Endonuclease III homolog

Overview
NameEndonuclease III homolog
Smed IDSMED30029304
Length (bp)856
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Endonuclease III homolog (SMED30029304) t-SNE clustered cells

Violin plots show distribution of expression levels for Endonuclease III homolog (SMED30029304) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Endonuclease III homolog (SMED30029304) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Endonuclease III homolog (SMED30029304) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029304

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30029304SMESG000036384.1 SmedASXL_012653SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30029304SMESG000036384.1 dd_Smed_v4_9966_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30029304SMESG000036384.1 dd_Smed_v4_9966_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029304SMESG000036384.1 SMED_32068_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30029304SMESG000036384.1 SMED_32068_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Endonuclease III homolog vs. Ensembl Human
Match: NTHL1 (nth like DNA glycosylase 1 [Source:HGNC Symbol;Acc:HGNC:8028])

HSP 1 Score: 277.33 bits (708), Expect = 1.653e-92
Identity = 124/221 (56.11%), Postives = 161/221 (72.85%), Query Frame = 2
Query:  155 MWIPRNWQQQWNNLLKMRESYNAPVDTMGCERIADQNEEPKTFRYQVLLSLMLSSQTKDEITSAAMTKLKNYGCNVDNILQMKITELEKLIYPVGFYKTKAKYIMKTTQTLKDDYDGDVPSNVEELCQLPGVGPKMAHLVMKCAWNKVTGIAVDSHVHKICNRLGWTRKTTKTPIETQREIEKWIPRELWSEVNYVMVGFGQQLCLTNKPKCGTCLNKSTC 817
            +W P++WQQQ  N+  MR   +APVD +G E   D +  PK  RYQVLLSLMLSSQTKD++T+ AM +L+  G  VD+ILQ     L KLIYPVGF+++K KYI +T+  L+  Y GD+P++V EL  LPGVGPKMAHL M  AW  V+GIAVD+HVH+I NRL WT+K TK+P ET+  +E+W+PRELW E+N ++VGFGQQ CL   P+C  CLN++ C
Sbjct:   78 VWEPQDWQQQLVNIRAMRNKKDAPVDHLGTEHCYDSSAPPKVRRYQVLLSLMLSSQTKDQVTAGAMQRLRARGLTVDSILQTDDATLGKLIYPVGFWRSKVKYIKQTSAILQQHYGGDIPASVAELVALPGVGPKMAHLAMAVAWGTVSGIAVDTHVHRIANRLRWTKKATKSPEETRAALEEWLPRELWHEINGLLVGFGQQTCLPVHPRCHACLNQALC 298          
BLAST of Endonuclease III homolog vs. Ensembl Human
Match: NTHL1 (nth like DNA glycosylase 1 [Source:HGNC Symbol;Acc:HGNC:8028])

HSP 1 Score: 277.33 bits (708), Expect = 2.690e-92
Identity = 124/221 (56.11%), Postives = 161/221 (72.85%), Query Frame = 2
Query:  155 MWIPRNWQQQWNNLLKMRESYNAPVDTMGCERIADQNEEPKTFRYQVLLSLMLSSQTKDEITSAAMTKLKNYGCNVDNILQMKITELEKLIYPVGFYKTKAKYIMKTTQTLKDDYDGDVPSNVEELCQLPGVGPKMAHLVMKCAWNKVTGIAVDSHVHKICNRLGWTRKTTKTPIETQREIEKWIPRELWSEVNYVMVGFGQQLCLTNKPKCGTCLNKSTC 817
            +W P++WQQQ  N+  MR   +APVD +G E   D +  PK  RYQVLLSLMLSSQTKD++T+ AM +L+  G  VD+ILQ     L KLIYPVGF+++K KYI +T+  L+  Y GD+P++V EL  LPGVGPKMAHL M  AW  V+GIAVD+HVH+I NRL WT+K TK+P ET+  +E+W+PRELW E+N ++VGFGQQ CL   P+C  CLN++ C
Sbjct:   86 VWEPQDWQQQLVNIRAMRNKKDAPVDHLGTEHCYDSSAPPKVRRYQVLLSLMLSSQTKDQVTAGAMQRLRARGLTVDSILQTDDATLGKLIYPVGFWRSKVKYIKQTSAILQQHYGGDIPASVAELVALPGVGPKMAHLAMAVAWGTVSGIAVDTHVHRIANRLRWTKKATKSPEETRAALEEWLPRELWHEINGLLVGFGQQTCLPVHPRCHACLNQALC 306          
BLAST of Endonuclease III homolog vs. Ensembl Human
Match: NTHL1 (nth like DNA glycosylase 1 [Source:HGNC Symbol;Acc:HGNC:8028])

HSP 1 Score: 253.447 bits (646), Expect = 2.078e-84
Identity = 115/201 (57.21%), Postives = 148/201 (73.63%), Query Frame = 2
Query:  218 NAPVDTMGCERIADQNEEPKTFRYQVLLSLMLSSQTKDEITSAAMTKLKNYGCNVDNILQMKITELEKLIYPVGFYKTKAKYIMKTTQTLKDDYDGDVPSNVEELCQLPGVGPKMAHLVMKCAWNKVTGI-AVDSHVHKICNRLGWTRKTTKTPIETQREIEKWIPRELWSEVNYVMVGFGQQLCLTNKPKCGTCLNKSTC 817
            +APVD +G E   D +  PK  RYQVLLSLMLSSQTKD++T+ AM +L+  G  VD+ILQ     L KLIYPVGF+++K KYI +T+  L+  Y GD+P++V EL  LPGVGPKMAHL M  AW  V+GI AVD+HVH+I NRL WT+K TK+P ET+  +E+W+PRELW E+N ++VGFGQQ CL   P+C  CLN++ C
Sbjct:    2 DAPVDHLGTEHCYDSSAPPKVRRYQVLLSLMLSSQTKDQVTAGAMQRLRARGLTVDSILQTDDATLGKLIYPVGFWRSKVKYIKQTSAILQQHYGGDIPASVAELVALPGVGPKMAHLAMAVAWGTVSGIAAVDTHVHRIANRLRWTKKATKSPEETRAALEEWLPRELWHEINGLLVGFGQQTCLPVHPRCHACLNQALC 202          
BLAST of Endonuclease III homolog vs. Ensembl Human
Match: NTHL1 (nth like DNA glycosylase 1 [Source:HGNC Symbol;Acc:HGNC:8028])

HSP 1 Score: 181.8 bits (460), Expect = 3.439e-56
Identity = 84/153 (54.90%), Postives = 107/153 (69.93%), Query Frame = 2
Query:  155 MWIPRNWQQQWNNLLKMRESYNAPVDTMGCERIADQNEEPKTFRYQVLLSLMLSSQTKDEITSAAMTKLKNYGCNVDNILQMKITELEKLIYPVGFYKTKAKYIMKTTQTLKDDYDGDVPSNVEELCQLPGVGPKMAHLVMKCAWNKVTGIAV 613
            +W P++WQQQ  N+  MR   +APVD +G E   D +  PK  RYQVLLSLMLSSQTKD++T+ AM +L+  G  VD+ILQ     L KLIYPVGF+++K KYI +T+  L+  Y GD+P++V EL  LPGVGPKMAHL M  AW  V+GI V
Sbjct:   52 VWEPQDWQQQLVNIRAMRNKKDAPVDHLGTEHCYDSSAPPKVRRYQVLLSLMLSSQTKDQVTAGAMQRLRARGLTVDSILQTDDATLGKLIYPVGFWRSKVKYIKQTSAILQQHYGGDIPASVAELVALPGVGPKMAHLAMAVAWGTVSGIGV 204          
BLAST of Endonuclease III homolog vs. Ensembl Human
Match: NTHL1 (nth like DNA glycosylase 1 [Source:HGNC Symbol;Acc:HGNC:8028])

HSP 1 Score: 168.703 bits (426), Expect = 5.490e-51
Identity = 72/124 (58.06%), Postives = 94/124 (75.81%), Query Frame = 2
Query:  446 KTKAKYIMKTTQTLKDDYDGDVPSNVEELCQLPGVGPKMAHLVMKCAWNKVTGIAVDSHVHKICNRLGWTRKTTKTPIETQREIEKWIPRELWSEVNYVMVGFGQQLCLTNKPKCGTCLNKSTC 817
            K+K KYI +T+  L+  Y GD+P++V EL  LPGVGPKMAHL M  AW  V+GIAVD+HVH+I NRL WT+K TK+P ET+  +E+W+PRELW E+N ++VGFGQQ CL   P+C  CLN++ C
Sbjct:  103 KSKVKYIKQTSAILQQHYGGDIPASVAELVALPGVGPKMAHLAMAVAWGTVSGIAVDTHVHRIANRLRWTKKATKSPEETRAALEEWLPRELWHEINGLLVGFGQQTCLPVHPRCHACLNQALC 226          
BLAST of Endonuclease III homolog vs. Ensembl Celegans
Match: nth-1 (Endonuclease III homolog [Source:UniProtKB/Swiss-Prot;Acc:P54137])

HSP 1 Score: 250.751 bits (639), Expect = 1.174e-82
Identity = 111/215 (51.63%), Postives = 157/215 (73.02%), Query Frame = 2
Query:  173 WQQQWNNLLKMRESYNAPVDTMGCERIADQNEEPKTFRYQVLLSLMLSSQTKDEITSAAMTKLKNYGCNVDNILQMKITELEKLIYPVGFYKTKAKYIMKTTQTLKDDYDGDVPSNVEELCQLPGVGPKMAHLVMKCAWNKVTGIAVDSHVHKICNRLGWTRKTTKTPIETQREIEKWIPRELWSEVNYVMVGFGQQLCLTNKPKCGTCLNKSTC 817
            W++    + KMR+   APVDTMGC ++AD    P   R+QVL++LMLSSQT+DE+ +AAM +LK++G ++  IL+ K+ +LE ++ PVGFYK KA Y+ KT + LKDD+ GD+P +++ LC LPGVGPKMA+LVM+ AW +  GIAVD+HVH+I NRLGW +  T TP +TQ+ +E  +P+  W  +N+++VGFGQ  C   +PKCGTCL + TC
Sbjct:   25 WRRDVELIRKMRKDMIAPVDTMGCHKLADPLAAPPVHRFQVLVALMLSSQTRDEVNAAAMKRLKDHGLSIGKILEFKVPDLETILCPVGFYKRKAVYLQKTAKILKDDFSGDIPDSLDGLCALPGVGPKMANLVMQIAWGECVGIAVDTHVHRISNRLGWIK--TSTPEKTQKALEILLPKSEWQPINHLLVGFGQMQCQPVRPKCGTCLCRFTC 237          
BLAST of Endonuclease III homolog vs. Ensembl Celegans
Match: nth-1 (Endonuclease III homolog [Source:UniProtKB/Swiss-Prot;Acc:P54137])

