1[more]
SMESG000041864.11.423e-11845.58SMESG000041864.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30029327
GenBankAKN21455.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029327 ID=SMED30029327|Name=slc8a-1|organism=Schmidtea mediterranea sexual|type=transcript|length=3407bp
GTCACTCTCACTTTATTTGCTATCATCTATCTGGCGGGAATTGCGTGGTT
GTGTGTATGGTCAGTGGGCGCACAATAGTATTGGTCCATTTATGCATGTG
TGTTACCTACATGTATTAGCGAGTGTGTGTCTGACTATTTGTCAATTCCT
CCTATTCGATTCCACATAAAGAATTTCAGGAGTACAAGTTGAAATTTAAT
TTTATCCAGTTTTTATTAGAAATCATTTCCTGCAATCAAGGATTTTTATT
TCCATTGAACTGCTTTTATTCTAAACCATTTGACTATATTTCACCAAGGA
TTATTTTGAATGATTATTATGATTGGAAACATTTGAAAATTCATTCTAAA
TGAGAGGTAATTTATTGTTTGGATCTTGTATTGTTGTCATCGAGTTTCTA
TCATGGATTCAATGCGAACCTCTAAAAAATGGTGCATGTGAATCATTGAA
CGACACCAGCTGTAAAAAAGGAATAGTTTTGCCCCTTTGGAAACCTGTAC
ATGGACTGAGTATCGGCGATAAAATCGCGAGAGCATTTGTCTATTTTGTG
TCATTGATGTATTTGTTTTTGGGAGTTTCAATAATCGCCGATCGCTTTAT
GGCTTCCATTGAAGTGATCACGTCGAAAGAAAGAAAAGTTATTGTCAGGA
AAAAAAATGGAGAAATGCAAACGATAAATGTTAGGATTTGGAATGAAACG
GTTTCCAATTTAACTTTGATGGCGTTAGGTTCTTCGGCCCCGGAAATTCT
TTTGTCTGTTATAGAAATTTGTGGAAGCAATTTTGAAGCCGGCGATTTGG
GTCCTGGAACGATCGTTGGAAGTGCTGCTTTTAATTTGTTTATCATCATA
GGATATTGCGTTTACGTTATACCTGACGGAGAGGTTAGAAGAATAAAACA
TTTAAGCGTATTCTTAATCACTGCATCATGGAGTGTTTTTGCGTATATAT
GGCTCTATTTAATAATAGCTTTTTTCTCTCCAGAAGTAATTCAGGTATGG
GAAGCCCTTTTGACGTTTTTCTTTTTCTTTCTCACTGTTTTAACAGCTTA
TGTTGCAGATACTAAAATCTTTATTAAAAAATTCTTAAAGCGGCGATATC
TAAGAAAAAATGTCAAATCTTATGCCTTAGAAGGTGACCACGAATTGCAT
TGCAATCATAGTTTAGAAGATGCTCACTTGGATGGAGATAAAAAAGAAAA
CCTAACGGAATTAGAAAAAACAAGAATGGATTATATAGAAGTTATTAGAG
AGATACGTCTTAAAAATCCCAATATTGACCCCAAAACCTTGGAAGAACAA
GCTCAAATTGAGGTTCTAAACCGAGTTCCAAAGTCTAGAGCATTTTATCG
AATGCAAGCTACAAGAACATTGACAGGGAGTGGAAATGTCATTAAAAAGT
CTAAGCTGGAACGACGGTTGTCACAAGATCCTGATAAGCTTGGATTGAAA
GAAAAGGAAAATAATAATCAAAAAATATTTTTTGATCCCGGTCACTATAC
TGTTATGGAAAACGTTGGCACCTTTAATGTGATGGTAAAACGAACTGGTA
CAGATGAGCAAATCGCTAAAACAATGATTGAAGTAGAATATTGTACAGAA
GATGGAACTGCTACGGCTGGAGACGATTACATAGCGACAAGTGGAGTTGT
ATTATTTCAGTCTGGAGAGGATCAAAAACCCATAGAAATATCCATTATCG
ATGATGACATCTTTGAAGCAGATGAACACTTTTTTATAAATTTGAAATCT
CCAAGAGCCGTTACTCAAGATGGGAAAAAGGTCTCAATAAATCAGTTGAC
CGAGCAAAATATATATGGAGTAGAATTAATAGAACCTTTTATCGCTACCA
TTATGGTTTTGGATGATGATCATGCAGGGATTTTTAATTTCGAAGAAGCA
GAAACTGTCGTAGCAGAATCATGTGGAGAAGCAGAAATAAAAGTTTGTCG
GTCTTCCGGAGCTCGTGGGGTTGTTTTGGTTCCATATCGTTCTAGGTCAG
ACACTGCAACAGGTGGAACAGACTATATAGAGGTTGAAAGTTATCTGGAA
TTCATGAATGATCAAACAGAAGCCTTTATAAAAGTCAATATTATCGATGA
CAATGAATACGAAAAAGATGAATACTTCCATATTGAACTTGGGGAGCCGA