HSP 1 Score: 250.751 bits (639), Expect = 1.174e-82
Identity = 111/215 (51.63%), Postives = 157/215 (73.02%), Query Frame = 2
Query:  173 WQQQWNNLLKMRESYNAPVDTMGCERIADQNEEPKTFRYQVLLSLMLSSQTKDEITSAAMTKLKNYGCNVDNILQMKITELEKLIYPVGFYKTKAKYIMKTTQTLKDDYDGDVPSNVEELCQLPGVGPKMAHLVMKCAWNKVTGIAVDSHVHKICNRLGWTRKTTKTPIETQREIEKWIPRELWSEVNYVMVGFGQQLCLTNKPKCGTCLNKSTC 817
            W++    + KMR+   APVDTMGC ++AD    P   R+QVL++LMLSSQT+DE+ +AAM +LK++G ++  IL+ K+ +LE ++ PVGFYK KA Y+ KT + LKDD+ GD+P +++ LC LPGVGPKMA+LVM+ AW +  GIAVD+HVH+I NRLGW +  T TP +TQ+ +E  +P+  W  +N+++VGFGQ  C   +PKCGTCL + TC
Sbjct:   25 WRRDVELIRKMRKDMIAPVDTMGCHKLADPLAAPPVHRFQVLVALMLSSQTRDEVNAAAMKRLKDHGLSIGKILEFKVPDLETILCPVGFYKRKAVYLQKTAKILKDDFSGDIPDSLDGLCALPGVGPKMANLVMQIAWGECVGIAVDTHVHRISNRLGWIK--TSTPEKTQKALEILLPKSEWQPINHLLVGFGQMQCQPVRPKCGTCLCRFTC 237          
BLAST of Endonuclease III homolog vs. Ensembl Celegans
Match: nth-1 (Endonuclease III homolog [Source:UniProtKB/Swiss-Prot;Acc:P54137])

HSP 1 Score: 251.136 bits (640), Expect = 1.180e-82
Identity = 111/215 (51.63%), Postives = 157/215 (73.02%), Query Frame = 2
Query:  173 WQQQWNNLLKMRESYNAPVDTMGCERIADQNEEPKTFRYQVLLSLMLSSQTKDEITSAAMTKLKNYGCNVDNILQMKITELEKLIYPVGFYKTKAKYIMKTTQTLKDDYDGDVPSNVEELCQLPGVGPKMAHLVMKCAWNKVTGIAVDSHVHKICNRLGWTRKTTKTPIETQREIEKWIPRELWSEVNYVMVGFGQQLCLTNKPKCGTCLNKSTC 817
            W++    + KMR+   APVDTMGC ++AD    P   R+QVL++LMLSSQT+DE+ +AAM +LK++G ++  IL+ K+ +LE ++ PVGFYK KA Y+ KT + LKDD+ GD+P +++ LC LPGVGPKMA+LVM+ AW +  GIAVD+HVH+I NRLGW +  T TP +TQ+ +E  +P+  W  +N+++VGFGQ  C   +PKCGTCL + TC
Sbjct:   30 WRRDVELIRKMRKDMIAPVDTMGCHKLADPLAAPPVHRFQVLVALMLSSQTRDEVNAAAMKRLKDHGLSIGKILEFKVPDLETILCPVGFYKRKAVYLQKTAKILKDDFSGDIPDSLDGLCALPGVGPKMANLVMQIAWGECVGIAVDTHVHRISNRLGWIK--TSTPEKTQKALEILLPKSEWQPINHLLVGFGQMQCQPVRPKCGTCLCRFTC 242          
BLAST of Endonuclease III homolog vs. Ensembl Celegans
Match: nth-1 (Endonuclease III homolog [Source:UniProtKB/Swiss-Prot;Acc:P54137])

HSP 1 Score: 207.608 bits (527), Expect = 1.354e-66
Identity = 91/170 (53.53%), Postives = 128/170 (75.29%), Query Frame = 2
Query:  308 MLSSQTKDEITSAAMTKLKNYGCNVDNILQMKITELEKLIYPVGFYKTKAKYIMKTTQTLKDDYDGDVPSNVEELCQLPGVGPKMAHLVMKCAWNKVTGIAVDSHVHKICNRLGWTRKTTKTPIETQREIEKWIPRELWSEVNYVMVGFGQQLCLTNKPKCGTCLNKSTC 817
            MLSSQT+DE+ +AAM +LK++G ++  IL+ K+ +LE ++ PVGFYK KA Y+ KT + LKDD+ GD+P +++ LC LPGVGPKMA+LVM+ AW +  GIAVD+HVH+I NRLGW +  T TP +TQ+ +E  +P+  W  +N+++VGFGQ  C   +PKCGTCL + TC
Sbjct:    1 MLSSQTRDEVNAAAMKRLKDHGLSIGKILEFKVPDLETILCPVGFYKRKAVYLQKTAKILKDDFSGDIPDSLDGLCALPGVGPKMANLVMQIAWGECVGIAVDTHVHRISNRLGWIK--TSTPEKTQKALEILLPKSEWQPINHLLVGFGQMQCQPVRPKCGTCLCRFTC 168          
BLAST of Endonuclease III homolog vs. Ensembl Celegans
Match: nth-1 (Endonuclease III homolog [Source:UniProtKB/Swiss-Prot;Acc:P54137])

HSP 1 Score: 101.293 bits (251), Expect = 1.584e-26
Identity = 45/86 (52.33%), Postives = 62/86 (72.09%), Query Frame = 2
Query:  560 MAHLVMKCAWNKVTGIAVDSHVHKICNRLGWTRKTTKTPIETQREIEKWIPRELWSEVNYVMVGFGQQLCLTNKPKCGTCLNKSTC 817
            MA+LVM+ AW +  GIAVD+HVH+I NRLGW +  T TP +TQ+ +E  +P+  W  +N+++VGFGQ  C   +PKCGTCL + TC
Sbjct:    1 MANLVMQIAWGECVGIAVDTHVHRISNRLGWIK--TSTPEKTQKALEILLPKSEWQPINHLLVGFGQMQCQPVRPKCGTCLCRFTC 84          
BLAST of Endonuclease III homolog vs. Ensembl Fly
Match: CG9272 (gene:FBgn0032907 transcript:FBtr0089944)

HSP 1 Score: 256.914 bits (655), Expect = 9.780e-84
Identity = 118/215 (54.88%), Postives = 148/215 (68.84%), Query Frame = 2
Query:  173 WQQQWNNLLKMRESYNAPVDTMGCERIADQNEEPKTFRYQVLLSLMLSSQTKDEITSAAMTKLKNYGCNVDNILQMKITELEKLIYPVGFYKTKAKYIMKTTQTLKDDYDGDVPSNVEELCQLPGVGPKMAHLVMKCAWNKVTGIAVDSHVHKICNRLGWTRKTTKTPIETQREIEKWIPRELWSEVNYVMVGFGQQLCLTNKPKCGTCLNKSTC 817
            W     N+  MR S  APVDTMGC R AD   + KT R+Q L++LMLSSQTKD+ T  AM +LK+ G     + +M +TELE L++PV FYK KAKY+ +T + L D Y  D+P NV++L  LPGVGPKMAH+ M  AWNK+TGI VD HVH++ NRLGW  K TK P +T+  +EKW+P  LWSEVN++ VGFGQ +C   KP CG CLNK  C
Sbjct:  159 WFNHLENIRIMRNSRTAPVDTMGCHRCADLKADSKTQRFQNLVALMLSSQTKDQTTYEAMNRLKDRGLTPLKVKEMPVTELENLLHPVSFYKNKAKYLKQTVEILTDKYGSDIPDNVKDLVALPGVGPKMAHICMAVAWNKITGIGVDVHVHRLSNRLGWVPKPTKEPEQTRVALEKWLPFSLWSEVNHLFVGFGQTICTPVKPNCGECLNKDIC 373          
BLAST of Endonuclease III homolog vs. Ensembl Zebrafish
Match: nthl1 (nth-like DNA glycosylase 1 [Source:ZFIN;Acc:ZDB-GENE-120511-4])

HSP 1 Score: 282.722 bits (722), Expect = 3.642e-93
Identity = 129/248 (52.02%), Postives = 176/248 (70.97%), Query Frame = 2
Query:   77 PETVPTTVSKYKRKHIVIE-EAENTANMWIPRNWQQQWNNLLKMRESYNAPVDTMGCERIADQNEEPKTFRYQVLLSLMLSSQTKDEITSAAMTKLKNYGCNVDNILQMKITELEKLIYPVGFYKTKAKYIMKTTQTLKDDYDGDVPSNVEELCQLPGVGPKMAHLVMKCAWNKVTGIAVDSHVHKICNRLGWTRKTTKTPIETQREIEKWIPRELWSEVNYVMVGFGQQLCLTNKPKCGTCLNKSTC 817
            P+    +  K  R H+ +E E E       P +W+ Q + + +MR   +APVD MG E+  D    P+  RYQVL+SLMLSSQTKD++T+ AM +L+ +G +VD IL+M    L KLIYPVGF++TK KYI + T  ++ ++ GD+P+ VE L +LPGVGPKMAHL M  AWN+V+GI VD+HVH+I NRLGWT+K TKTP ET+R +E+W+PR+LWSE+N+++VGFGQQ+CL   P C  CLN+ TC
Sbjct:   97 PDQALLSPRKRGRGHLKVEYETEGVGLKREPYDWRTQLSFIREMRSKRDAPVDQMGAEKCYDTQGLPEVRRYQVLISLMLSSQTKDQVTAGAMQRLREHGLSVDGILKMDDETLGKLIYPVGFWRTKVKYIKQATALIQQEFGGDIPNTVEGLIRLPGVGPKMAHLAMDIAWNQVSGIGVDTHVHRISNRLGWTKKETKTPEETRRALEEWLPRDLWSEINWLLVGFGQQVCLPVGPLCSVCLNQHTC 344          
BLAST of Endonuclease III homolog vs. Ensembl Zebrafish
Match: CT025742.1 (mutY DNA glycosylase [Source:NCBI gene;Acc:558403])

HSP 1 Score: 52.7582 bits (125), Expect = 2.354e-7
Identity = 37/150 (24.67%), Postives = 69/150 (46.00%), Query Frame = 2
Query:  380 VDNILQMKITELEKLIYPVGFYKTKAKYIMKTTQTLKDDYDGDVPSNVEELC-QLPGVGPKMAHLVMKCAWNKVTGIAVDSHVHKICNRLGWTRKTTKTPIETQ---REIEKWIPRELWSEVNYVMVGFGQQLCLTNKPKCGTCLNKSTC 817
            V+ +    + E+ ++   +G+Y ++ + + +  Q +  + DG +P     L  QLPGVG   A  +   A  +VTG AVD +V ++  R+      + +P  T    R  +  +  E   + N  M+  G ++C    P C  C  ++ C
Sbjct:  122 VEKLAAATLEEVNQMWSGLGYY-SRGRRLHEGAQKVVSELDGQMPKTTAGLLKQLPGVGRYTAGAIGSIALGQVTG-AVDGNVIRVLCRVRAIGADSSSPAVTDALWRIADALVDPERPGDFNQAMMELGARVCTPKSPVCSQCPIQTHC 269          
BLAST of Endonuclease III homolog vs. Ensembl Xenopus
Match: nthl1 (nth-like DNA glycosylase 1 [Source:NCBI gene;Acc:733472])

HSP 1 Score: 288.886 bits (738), Expect = 4.246e-97
Identity = 132/249 (53.01%), Postives = 174/249 (69.88%), Query Frame = 2
Query:   89 PTTVSKYKRKHIVIEEAENTANM------WIPRNWQQQWNNLLKMRESYNAPVDTMGCERIADQNEEPKTFRYQVLLSLMLSSQTKDEITSAAMTKLKNYGCNVDNILQMKITELEKLIYPVGFYKTKAKYIMKTTQTLKDDYDGDVPSNVEELCQLPGVGPKMAHLVMKCAWNKVTGIAVDSHVHKICNRLGWTRKTTKTPIETQREIEKWIPRELWSEVNYVMVGFGQQLCLTNKPKCGTCLNKSTC 817
            P++  +  ++ + +E  +  +        W P+NW Q   N+ +MR   +APVD MG E+  DQN  P+  RYQ+LLSLMLSSQTKD++TSAAM +L+ +G  V  IL+     L KLIYPVGF+K K KYI +TT+ L++ Y GD+P NV +L +LPGVGPKMAHLVM  AWN V+GI VD+HVH+I NRL W RK TKTP ET+  +E W+PRELWSE+N+++VGFGQQ+CL   P+C  CLNK  C
Sbjct:   43 PSSPKERSKRRVSVEYEQAASETVAKRPKWQPKNWAQHLENIRQMRSRRDAPVDQMGAEKCYDQNAAPEVMRYQILLSLMLSSQTKDQVTSAAMCRLRQHGLTVSRILETDDGTLGKLIYPVGFWKNKVKYIKQTTEILQEKYGGDIPDNVTDLVKLPGVGPKMAHLVMDIAWNNVSGIGVDTHVHRISNRLKWVRKETKTPEETRVAMEDWMPRELWSEINWLLVGFGQQVCLPVSPRCSECLNKDIC 291          
BLAST of Endonuclease III homolog vs. Ensembl Xenopus
Match: nthl1 (nth-like DNA glycosylase 1 [Source:NCBI gene;Acc:733472])

HSP 1 Score: 248.825 bits (634), Expect = 1.098e-81
Identity = 114/191 (59.69%), Postives = 141/191 (73.82%), Query Frame = 2
Query:  158 WIPRNWQQQWNNLLKMRESYNAPVDTMGCERIADQNEEPKTFRYQVLLSLMLSSQTKDEITSAAMTKLKNYGCNVDNILQMKITELEKLIYPVGFYKTKAKYIMKTTQTLKDDYDGDVPSNVEELCQLPGVGPKMAHLVMKCAWNKVTGIAVDSHVHKICNRLGWTRKTTKTPIETQREIEKWIPRELWSE 730
            W P+NW Q   N+ +MR   +APVD MG E+  DQN  P+  RYQ+LLSLMLSSQTKD++TSAAM +L+ +G  V  IL+     L KLIYPVGF+K K KYI +TT+ L++ Y GD+P NV +L +LPGVGPKMAHLVM  AWN V+GI VD+HVH+I NRL W RK TKTP ET+  +E W+PRELWSE
Sbjct:   72 WQPKNWAQHLENIRQMRSRRDAPVDQMGAEKCYDQNAAPEVMRYQILLSLMLSSQTKDQVTSAAMCRLRQHGLTVSRILETDDGTLGKLIYPVGFWKNKVKYIKQTTEILQEKYGGDIPDNVTDLVKLPGVGPKMAHLVMDIAWNNVSGIGVDTHVHRISNRLKWVRKETKTPEETRVAMEDWMPRELWSE 262          
BLAST of Endonuclease III homolog vs. Ensembl Xenopus
Match: nthl1 (nth-like DNA glycosylase 1 [Source:NCBI gene;Acc:733472])

HSP 1 Score: 232.646 bits (592), Expect = 1.771e-75
Identity = 116/249 (46.59%), Postives = 159/249 (63.86%), Query Frame = 2
Query:   89 PTTVSKYKRKHIVIEEAENTANM------WIPRNWQQQWNNLLKMRESYNAPVDTMGCERIADQNEEPKTFRYQVLLSLMLSSQTKDEITSAAMTKLKNYGCNVDNILQMKITELEKLIYPVGFYKTKAKYIMKTTQTLKDDYDGDVPSNVEELCQLPGVGPKMAHLVMKCAWNKVTGIAVDSHVHKICNRLGWTRKTTKTPIETQREIEKWIPRELWSEVNYVMVGFGQQLCLTNKPKCGTCLNKSTC 817
            P++  +  ++ + +E  +  +        W P+NW Q   N+ +MR   +APVD MG E+  DQN  P+  RYQ+LLSLMLSSQTKD++TSAAM +L+ +G  V  IL+     L KLIYPVGF+K K KYI +TT+ L++ Y GD+P NV +L +LPGVGPKMAHLVM  AWN V+GI         CN +      ++TPI +   I+  +  ELWSE+N+++VGFGQQ+CL   P+C  CLNK  C
Sbjct:   22 PSSPKERSKRRVSVEYEQAASETVAKRPKWQPKNWAQHLENIRQMRSRRDAPVDQMGAEKCYDQNAAPEVMRYQILLSLMLSSQTKDQVTSAAMCRLRQHGLTVSRILETDDGTLGKLIYPVGFWKNKVKYIKQTTEILQEKYGGDIPDNVTDLVKLPGVGPKMAHLVMDIAWNNVSGIG-----KYQCNCMKGYLPGSQTPITS--AIKLPVTLELWSEINWLLVGFGQQVCLPVSPRCSECLNKDIC 263          
BLAST of Endonuclease III homolog vs. Ensembl Xenopus
Match: hsd17b4 (hydroxysteroid (17-beta) dehydrogenase 4 [Source:Xenbase;Acc:XB-GENE-1010432])

HSP 1 Score: 201.83 bits (512), Expect = 2.394e-63
Identity = 111/245 (45.31%), Postives = 144/245 (58.78%), Query Frame = 2
Query:  104 KYKRKHIVIEEAENTAN-------MWIPRNWQQQWNNLLKMRESYNAPVDTMGCERIADQNEEPKTFRYQVLLSLMLSSQTKDEITSAAMTKLKNYGCNVDNILQMKITELEKLIYPVGFYKTKAKYIMKTTQTLKDDYDGDVPSNVEELCQLPGVGPKMAHLVMKCAWNKVTGIAVDSHVHKICNRLGWTRKTTKTPIETQREIEKWIPRELWSEVNYVMVGFGQQLCLTNKPKCGTCLNKSTC 817
            + KRK  V  E E  A+        W P+NW Q   N+ +MR   +APVD MG E+  DQN  P+  RYQ+LLSLMLSSQTKD++TSAAM +L+ +G  V  IL+     L KLIYPVGF+K K KYI +TT+ L++ Y                 GPKMAHLVM  AWN V+GI         CN +      ++TPI +   I+  +  ELWSE+N+++VGFGQQ+CL   P+C  CLNK  C
Sbjct:   46 RSKRKRRVSVEYEQAASETVAKRPKWQPKNWAQHLENIQQMRSRRDAPVDQMGAEKCYDQNAAPEVMRYQILLSLMLSSQTKDQVTSAAMCRLRQHGLTVSRILETDDGTLGKLIYPVGFWKNKVKYIKQTTEILQEKY-----------------GPKMAHLVMDIAWNNVSGIG-----KYQCNCMKGYLPGSQTPITS--AIKLPVTLELWSEINWLLVGFGQQVCLPVSPRCSECLNKDIC 266          
BLAST of Endonuclease III homolog vs. Ensembl Mouse
Match: Nthl1 (nth (endonuclease III)-like 1 (E.coli) [Source:MGI Symbol;Acc:MGI:1313275])