TTTTAGTCAAGAAACCCGGAATTGGGAAAAGTAATATTCCTAAAGAATTT
ACAGGTTTCAATCATGTTTCGGAAGTGAAAACTCATTCAGATCAATTAGT
TAGTCAATCGAGTGAAATTGAAGACATGGGAAAACCAAGATTAGGAGACA
TAAAAGAAATCAAAGTAATTATAAAAGAAAGTCTCGAGTTTAAGCATGTT
GTTGACAATCTCCTACGACATGGTCAACTATCTGAATTTATCGGCACATC
GTCATGGAAAGAACAGTTTGTTGAAGCAATTACTGTCAGTCCGGGAGAAA
ATGACACTGAAGACTCAGACGACTTATCAGAGGAAAAGTTGCCGTCATGC
CTAGACTATGTCATGCACTTTTTAACACTATTTTGGAAAGTTCTATTTGC
CTTTGTTCCACCTACCGATTACTTGGGAGGATGGGTTTCATTTTGGGTGT
GCATTGTGGTTATAGGAGCATTGACTGCTGTGATTGGTGACCTTGCTTCT
GGATTTGGTTGCACAATCGGAATGACCAATGCCGTTACAGCTATTACTTT
TGTTGCCATGGGCACAAGTTTACCAGATACATTTGCAAGCAAAGTAGCGG
CAATTAACGATGATTCTGCCGACTCATCAGTTGGAAATGTAACCGGTAGC
AATGCTGTCAATGTATTTCTTGGAATTGGCTTGGCGTGGAGCATTGCGGC
AGTCTATCACTTTTTTAAAGGGAGCACCTTTAGAGTTAAATCAGGATCTC
TTGGATTTTCTGTCACAGTATTTTGTATATTTGCTTTAACAGCGATTGCT
TTTATGCTTCTGAGACGAAATCGTAGAGTCGGCGGTGAGCTTGGAGGTCC
AAGACATTTAAAAATAGCAACTACAATTTATTTTGTTGGCCTCTGGATTG
TATATGTAATATTGAGTTCCTTAGAGAATTATTGTCATATAAAAGGATTT
TAAAGTCAAGAAACTAATTTTTATCAATAATAATAATAATAATGTTTTAA
ATAGAAATATTTTTCATTGGTACAATTTATTTGCAATGTGTTCGAAAATG
TGATACTCAAAGTAGAAGATTTCTGCCAATAATAATCATCAAATTTTGTG
CTAGTTAGTCGAAAAAAAAATTGTTGTAAATGATTTGATTGGTATTTTCC
TATTTATTCCTGATAATGTTTATTCTTTTATTATTATAATTACTGCCTTC
ATTGCTCTAAGAGAATGTTTGCCTAGCATAGTGTGATAAAAAAAAAATCT
GTTAACG
back to top

protein sequence of SMED30029327-orf-1

>SMED30029327-orf-1 ID=SMED30029327-orf-1|Name=SMED30029327-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=918bp
MRGNLLFGSCIVVIEFLSWIQCEPLKNGACESLNDTSCKKGIVLPLWKPV
HGLSIGDKIARAFVYFVSLMYLFLGVSIIADRFMASIEVITSKERKVIVR
KKNGEMQTINVRIWNETVSNLTLMALGSSAPEILLSVIEICGSNFEAGDL
GPGTIVGSAAFNLFIIIGYCVYVIPDGEVRRIKHLSVFLITASWSVFAYI
WLYLIIAFFSPEVIQVWEALLTFFFFFLTVLTAYVADTKIFIKKFLKRRY
LRKNVKSYALEGDHELHCNHSLEDAHLDGDKKENLTELEKTRMDYIEVIR
EIRLKNPNIDPKTLEEQAQIEVLNRVPKSRAFYRMQATRTLTGSGNVIKK
SKLERRLSQDPDKLGLKEKENNNQKIFFDPGHYTVMENVGTFNVMVKRTG
TDEQIAKTMIEVEYCTEDGTATAGDDYIATSGVVLFQSGEDQKPIEISII
DDDIFEADEHFFINLKSPRAVTQDGKKVSINQLTEQNIYGVELIEPFIAT
IMVLDDDHAGIFNFEEAETVVAESCGEAEIKVCRSSGARGVVLVPYRSRS
DTATGGTDYIEVESYLEFMNDQTEAFIKVNIIDDNEYEKDEYFHIELGEP
ILVKKPGIGKSNIPKEFTGFNHVSEVKTHSDQLVSQSSEIEDMGKPRLGD
IKEIKVIIKESLEFKHVVDNLLRHGQLSEFIGTSSWKEQFVEAITVSPGE
NDTEDSDDLSEEKLPSCLDYVMHFLTLFWKVLFAFVPPTDYLGGWVSFWV
CIVVIGALTAVIGDLASGFGCTIGMTNAVTAITFVAMGTSLPDTFASKVA
AINDDSADSSVGNVTGSNAVNVFLGIGLAWSIAAVYHFFKGSTFRVKSGS
LGFSVTVFCIFALTAIAFMLLRRNRRVGGELGGPRHLKIATTIYFVGLWI
VYVILSSLENYCHIKGF*
back to top
Aliases
The feature 'slc8a-1' has the following synonyms
Synonym
ncx
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR038081CalX-like_sf