HSP 1 Score: 281.567 bits (719), Expect = 2.678e-94
Identity = 129/233 (55.36%), Postives = 167/233 (71.67%), Query Frame = 2
Query:  131 EEAENTANM----WIPRNWQQQWNNLLKMRESYNAPVDTMGCERIADQNEEPKTFRYQVLLSLMLSSQTKDEITSAAMTKLKNYGCNVDNILQMKITELEKLIYPVGFYKTKAKYIMKTTQTLKDDYDGDVPSNVEELCQLPGVGPKMAHLVMKCAWNKVTGIAVDSHVHKICNRLGWTRKTTKTPIETQREIEKWIPRELWSEVNYVMVGFGQQLCLTNKPKCGTCLNKSTC 817
            EE E+   +    W P+NWQQQ  N+  MR   +APVD +G E   D +  PK  RYQVLLSLMLSSQTKD++T+ AM +L+  G  V++ILQ     L +LIYPVGF++ K KYI +TT  L+  Y+GD+P++V EL  LPGVGPKMAHL M  AW  ++GIAVD+HVH+I NRL WT+K TKTP ET++ +E+W+PR LWSEVN ++VGFGQQ+CL   P+C  CLNK+ C
Sbjct:   62 EEGEDAEPLKVPVWEPQNWQQQLANIRIMRSKKDAPVDQLGAEHCYDASASPKVRRYQVLLSLMLSSQTKDQVTAGAMQRLRARGLTVESILQTDDDTLGRLIYPVGFWRNKVKYIKQTTAILQQRYEGDIPASVAELVALPGVGPKMAHLAMAVAWGTISGIAVDTHVHRIANRLRWTKKMTKTPEETRKNLEEWLPRVLWSEVNGLLVGFGQQICLPVHPRCQACLNKALC 294          
BLAST of Endonuclease III homolog vs. Ensembl Mouse
Match: Mutyh (mutY DNA glycosylase [Source:MGI Symbol;Acc:MGI:1917853])

HSP 1 Score: 48.521 bits (114), Expect = 5.958e-6
Identity = 42/184 (22.83%), Postives = 82/184 (44.57%), Query Frame = 2
Query:  287 YQVLLSLMLSSQTKDEITSAAMTKLKNYGCNVDNILQMKITELEKLIYPVGFYKTKAKYIMKTTQTLKDDYDGDVPSNVEELCQL-PGVGPKMAHLVMKCAWNKVTGIAVDSHVHKICNRLGWTRKTTKTPIETQREIEKW-IPRELW-----SEVNYVMVGFGQQLCLTNKPKCGTCLNKSTC 817
            Y V +S ++  QT+        T+       + ++    + E+ +L   +G+Y ++ + + +  + + ++  G +P   E L QL PGVG   A  +   A+++VTG+ VD +V ++  R+   R     P  T      W + ++L       + N   +  G  +C   +P C  C  +S C
Sbjct:   99 YAVWVSEVMLQQTQVATVIDYYTRWMQKWPKLQDLASASLEEVNQLWSGLGYY-SRGRRLQEGARKVVEELGGHMPRTAETLQQLLPGVGRYTAGAIASIAFDQVTGV-VDGNVLRVLCRV---RAIGADPTSTLVSHHLWNLAQQLVDPARPGDFNQAAMELGATVCTPQRPLCSHCPVQSLC 277          
BLAST of Endonuclease III homolog vs. UniProt/SwissProt
Match: sp|Q2KID2|NTH_BOVIN (Endonuclease III-like protein 1 OS=Bos taurus OX=9913 GN=NTHL1 PE=2 SV=1)

HSP 1 Score: 288.5 bits (737), Expect = 3.259e-96
Identity = 126/223 (56.50%), Postives = 166/223 (74.44%), Query Frame = 2
Query:  149 ANMWIPRNWQQQWNNLLKMRESYNAPVDTMGCERIADQNEEPKTFRYQVLLSLMLSSQTKDEITSAAMTKLKNYGCNVDNILQMKITELEKLIYPVGFYKTKAKYIMKTTQTLKDDYDGDVPSNVEELCQLPGVGPKMAHLVMKCAWNKVTGIAVDSHVHKICNRLGWTRKTTKTPIETQREIEKWIPRELWSEVNYVMVGFGQQLCLTNKPKCGTCLNKSTC 817
            A  W P++W+QQ +N+  MR   +APVD +G E   D +  PK  RYQVLLSLMLSSQTKD++T+ AM +L+  G  VD+ILQ   + L  LIYPVGF+++K KYI +T+  L+  YDGD+P++V EL  LPGVGPKMAHL M  AW  V+GIAVD+HVH+I NRL WT+K TK+P ET+R +E+W+PRELWSE+N ++VGFGQQ CL  +P+C  CLN++ C
Sbjct:   77 APSWQPQDWRQQLDNIRTMRSGKDAPVDQLGAEHCFDPSASPKVRRYQVLLSLMLSSQTKDQVTAGAMQRLRARGLTVDSILQTDDSTLGALIYPVGFWRSKVKYIKQTSAILQQRYDGDIPASVAELVALPGVGPKMAHLAMAVAWGTVSGIAVDTHVHRIANRLRWTKKATKSPEETRRALEEWLPRELWSEINGLLVGFGQQTCLPIRPRCQACLNRALC 299          
BLAST of Endonuclease III homolog vs. UniProt/SwissProt
Match: sp|A7M7B9|NTH_CHICK (Endonuclease III-like protein 1 OS=Gallus gallus OX=9031 GN=NTHL1 PE=2 SV=1)

HSP 1 Score: 281.952 bits (720), Expect = 5.827e-94
Identity = 131/251 (52.19%), Postives = 170/251 (67.73%), Query Frame = 2
Query:   86 VPTTVSKYKRKHIVIEEA-------ENTANMWIPRNWQQQWNNLLKMRESYNAPVDTMGCERIADQNEEPKTFRYQVLLSLMLSSQTKDEITSAAMTKLKNYGCNVDNILQMKITELEKLIYPVGFYKTKAKYIMKTTQTLKDDYDGDVPSNVEELCQLPGVGPKMAHLVMKCAWNKVTGIAVDSHVHKICNRLGWTRKTTKTPIETQREIEKWIPRELWSEVNYVMVGFGQQLCLTNKPKCGTCLNKSTC 817
            VP+   +Y R+   +  A       E+    W P NWQQQ   + +MR   +APVD MG ++  D +  P+  RYQVLLSLMLSSQTKD++TSAAM +L+  G  VD+ILQM    L ++IYPVGF++ K KYI +TT  LK  Y GD+P  VEEL +LPGVGPKMAHL M  AWN V+GIAVD+HVH+I NRL W +K T+ P ET+  +E W+PR+LW E+N+++VGFGQQ CL   P+C  CLN+  C
Sbjct:   25 VPSAAPRYSRRTRRVPIAYEAEPKPESPGPKWEPENWQQQLERIREMRRHRDAPVDEMGVDKCYDTSAPPQVMRYQVLLSLMLSSQTKDQVTSAAMLRLRQRGLTVDSILQMDDATLGQIIYPVGFWRNKVKYIKQTTAILKQKYGGDIPGTVEELVKLPGVGPKMAHLAMNIAWNSVSGIAVDTHVHRITNRLKWVKKETRYPEETRVALEDWLPRDLWREINWLLVGFGQQTCLPVNPRCKECLNQDIC 275          
BLAST of Endonuclease III homolog vs. UniProt/SwissProt
Match: sp|O35980|NTH_MOUSE (Endonuclease III-like protein 1 OS=Mus musculus OX=10090 GN=Nthl1 PE=2 SV=2)

HSP 1 Score: 281.567 bits (719), Expect = 1.873e-93
Identity = 129/233 (55.36%), Postives = 167/233 (71.67%), Query Frame = 2
Query:  131 EEAENTANM----WIPRNWQQQWNNLLKMRESYNAPVDTMGCERIADQNEEPKTFRYQVLLSLMLSSQTKDEITSAAMTKLKNYGCNVDNILQMKITELEKLIYPVGFYKTKAKYIMKTTQTLKDDYDGDVPSNVEELCQLPGVGPKMAHLVMKCAWNKVTGIAVDSHVHKICNRLGWTRKTTKTPIETQREIEKWIPRELWSEVNYVMVGFGQQLCLTNKPKCGTCLNKSTC 817
            EE E+   +    W P+NWQQQ  N+  MR   +APVD +G E   D +  PK  RYQVLLSLMLSSQTKD++T+ AM +L+  G  V++ILQ     L +LIYPVGF++ K KYI +TT  L+  Y+GD+P++V EL  LPGVGPKMAHL M  AW  ++GIAVD+HVH+I NRL WT+K TKTP ET++ +E+W+PR LWSEVN ++VGFGQQ+CL   P+C  CLNK+ C
Sbjct:   62 EEGEDAEPLKVPVWEPQNWQQQLANIRIMRSKKDAPVDQLGAEHCYDASASPKVRRYQVLLSLMLSSQTKDQVTAGAMQRLRARGLTVESILQTDDDTLGRLIYPVGFWRNKVKYIKQTTAILQQRYEGDIPASVAELVALPGVGPKMAHLAMAVAWGTISGIAVDTHVHRIANRLRWTKKMTKTPEETRKNLEEWLPRVLWSEVNGLLVGFGQQICLPVHPRCQACLNKALC 294          
BLAST of Endonuclease III homolog vs. UniProt/SwissProt
Match: sp|P78549|NTH_HUMAN (Endonuclease III-like protein 1 OS=Homo sapiens OX=9606 GN=NTHL1 PE=1 SV=2)

HSP 1 Score: 277.33 bits (708), Expect = 1.292e-91
Identity = 124/221 (56.11%), Postives = 161/221 (72.85%), Query Frame = 2
Query:  155 MWIPRNWQQQWNNLLKMRESYNAPVDTMGCERIADQNEEPKTFRYQVLLSLMLSSQTKDEITSAAMTKLKNYGCNVDNILQMKITELEKLIYPVGFYKTKAKYIMKTTQTLKDDYDGDVPSNVEELCQLPGVGPKMAHLVMKCAWNKVTGIAVDSHVHKICNRLGWTRKTTKTPIETQREIEKWIPRELWSEVNYVMVGFGQQLCLTNKPKCGTCLNKSTC 817
            +W P++WQQQ  N+  MR   +APVD +G E   D +  PK  RYQVLLSLMLSSQTKD++T+ AM +L+  G  VD+ILQ     L KLIYPVGF+++K KYI +T+  L+  Y GD+P++V EL  LPGVGPKMAHL M  AW  V+GIAVD+HVH+I NRL WT+K TK+P ET+  +E+W+PRELW E+N ++VGFGQQ CL   P+C  CLN++ C
Sbjct:   86 VWEPQDWQQQLVNIRAMRNKKDAPVDHLGTEHCYDSSAPPKVRRYQVLLSLMLSSQTKDQVTAGAMQRLRARGLTVDSILQTDDATLGKLIYPVGFWRSKVKYIKQTSAILQQHYGGDIPASVAELVALPGVGPKMAHLAMAVAWGTVSGIAVDTHVHRIANRLRWTKKATKSPEETRAALEEWLPRELWHEINGLLVGFGQQTCLPVHPRCHACLNQALC 306          
BLAST of Endonuclease III homolog vs. UniProt/SwissProt
Match: sp|P54137|NTH_CAEEL (Endonuclease III homolog OS=Caenorhabditis elegans OX=6239 GN=nth-1 PE=1 SV=2)

HSP 1 Score: 251.136 bits (640), Expect = 1.502e-81
Identity = 111/215 (51.63%), Postives = 157/215 (73.02%), Query Frame = 2
Query:  173 WQQQWNNLLKMRESYNAPVDTMGCERIADQNEEPKTFRYQVLLSLMLSSQTKDEITSAAMTKLKNYGCNVDNILQMKITELEKLIYPVGFYKTKAKYIMKTTQTLKDDYDGDVPSNVEELCQLPGVGPKMAHLVMKCAWNKVTGIAVDSHVHKICNRLGWTRKTTKTPIETQREIEKWIPRELWSEVNYVMVGFGQQLCLTNKPKCGTCLNKSTC 817
            W++    + KMR+   APVDTMGC ++AD    P   R+QVL++LMLSSQT+DE+ +AAM +LK++G ++  IL+ K+ +LE ++ PVGFYK KA Y+ KT + LKDD+ GD+P +++ LC LPGVGPKMA+LVM+ AW +  GIAVD+HVH+I NRLGW +  T TP +TQ+ +E  +P+  W  +N+++VGFGQ  C   +PKCGTCL + TC
Sbjct:   30 WRRDVELIRKMRKDMIAPVDTMGCHKLADPLAAPPVHRFQVLVALMLSSQTRDEVNAAAMKRLKDHGLSIGKILEFKVPDLETILCPVGFYKRKAVYLQKTAKILKDDFSGDIPDSLDGLCALPGVGPKMANLVMQIAWGECVGIAVDTHVHRISNRLGWIK--TSTPEKTQKALEILLPKSEWQPINHLLVGFGQMQCQPVRPKCGTCLCRFTC 242          
BLAST of Endonuclease III homolog vs. TrEMBL
Match: A0A4E0RXY0 (Endonuclease III homolog OS=Fasciola hepatica OX=6192 GN=NTH1 PE=3 SV=1)

HSP 1 Score: 312.383 bits (799), Expect = 6.207e-103
Identity = 138/231 (59.74%), Postives = 178/231 (77.06%), Query Frame = 2
Query:  140 ENTANMWIPRNWQQQWNNLLKMRESYNAPVDTMGCERIADQNEEPKTFRYQVLLSLMLSSQTKDEITSAAMTKLKNYGCNVDNILQMKITELEKLIYPVGFYKTKAKYIMKTTQTLKDDYDGDVPSNVEELCQLPGVGPKMAHLVMKCAWNKVTGIAVDSHVHKICNRLGWTRKTTKTPIETQREIEKWIPRELWSEVNYVMVGFGQQLCLTNKPKCGTCLNKSTCLFPAG 832
            ++ A  W P NW++Q  N+++MRE  NAPVDTMGCER+AD  E+PK FR QVLLSLMLSSQTKD++T+AAMT+L+  GC ++ +L M  T LE++IYPVGFYK KA YI +T Q LKD Y+GD+P  VE LC+LPGVGPKMAHL  + AW+ VTGIAVD+HVH+I NRL WT+K +KTP ET++ +E W+P+E W  +N+++VGFGQQ+CL   PKC  CLN + C  P G
Sbjct:   34 DSVAKHWEPPNWREQLTNIVRMREIRNAPVDTMGCERLADSTEDPKVFRLQVLLSLMLSSQTKDQVTAAAMTRLRTAGCTIEQLLAMDATTLEQIIYPVGFYKQKAVYIQRTCQLLKDKYNGDIPRTVEGLCELPGVGPKMAHLATRVAWDTVTGIAVDTHVHRIANRLQWTKKPSKTPEETRKALESWLPKEEWDRINWLLVGFGQQICLPVSPKCLDCLNNTIC--PVG 262          
BLAST of Endonuclease III homolog vs. TrEMBL
Match: A0A1S3JCP2 (Endonuclease III homolog OS=Lingula unguis OX=7574 GN=LOC106171745 PE=3 SV=2)

HSP 1 Score: 313.153 bits (801), Expect = 1.534e-102
Identity = 140/231 (60.61%), Postives = 183/231 (79.22%), Query Frame = 2
Query:  131 EEAENTANMWIPRNWQQQWNNLLKMRESYNAPVDTMGCERIADQNEEPKTFRYQVLLSLMLSSQTKDEITSAAMTKLKNYGCNVDNILQMKITELEKLIYPVGFYKTKAKYIMKTTQTLKDDYDGDVPSNVEELCQLPGVGPKMAHLVMKCAWNKVTGIAVDSHVHKICNRLGWTRKTTKTPIETQREIEKWIPRELWSEVNYVMVGFGQQLCLTNKPKCGTCLNKSTCLF 823
            E+ ++  + W P N  QQ +N+ +MR++ +APVDTMGC+RI+DQ+ +P+ +RYQVLLSLMLSSQTKD++TSAAMT+L+ +GCN+ NIL     +L +LIYPVGF++ K +YI KTTQ LKD Y GD+P  +EELC+LPGVGPKMAHLVMKCAW +VTGIAVD+HVH+I NRLGW RK T  P  T+ E+E W+P+ELW+E+N+++VGFGQQ CL   PKC  CLN+  C F
Sbjct:  118 EQQDSKRSAWEPPNCWQQLDNIREMRKNRDAPVDTMGCDRISDQDAKPQVYRYQVLLSLMLSSQTKDQVTSAAMTRLRQHGCNITNILATDDKKLGELIYPVGFWRRKVEYIKKTTQILKDKYKGDIPRTLEELCKLPGVGPKMAHLVMKCAWAEVTGIAVDTHVHRISNRLGWVRKPTVQPENTRVELESWLPKELWTEINWLLVGFGQQTCLPVGPKCQQCLNQHICPF 348          
BLAST of Endonuclease III homolog vs. TrEMBL
Match: A0A1S3J680 (Endonuclease III homolog OS=Lingula unguis OX=7574 GN=LOC106170441 PE=3 SV=1)

HSP 1 Score: 313.153 bits (801), Expect = 1.798e-102
Identity = 140/231 (60.61%), Postives = 182/231 (78.79%), Query Frame = 2
Query:  131 EEAENTANMWIPRNWQQQWNNLLKMRESYNAPVDTMGCERIADQNEEPKTFRYQVLLSLMLSSQTKDEITSAAMTKLKNYGCNVDNILQMKITELEKLIYPVGFYKTKAKYIMKTTQTLKDDYDGDVPSNVEELCQLPGVGPKMAHLVMKCAWNKVTGIAVDSHVHKICNRLGWTRKTTKTPIETQREIEKWIPRELWSEVNYVMVGFGQQLCLTNKPKCGTCLNKSTCLF 823
            E+ ++  + W P N  QQ +N+ +MR+  +APVDTMGC+RI+DQ+ +P+ +RYQVLLSLMLSSQTKD++TSAAMT+L+ +GCN+ NIL     +L +LIYPVGF++ K +YI KTTQ LKD Y GD+P  +EELC+LPGVGPKMAHLVMKCAW +VTGIAVD+HVH+I NRLGW RK T  P  T+ E+E W+P+ELW+E+N+++VGFGQQ CL   PKC  CLN+  C F
Sbjct:  118 EQQDSKRSAWEPPNCWQQLDNIREMRKDRDAPVDTMGCDRISDQDAKPQVYRYQVLLSLMLSSQTKDQVTSAAMTRLRQHGCNITNILATDDKKLGELIYPVGFWRRKVEYIKKTTQILKDKYKGDIPRTLEELCKLPGVGPKMAHLVMKCAWAEVTGIAVDTHVHRISNRLGWVRKPTVQPENTRVELESWLPKELWTEINWLLVGFGQQTCLPVGPKCQQCLNQHICPF 348          
BLAST of Endonuclease III homolog vs. TrEMBL
Match: A0A2C9JFU8 (Endonuclease III homolog OS=Biomphalaria glabrata OX=6526 GN=106054535 PE=3 SV=1)

HSP 1 Score: 310.457 bits (794), Expect = 3.766e-101
Identity = 143/252 (56.75%), Postives = 186/252 (73.81%), Query Frame = 2
Query:   68 YMNPETVPTTVSKYKRKHIVIEEAENTANMWIPRNWQQQWNNLLKMRESYNAPVDTMGCERIADQNEEPKTFRYQVLLSLMLSSQTKDEITSAAMTKLKNYGCNVDNILQMKITELEKLIYPVGFYKTKAKYIMKTTQTLKDDYDGDVPSNVEELCQLPGVGPKMAHLVMKCAWNKVTGIAVDSHVHKICNRLGWTRKTTKTPIETQREIEKWIPRELWSEVNYVMVGFGQQLCLTNKPKCGTCLNKSTCLF 823
            Y  PE +   V K   ++ V E    + + W P  W +Q +N+ +MR+S +APVDTMGC+ I+D    PK +RYQVLLSLMLSSQTKD++TSAAM +L+ +GCNV NIL      L +LIYP GF+K K KYI +T++ L + Y GD+P++VE+LC LPGVGPKMAHLVMKCAWN VTGI VD+HVH+I NRLGW +K TK P +T++E+E W+PR  WSEVN+++VGFGQQ+CL  +PKC  CLN+S C F
Sbjct:  141 YYKPELLSEEVLKPDYQNDVCE----SKSSWRPYQWLEQLSNIREMRKSRDAPVDTMGCDVISDSKAPPKDYRYQVLLSLMLSSQTKDQVTSAAMGRLREHGCNVSNILSTSDDVLGQLIYPAGFWKKKVKYIKQTSEILANKYGGDIPNSVEDLCSLPGVGPKMAHLVMKCAWNTVTGIGVDTHVHRITNRLGWVQKPTKQPEDTRKELEDWLPRSYWSEVNHLLVGFGQQICLPVRPKCDQCLNQSICPF 388          
BLAST of Endonuclease III homolog vs. TrEMBL
Match: A0A2H8TXB9 (Endonuclease III homolog OS=Melanaphis sacchari OX=742174 GN=NTHL1_0 PE=3 SV=1)