IPR004836Na_Ca_Ex
IPR003644Calx_beta
IPR032452Na_Ca_Ex_C-exten
IPR004837NaCa_Exmemb
Vocabulary: biological process
TermDefinition
GO:0006816calcium ion transport
GO:0007154cell communication
GO:0055085transmembrane transport
GO:0035725sodium ion transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005432calcium:sodium antiporter activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004836Sodium/calcium exchanger proteinPRINTSPR01259NACAEXCHNGRcoord: 788..801
score: 89.85
coord: 749..761
score: 55.06
coord: 762..773
score: 82.02
coord: 775..787
score: 49.8
IPR004836Sodium/calcium exchanger proteinTIGRFAMTIGR00845TIGR00845coord: 32..917
e-value: 0.0
score: 1274.4
IPR003644Na-Ca exchanger/integrin-beta4SMARTSM00237NIbeta_1coord: 499..598
e-value: 3.2E-37
score: 139.7
coord: 363..466
e-value: 5.7E-28
score: 108.9
IPR003644Na-Ca exchanger/integrin-beta4PFAMPF03160Calx-betacoord: 369..465
e-value: 3.2E-27
score: 94.6
coord: 499..597
e-value: 6.0E-26
score: 90.5
NoneNo IPR availableGENE3DG3DSA:1.20.1420.30coord: 713..909
e-value: 9.8E-12
score: 46.6
coord: 115..244
e-value: 7.5E-11
score: 43.7
NoneNo IPR availablePANTHERPTHR11878SODIUM/CALCIUM EXCHANGERcoord: 31..917
NoneNo IPR availablePANTHERPTHR11878:SF44NA/CA-EXCHANGE PROTEIN, ISOFORM Gcoord: 31..917
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..22
score: 0.652
NoneNo IPR availableTMHMMTMhelixcoord: 765..787
NoneNo IPR availableTMHMMTMhelixcoord: 741..763
NoneNo IPR availableTMHMMTMhelixcoord: 720..737
NoneNo IPR availableTMHMMTMhelixcoord: 886..908
NoneNo IPR availableTMHMMTMhelixcoord: 187..209
NoneNo IPR availableTMHMMTMhelixcoord: 63..85
NoneNo IPR availableTMHMMTMhelixcoord: 152..174
NoneNo IPR availableTMHMMTMhelixcoord: 814..836
NoneNo IPR availableTMHMMTMhelixcoord: 213..235
NoneNo IPR availableTMHMMTMhelixcoord: 849..871
IPR038081CalX-like domain superfamilyGENE3DG3DSA:2.60.40.2030coord: 504..669
e-value: 1.7E-46
score: 159.7
IPR038081CalX-like domain superfamilyGENE3DG3DSA:2.60.40.2030coord: 365..503
e-value: 8.7E-35
score: 121.2
IPR038081CalX-like domain superfamilySUPERFAMILYSSF141072CalX-likecoord: 509..604
IPR038081CalX-like domain superfamilySUPERFAMILYSSF141072CalX-likecoord: 373..517
IPR004837Sodium/calcium exchanger membrane regionPFAMPF01699Na_Ca_excoord: 745..906
e-value: 8.8E-23
score: 80.9
coord: 65..234
e-value: 1.3E-29
score: 103.1
IPR032452Sodium/calcium exchanger domain, C-terminal extensionPFAMPF16494Na_Ca_ex_Ccoord: 239..353
e-value: 3.7E-25
score: 88.8