HSP 1 Score: 303.908 bits (777), Expect = 4.379e-100
Identity = 140/238 (58.82%), Postives = 183/238 (76.89%), Query Frame = 2
Query:  110 KRKHIVIE-EAENTANM-WIPRNWQQQWNNLLKMRESYNAPVDTMGCERIADQNEEPKTFRYQVLLSLMLSSQTKDEITSAAMTKLKNYGCNVDNILQMKITELEKLIYPVGFYKTKAKYIMKTTQTLKDDYDGDVPSNVEELCQLPGVGPKMAHLVMKCAWNKVTGIAVDSHVHKICNRLGWTRKTTKTPIETQREIEKWIPRELWSEVNYVMVGFGQQLCLTNKPKCGTCLNKSTC 817
            KRKH+ I+ + E T+N  W P NW++  +N+ KMR+   APVD MGC++ AD NE P+  RY VL+SLMLSSQTKDE+  AAM +LK YG  VD IL++    L +LIYPVGF+K K +YI +TT+ LKD Y+GD+PS +++LCQLPGVGPKMAHL M CAWN+VTGI VD+HVH+I NRLGW +KTTKTP  T+ E+E W+P++LW EVN+++VGFGQ +C    P+C +CLNK+TC
Sbjct:   29 KRKHLTIKSDNEKTSNSDWKPPNWEKTLDNIRKMRKDIIAPVDNMGCDQAADLNESPEVIRYHVLISLMLSSQTKDEVNFAAMQRLKQYGLTVDKILEISDKTLGELIYPVGFWKRKVEYIKRTTRILKDIYNGDIPSTIKDLCQLPGVGPKMAHLCMSCAWNEVTGIGVDTHVHRISNRLGWVKKTTKTPENTRMELESWLPKDLWREVNHMLVGFGQTICRPVGPQCVSCLNKTTC 266          
BLAST of Endonuclease III homolog vs. Ensembl Cavefish
Match: nthl1 (nth-like DNA glycosylase 1 [Source:ZFIN;Acc:ZDB-GENE-120511-4])

HSP 1 Score: 284.263 bits (726), Expect = 4.485e-96
Identity = 127/240 (52.92%), Postives = 175/240 (72.92%), Query Frame = 2
Query:  110 KRKHIVIEEAENTA----NMWIPRNWQQQWNNLLKMRESYNAPVDTMGCERIADQNEEPKTFRYQVLLSLMLSSQTKDEITSAAMTKLKNYGCNVDNILQMKITELEKLIYPVGFYKTKAKYIMKTTQTLKDDYDGDVPSNVEELCQLPGVGPKMAHLVMKCAWNKVTGIAVDSHVHKICNRLGWTRKTTKTPIETQREIEKWIPRELWSEVNYVMVGFGQQLCLTNKPKCGTCLNKSTC 817
            +R HI++E  E       N W P +W++Q + + +MR   +APVD MG ++  D    P+  RYQVL+SLMLSSQTKD++TSAAMT+L+ +G ++++IL+     L KLIYPVGF+KTK KYI K T+ ++ ++ GD+P+ VE L +LPGVGPKMAHL M  AWN+V+GI VD+HVH+I NRLGWTR  TK P ET++ +E W+PR+LW E+N ++VGFGQQ+CL   P C TCLN+ +C
Sbjct:   19 RRGHIIVEYEEEGPGIKKNKWEPPDWRRQLSFIREMRSGRDAPVDYMGADKCYDPQASPEVVRYQVLVSLMLSSQTKDQVTSAAMTRLRKHGLSIESILRTDDDRLGKLIYPVGFWKTKVKYIKKATEMIQQEFGGDIPNTVEGLVRLPGVGPKMAHLAMAIAWNQVSGIGVDTHVHRISNRLGWTRSKTKNPEETRKALEDWLPRDLWQEINLLLVGFGQQVCLPVGPLCSTCLNQHSC 258          
BLAST of Endonuclease III homolog vs. Ensembl Cavefish
Match: ENSAMXT00000005387.2 (mutY DNA glycosylase [Source:NCBI gene;Acc:103025733])

HSP 1 Score: 52.7582 bits (125), Expect = 1.677e-7
Identity = 35/150 (23.33%), Postives = 72/150 (48.00%), Query Frame = 2
Query:  380 VDNILQMKITELEKLIYPVGFYKTKAKYIMKTTQTLKDDYDGDVPSNVEELC-QLPGVGPKMAHLVMKCAWNKVTGIAVDSHVHKICNRLGWTRKTTKTPIETQ---REIEKWIPRELWSEVNYVMVGFGQQLCLTNKPKCGTCLNKSTC 817
            V  + +  + E+ ++   +G+Y ++ + + +  Q +  +  G +P + E L  QLPGVG   A  +   A  +VTG AVD +V ++  R+      + +P+ T+   +  E  +  +  ++ N  ++  G  +C    P C  C  ++ C
Sbjct:  118 VQTLAEASLEEVNQMWSGLGYY-SRGRRLHEGAQKVVSELGGQMPRSAEALLKQLPGVGRYTAGAISSIALGQVTG-AVDGNVIRVLCRVRAIGADSTSPVVTEALWKIAETLVDPKRPADFNQALMELGATVCTPKNPGCARCPIQTHC 265          
BLAST of Endonuclease III homolog vs. Ensembl Yeast
Match: NTG2 (DNA N-glycosylase and apurinic/apyrimidinic (AP) lyase; involved in base excision repair, localizes to the nucleus; sumoylated; NTG2 has a paralog, NTG1, that arose from the whole genome duplication [Source:SGD;Acc:S000005403])

HSP 1 Score: 176.022 bits (445), Expect = 3.240e-53
Identity = 90/252 (35.71%), Postives = 131/252 (51.98%), Query Frame = 2
Query:  122 IVIEEAENTANMWIPRNWQQQWNNLLKMRESYNAPVDTMGCERIA----------DQNEEPKTFRYQVLLSLMLSSQTKDEITSAAMTKLKNY---------GCNVDNILQMKITELEKLIYPVGFYKTKAKYIMKTTQTLKDDYDGDVPSNVEELCQLPGVGPKMAHLVMKCAWNKVTGIAVDSHVHKICNRLGWTRKTT-KTPIETQREIEKWIPRELWSEVNYVMVGFGQQLCLTNKPKCGTCLNKSTC 817
            I  EE  N +   +P ++   +N +  MR     PVD MGC  I            +  +PK FR Q L+  MLS+QT+DE  + A   +  Y         G  +D +L++    L  LI  V FY  KA +I +T Q L D++D D+P ++E +  LPGVGPKM +L ++  W  + GI VD HVH++C    W      KT   T++E++ W+P  LW E+N V+VGFGQ +C+    +C  CL    C
Sbjct:   84 ITKEEMINDSGAKVPESFLPIYNRVRLMRSKVKTPVDAMGCSMIPVLVSNKCGIPSEKVDPKNFRLQFLIGTMLSAQTRDERMAQAALNITEYCLNTLKIAEGITLDGLLKIDEPVLANLIRCVSFYTRKANFIKRTAQLLVDNFDSDIPYDIEGILSLPGVGPKMGYLTLQKGWGLIAGICVDVHVHRLCKMWNWVDPIKCKTAEHTRKELQVWLPHSLWYEINTVLVGFGQLICMARGKRCDLCLANDVC 335          
BLAST of Endonuclease III homolog vs. Ensembl Yeast
Match: NTG1 (DNA N-glycosylase and apurinic/apyrimidinic (AP) lyase; involved in base excision repair; acts in both nucleus and mitochondrion; creates a double-strand break at mtDNA origins that stimulates replication in response to oxidative stress; required for maintaining mitochondrial genome integrity; NTG1 has a paralog, NTG2, that arose from the whole genome duplication [Source:SGD;Acc:S000000013])

HSP 1 Score: 173.711 bits (439), Expect = 3.565e-52
Identity = 94/250 (37.60%), Postives = 144/250 (57.60%), Query Frame = 2
Query:  149 ANMWIPRNWQQQWNNLLKMRESYNAPVDTMGCERI----------ADQNEEPKTFRYQVLLSLMLSSQTKDEITSAAMTKLKNY---------GCNVDNILQMKITELEKLIYPVGFYKTKAKYIMKTTQTLKDDYDGDVPSNVEELCQLPGVGPKMAHLVMKCAWNKVTGIAVDSHVHKICNRLGWT-RKTTKTPIETQREIEKWIPRELWSEVNYVMVGFGQQLCLTNKPKCGTCLNKSTCLFPAGPR 838
            A+  +P  +Q+ +  +  +R    APVD +G   I          + +   P+ +R QVLL +MLSSQTKDE+T+ AM  +  Y         G  ++ +LQ+  T+L++LI+ VGF+  KAKYI+ T + L+D +  DVP+ + EL  LPGVGPKMA+L ++ AW K+ GI VD HV ++     W   +  KTP +T+ +++ W+P+ LW+E+N ++VGFGQ   +T     G  L     L P  PR
Sbjct:   88 ASTKVPYKFQETYARMRVLRSKILAPVDIIGGSSIPVTVASKCGISKEQISPRDYRLQVLLGVMLSSQTKDEVTAMAMLNIMRYCIDELHSEEGMTLEAVLQINETKLDELIHSVGFHTRKAKYILSTCKILQDQFSSDVPATINELLGLPGVGPKMAYLTLQKAWGKIEGICVDVHVDRLTKLWKWVDAQKCKTPDQTRTQLQNWLPKGLWTEINGLLVGFGQ--IITKSRNLGDMLQ---FLPPDDPR 332          
BLAST of Endonuclease III homolog vs. Ensembl Nematostella
Match: EDO31265 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYF1])

HSP 1 Score: 281.182 bits (718), Expect = 1.291e-95
Identity = 126/220 (57.27%), Postives = 161/220 (73.18%), Query Frame = 2
Query:  158 WIPRNWQQQWNNLLKMRESYNAPVDTMGCERIADQNEEPKTFRYQVLLSLMLSSQTKDEITSAAMTKLKNYGCNVDNILQMKITELEKLIYPVGFYKTKAKYIMKTTQTLKDDYDGDVPSNVEELCQLPGVGPKMAHLVMKCAWNKVTGIAVDSHVHKICNRLGWTRKTTKTPIETQREIEKWIPRELWSEVNYVMVGFGQQLCLTNKPKCGTCLNKSTC 817
            W P NW+QQ  N+ +MR S +APVD+ GCER AD +  P+ +RYQVL+SLMLSSQTKD +T AAM KLK +GC VD IL     +L ++IYPVGF++ K  YI K T   K  Y GD+P  + EL +LPGVGPKMAH+ M  AW ++TGI VD+HVH+ICNRLGWT+K TKTP E++  +E W+PRE WSE+N ++VGFGQQ+CL   P C +CLN+  C
Sbjct:    1 WEPPNWRQQLENIRQMRASRDAPVDSQGCERTADTSTTPQVYRYQVLVSLMLSSQTKDPVTFAAMEKLKAHGCTVDKILNTSDDKLGEMIYPVGFWRKKVDYIKKATNICKAQYQGDIPCTISELVELPGVGPKMAHICMSVAWGQLTGIGVDTHVHRICNRLGWTKKPTKTPEESRLAVEAWLPREEWSELNVLLVGFGQQICLPVGPNCQSCLNRDIC 220          
BLAST of Endonuclease III homolog vs. Ensembl Nematostella
Match: EDO48701 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIG3])

HSP 1 Score: 61.2326 bits (147), Expect = 9.955e-11
Identity = 37/151 (24.50%), Postives = 77/151 (50.99%), Query Frame = 2
Query:  377 NVDNILQMKITELEKLIYPVGFYKTKAKYIMKTTQTLKDDYDGDVPSNVEELC-QLPGVGPKMAHLVMKCAWNKVTGIAVDSHVHKICNRL---GWTRKTTKTPIETQREIEKWIPRELWSEVNYVMVGFGQQLCLTNKPKCGTCLNKSTC 817
            +++ + +  + E+ +    +G+Y ++A+ + +    + ++ DG +P+N  +L  +LPGVG   A  +   A+ + TG+ VD +V ++ +RL   G    +  T         + +P +   + N  M+ FG  LC    P+C  C+ +S+C
Sbjct:   95 SLEALARASLEEVNECWSGLGYY-SRARRLHEAAIKVVNELDGKIPTNAAKLQKELPGVGLYTAGAIASIAFGEATGV-VDGNVIRVLSRLRRIGADMTSNTTMDHFWSLAHRLVPNDRPGDFNQAMMEFGATLCTPKTPQCSKCVLRSSC 243          
BLAST of Endonuclease III homolog vs. Ensembl Nematostella
Match: EDO29376 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T3T7])

HSP 1 Score: 57.7658 bits (138), Expect = 4.929e-10
Identity = 42/180 (23.33%), Postives = 80/180 (44.44%), Query Frame = 2
Query:  287 YQVLLSLMLSSQTKDEITSAAMTKLKNYGCNVDNILQMKITELEKLIYPVGFYKTKAKYIMKTTQTLKDDYDGDVPSNVEELCQLPGVGPKMAHLVMKCAWNKVTGIAVDSHVHKICNRLGWTRKTTKTPIETQR---EIEKWIPRELWSEVNYVMVGFGQQLCLTNKPKCGTCLNKSTC 817
            Y+V +S ++  QT+         +       V+++      E+  L   +G+Y T+A+ + KT Q +  ++ G+ P +V++L +LPG+G   A  +   +      I +D +V ++  R          P   ++     E++ P+   +     M+  G  LC  +KP C  C  KS C
Sbjct:   31 YRVWVSEIMLQQTQVSTVLGYFDRFMTALPTVNDLAAAPEDEVLHLWTGLGYY-TRARNLQKTAQIVMREHAGEFPRDVDQLTELPGIGRSTAGAIASLSMGLRAPI-LDGNVKRVLARYVAQEGYPGEPKVAKQLWDVAERFTPQARVNHYTQAMMDLGATLCTRSKPSCLLCPLKSGC 208          
BLAST of Endonuclease III homolog vs. Ensembl Medaka
Match: nthl1 (nth like DNA glycosylase 1 [Source:NCBI gene;Acc:101175220])

HSP 1 Score: 263.462 bits (672), Expect = 1.160e-86
Identity = 118/220 (53.64%), Postives = 160/220 (72.73%), Query Frame = 2
Query:  158 WIPRNWQQQWNNLLKMRESYNAPVDTMGCERIADQNEEPKTFRYQVLLSLMLSSQTKDEITSAAMTKLKNYGCNVDNILQMKITELEKLIYPVGFYKTKAKYIMKTTQTLKDDYDGDVPSNVEELCQLPGVGPKMAHLVMKCAWNKVTGIAVDSHVHKICNRLGWTRKTTKTPIETQREIEKWIPRELWSEVNYVMVGFGQQLCLTNKPKCGTCLNKSTC 817
            W P +W+ Q   +  MR   +APVD MG E+  D     +  R+QVL+SLMLSSQT+D++T+AAM KL+ +GC   NIL      L  LIYPVGF++ K KY+ KT+  L++ + GD+PS+VE L +LPGVGPKMAHL M  AWN+V+GI VD+HVH+I NRLGW RK TKTP +T+R +E+W+PR+LWS++N+++VGFGQQ+CL   P C  CLN+ +C
Sbjct:   78 WEPPHWKDQLACIRTMRSRRDAPVDQMGAEKCFDTKAPVR--RFQVLVSLMLSSQTRDQVTAAAMQKLRAHGCTAGNILATDDHTLGTLIYPVGFWRNKVKYLKKTSAILQEQFGGDIPSDVEGLVRLPGVGPKMAHLAMDIAWNQVSGIGVDTHVHRISNRLGWVRKPTKTPEDTRRALEEWLPRDLWSQINWLLVGFGQQMCLPVGPLCSMCLNQHSC 295          
BLAST of Endonuclease III homolog vs. Ensembl Medaka
Match: MUTYH (mutY DNA glycosylase [Source:NCBI gene;Acc:101160544])

HSP 1 Score: 51.9878 bits (123), Expect = 3.687e-7
Identity = 37/153 (24.18%), Postives = 69/153 (45.10%), Query Frame = 2
Query:  380 VDNILQMKITELEKLIYPVGFYKTKAKYIMKTTQTLKDDYDGDVPSNVEELC-QLPGVGPKMAHLVMKCAWNKVTGIAVDSHVHKICNRLGWTRKTTKTPIETQREIEKW------IPRELWSEVNYVMVGFGQQLCLTNKPKCGTCLNKSTC 817
            V ++    + E+ ++   +G+Y ++ K + +  Q +  +  G +P  V++L  +LPGVG   A  V   A  +V G+ VD +V ++  RL      + +P   Q     W      +  E   + N  M+  G ++C    P C  C  ++ C
Sbjct:  121 VQHLAAATLQEVNQMWAGLGYY-SRGKRLHEGAQKVVSELKGQMPHTVDDLLKELPGVGRYTAAAVASIALGQVAGV-VDGNVTRVLCRLRAIGADSTSPAANQ---ALWGLANVLVDSERPGDFNQAMMELGARVCTPKGPLCSRCPVRAHC 268          
BLAST of Endonuclease III homolog vs. Planmine SMEST
Match: SMESG000036384.1 (SMESG000036384.1)

HSP 1 Score: 535.413 bits (1378), Expect = 0.000e+0
Identity = 256/257 (99.61%), Postives = 257/257 (100.00%), Query Frame = 2
Query:   71 MNPETVPTTVSKYKRKHIVIEEAENTANMWIPRNWQQQWNNLLKMRESYNAPVDTMGCERIADQNEEPKTFRYQVLLSLMLSSQTKDEITSAAMTKLKNYGCNVDNILQMKITELEKLIYPVGFYKTKAKYIMKTTQTLKDDYDGDVPSNVEELCQLPGVGPKMAHLVMKCAWNKVTGIAVDSHVHKICNRLGWTRKTTKTPIETQREIEKWIPRELWSEVNYVMVGFGQQLCLTNKPKCGTCLNKSTCLFPAGPRK 841
            MNP+TVPTTVSKYKRKHIVIEEAENTANMWIPRNWQQQWNNLLKMRESYNAPVDTMGCERIADQNEEPKTFRYQVLLSLMLSSQTKDEITSAAMTKLKNYGCNVDNILQMKITELEKLIYPVGFYKTKAKYIMKTTQTLKDDYDGDVPSNVEELCQLPGVGPKMAHLVMKCAWNKVTGIAVDSHVHKICNRLGWTRKTTKTPIETQREIEKWIPRELWSEVNYVMVGFGQQLCLTNKPKCGTCLNKSTCLFPAGPRK
Sbjct:    1 MNPKTVPTTVSKYKRKHIVIEEAENTANMWIPRNWQQQWNNLLKMRESYNAPVDTMGCERIADQNEEPKTFRYQVLLSLMLSSQTKDEITSAAMTKLKNYGCNVDNILQMKITELEKLIYPVGFYKTKAKYIMKTTQTLKDDYDGDVPSNVEELCQLPGVGPKMAHLVMKCAWNKVTGIAVDSHVHKICNRLGWTRKTTKTPIETQREIEKWIPRELWSEVNYVMVGFGQQLCLTNKPKCGTCLNKSTCLFPAGPRK 257          
The following BLAST results are available for this feature:
BLAST of Endonuclease III homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NTHL11.653e-9256.11nth like DNA glycosylase 1 [Source:HGNC Symbol;Acc... [more]
NTHL12.690e-9256.11nth like DNA glycosylase 1 [Source:HGNC Symbol;Acc... [more]
NTHL12.078e-8457.21nth like DNA glycosylase 1 [Source:HGNC Symbol;Acc... [more]
NTHL13.439e-5654.90nth like DNA glycosylase 1 [Source:HGNC Symbol;Acc... [more]
NTHL15.490e-5158.06nth like DNA glycosylase 1 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Endonuclease III homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nth-11.174e-8251.63Endonuclease III homolog [Source:UniProtKB/Swiss-... [more]
nth-11.174e-8251.63Endonuclease III homolog [Source:UniProtKB/Swiss-... [more]
nth-11.180e-8251.63Endonuclease III homolog [Source:UniProtKB/Swiss-... [more]
nth-11.354e-6653.53Endonuclease III homolog [Source:UniProtKB/Swiss-... [more]
nth-11.584e-2652.33Endonuclease III homolog [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of Endonuclease III homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG92729.780e-8454.88gene:FBgn0032907 transcript:FBtr0089944[more]
back to top
BLAST of Endonuclease III homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nthl13.642e-9352.02nth-like DNA glycosylase 1 [Source:ZFIN;Acc:ZDB-GE... [more]
CT025742.12.354e-724.67mutY DNA glycosylase [Source:NCBI gene;Acc:558403][more]
back to top
BLAST of Endonuclease III homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
nthl14.246e-9753.01nth-like DNA glycosylase 1 [Source:NCBI gene;Acc:7... [more]
nthl11.098e-8159.69nth-like DNA glycosylase 1 [Source:NCBI gene;Acc:7... [more]
nthl11.771e-7546.59nth-like DNA glycosylase 1 [Source:NCBI gene;Acc:7... [more]
hsd17b42.394e-6345.31hydroxysteroid (17-beta) dehydrogenase 4 [Source:X... [more]
back to top
BLAST of Endonuclease III homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Nthl12.678e-9455.36nth (endonuclease III)-like 1 (E.coli) [Source:MGI... [more]
Mutyh5.958e-622.83mutY DNA glycosylase [Source:MGI Symbol;Acc:MGI:19... [more]
back to top
BLAST of Endonuclease III homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2KID2|NTH_BOVIN3.259e-9656.50Endonuclease III-like protein 1 OS=Bos taurus OX=9... [more]
sp|A7M7B9|NTH_CHICK5.827e-9452.19Endonuclease III-like protein 1 OS=Gallus gallus O... [more]
sp|O35980|NTH_MOUSE1.873e-9355.36Endonuclease III-like protein 1 OS=Mus musculus OX... [more]
sp|P78549|NTH_HUMAN1.292e-9156.11Endonuclease III-like protein 1 OS=Homo sapiens OX... [more]
sp|P54137|NTH_CAEEL1.502e-8151.63Endonuclease III homolog OS=Caenorhabditis elegans... [more]
back to top
BLAST of Endonuclease III homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RXY06.207e-10359.74Endonuclease III homolog OS=Fasciola hepatica OX=6... [more]
A0A1S3JCP21.534e-10260.61Endonuclease III homolog OS=Lingula unguis OX=7574... [more]
A0A1S3J6801.798e-10260.61Endonuclease III homolog OS=Lingula unguis OX=7574... [more]
A0A2C9JFU83.766e-10156.75Endonuclease III homolog OS=Biomphalaria glabrata ... [more]
A0A2H8TXB94.379e-10058.82Endonuclease III homolog OS=Melanaphis sacchari OX... [more]
back to top
BLAST of Endonuclease III homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nthl14.485e-9652.92nth-like DNA glycosylase 1 [Source:ZFIN;Acc:ZDB-GE... [more]
ENSAMXT00000005387.21.677e-723.33mutY DNA glycosylase [Source:NCBI gene;Acc:1030257... [more]
back to top
BLAST of Endonuclease III homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Endonuclease III homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
NTG23.240e-5335.71DNA N-glycosylase and apurinic/apyrimidinic (AP) l... [more]
NTG13.565e-5237.60DNA N-glycosylase and apurinic/apyrimidinic (AP) l... [more]
back to top
BLAST of Endonuclease III homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO312651.291e-9557.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487019.955e-1124.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO293764.929e-1023.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Endonuclease III homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nthl11.160e-8653.64nth like DNA glycosylase 1 [Source:NCBI gene;Acc:1... [more]
MUTYH3.687e-724.18mutY DNA glycosylase [Source:NCBI gene;Acc:1011605... [more]
back to top
BLAST of Endonuclease III homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000036384.10.000e+099.61SMESG000036384.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029304 ID=SMED30029304|Name=Endonuclease III homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=856bp
AATCTTATATGAATTGTATTGGACTTTGATTATTATTATTCATTTTAAAT
AATAGAAACCTTCTAATTATATGAATCCAGAAACTGTTCCAACTACAGTA
TCAAAATACAAAAGAAAGCATATAGTTATTGAAGAAGCAGAAAATACTGC
AAATATGTGGATCCCACGAAATTGGCAGCAACAATGGAATAATTTACTAA
AAATGAGAGAATCCTATAACGCTCCTGTAGACACTATGGGATGTGAAAGA
ATTGCGGATCAAAATGAAGAACCCAAAACTTTTAGATATCAAGTTTTATT
AAGCCTAATGCTATCAAGTCAAACTAAAGATGAAATAACATCTGCAGCAA
TGACAAAATTAAAAAATTATGGATGTAATGTTGATAATATTCTTCAAATG
AAAATTACTGAATTGGAAAAATTAATTTATCCAGTTGGCTTTTATAAAAC
TAAAGCGAAATATATCATGAAAACCACACAAACACTAAAGGATGATTATG
ATGGTGATGTTCCGTCTAATGTCGAGGAATTGTGTCAGTTGCCAGGCGTT
GGACCAAAGATGGCACATTTAGTAATGAAGTGTGCATGGAATAAAGTTAC
TGGAATTGCGGTCGATAGTCATGTACACAAAATATGTAATAGACTTGGAT
GGACAAGGAAGACAACTAAGACACCAATTGAGACACAAAGAGAAATCGAG
AAATGGATTCCAAGAGAATTATGGTCAGAGGTCAATTATGTGATGGTGGG
CTTTGGCCAGCAATTATGTCTTACTAATAAACCTAAATGCGGAACTTGCC
TCAATAAATCGACATGCTTATTTCCAGCTGGTCCGCGAAAATAAATAAAT
GTCCCC
back to top

protein sequence of SMED30029304-orf-1

>SMED30029304-orf-1 ID=SMED30029304-orf-1|Name=SMED30029304-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=258bp
MNPETVPTTVSKYKRKHIVIEEAENTANMWIPRNWQQQWNNLLKMRESYN
APVDTMGCERIADQNEEPKTFRYQVLLSLMLSSQTKDEITSAAMTKLKNY
GCNVDNILQMKITELEKLIYPVGFYKTKAKYIMKTTQTLKDDYDGDVPSN
VEELCQLPGVGPKMAHLVMKCAWNKVTGIAVDSHVHKICNRLGWTRKTTK
TPIETQREIEKWIPRELWSEVNYVMVGFGQQLCLTNKPKCGTCLNKSTCL
FPAGPRK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004519endonuclease activity
GO:0003824catalytic activity
GO:0003677DNA binding
GO:0000703oxidized pyrimidine nucleobase lesion DNA N-glycosylase activity
GO:0003906DNA-(apurinic or apyrimidinic site) lyase activity
GO:0016787hydrolase activity
GO:0016798hydrolase activity, acting on glycosyl bonds
GO:0016829lyase activity
GO:0019104DNA N-glycosylase activity
GO:0046872metal ion binding
GO:0051536iron-sulfur cluster binding
GO:00515394 iron, 4 sulfur cluster binding
Vocabulary: biological process
TermDefinition
GO:0090305nucleic acid phosphodiester bond hydrolysis
GO:0006284base-excision repair
GO:0006281DNA repair
GO:0006285base-excision repair, AP site formation
GO:0006974cellular response to DNA damage stimulus
GO:0008152metabolic process
Vocabulary: INTERPRO
TermDefinition
IPR003265HhH-GPD_domain
IPR023170HTH_base_excis_C
IPR011257DNA_glycosylase
IPR000445HhH_motif
IPR004035Endouclease-III_FeS-bd_BS
IPR004036Endonuclease-III-like_CS2
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005739mitochondrion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003265HhH-GPD domainSMARTSM00478endo3endcoord: 81..231
e-value: 3.0E-49
score: 179.6
IPR003265HhH-GPD domainPFAMPF00730HhH-GPDcoord: 78..214
e-value: 9.1E-21
score: 75.0
IPR003265HhH-GPD domainCDDcd00056ENDO3ccoord: 73..229
e-value: 2.3059E-43
score: 142.381
IPR023170Helix-turn-helix, base-excision DNA repair, C-terminalGENE3DG3DSA:1.10.1670.10coord: 171..253
e-value: 4.1E-22
score: 79.9
NoneNo IPR availableGENE3DG3DSA:1.10.340.30coord: 64..170
e-value: 3.6E-33
score: 116.2
NoneNo IPR availablePIRSFPIRSF001435Nthcoord: 44..256
e-value: 2.7E-36
score: 122.5
NoneNo IPR availablePANTHERPTHR43286FAMILY NOT NAMEDcoord: 16..249
NoneNo IPR availablePANTHERPTHR43286:SF1ENDONUCLEASE III-LIKE PROTEIN 1coord: 16..249
IPR000445Helix-hairpin-helix motifPFAMPF00633HHHcoord: 143..169
e-value: 1.7E-8
score: 33.9
IPR004036Endonuclease III-like, conserved site-2PROSITEPS01155ENDONUCLEASE_III_2coord: 145..174
IPR004035Endonuclease III, iron-sulphur binding sitePROSITEPS00764ENDONUCLEASE_III_1coord: 233..249
IPR011257DNA glycosylaseSUPERFAMILYSSF48150DNA-glycosylasecoord: 43..252