Structural maintenance of chromosomes protein

Overview
NameStructural maintenance of chromosomes protein
Smed IDSMED30029269
Length (bp)2123
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Structural maintenance of chromosomes protein (SMED30029269) t-SNE clustered cells

Violin plots show distribution of expression levels for Structural maintenance of chromosomes protein (SMED30029269) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Structural maintenance of chromosomes protein (SMED30029269) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Structural maintenance of chromosomes protein (SMED30029269) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029269

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30029269SMESG000022017.1 SmedASXL_018124SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30029269SMESG000022017.1 SmedASXL_018124SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30029269SMESG000022017.1 dd_Smed_v4_9360_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30029269SMESG000022017.1 dd_Smed_v4_9360_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029269SMESG000022017.1 dd_Smed_v4_9360_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30029269SMESG000022017.1 dd_Smed_v4_9360_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029269SMESG000022017.1 dd_Smed_v4_9360_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30029269SMESG000022017.1 dd_Smed_v4_9360_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029269SMESG000022017.1 dd_Smed_v6_9360_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Human
Match: SMC1A (structural maintenance of chromosomes 1A [Source:HGNC Symbol;Acc:HGNC:11111])

HSP 1 Score: 349.747 bits (896), Expect = 1.952e-105
Identity = 200/469 (42.64%), Postives = 306/469 (65.25%), Query Frame = 1
Query:  610 KLKMDSAEDDVFKEFCNSIGVENIRQYEERELIIARERDLKLLDFKNQLQKLKNQHDYEKS--RNTQAILDKYSEAMKNEKLEIEKAEANXXXXXXXXXXXXNRRDELETRLAEFKQKCESVDSELADLHRSRNTKQKDIQKLTKEVNQIETRLDSRRADRHSLIQAAKIDDLDLPVKEGSMTIYESTLSQNLNST-GDDLDAGEMGSEEMLRIFKAEEKIQFEYKRLDRSLRSLESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSNLLVSKVYRLDLSQYTDA 2007
            K KM+  ED+VF+EFC  IGV NIR++EE ++    E   K L+F+NQ  +L  Q D+EK+  +  Q  +  + + +K ++ EIEK +  E +    ++    +  +L+ +    K +    + E+ ++ +      K++  L KEV  IET+L+ +R+DRH+L+QA K+ D+ LP+ +G+M      +SQ   S+ G+D  +G   S+ +  I+  E  I+ +Y  L   L+  ++E E+ + +  +Q ++++    +Q+I  PN++A +KL+SV ++ ++T  +FE  R RA+KAK  FE++K+ R+DRF  CF  V  +ID IYK L+RN  AQA L P N EEPYLD I + CVAPGKRF+ MD+LSGGEKT+AALALLFA H+Y P+PFFVLDEIDAALDNTNIGKVA++I+E ++   Q IVISLKEEFY++A++LIG+ +    + ++SKV   DL++Y DA
Sbjct:  766 KEKMNQVEDEVFEEFCREIGVRNIREFEEEKVKRQNEIAKKRLEFENQKTRLGIQLDFEKNQLKEDQDKVHMWEQTVKKDENEIEKLKKEEQRHMKIIDETMAQLQDLKNQHLAKKSEVNDKNHEMEEIRKKLGGANKEMTHLQKEVTAIETKLEQKRSDRHNLLQACKMQDIKLPLSKGTM----DDISQEEGSSQGEDSVSG---SQRISSIYAREALIEIDYGDLCEDLKDAQAEEEIKQEMNTLQQKLNEQQSVLQRIAAPNMKAMEKLESVRDKFQETSDEFEAARKRAKKAKQAFEQIKKERFDRFNACFESVATNIDEIYKALSRNSSAQAFLGPENPEEPYLDGINYNCVAPGKRFRPMDNLSGGEKTVAALALLFAIHSYKPAPFFVLDEIDAALDNTNIGKVANYIKEQSTCNFQAIVISLKEEFYTKAESLIGV-YPEQGDCVISKVLTFDLTKYPDA 1226          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Human
Match: SMC1A (structural maintenance of chromosomes 1A [Source:HGNC Symbol;Acc:HGNC:11111])

HSP 1 Score: 349.362 bits (895), Expect = 2.021e-105
Identity = 200/469 (42.64%), Postives = 306/469 (65.25%), Query Frame = 1
Query:  610 KLKMDSAEDDVFKEFCNSIGVENIRQYEERELIIARERDLKLLDFKNQLQKLKNQHDYEKS--RNTQAILDKYSEAMKNEKLEIEKAEANXXXXXXXXXXXXNRRDELETRLAEFKQKCESVDSELADLHRSRNTKQKDIQKLTKEVNQIETRLDSRRADRHSLIQAAKIDDLDLPVKEGSMTIYESTLSQNLNST-GDDLDAGEMGSEEMLRIFKAEEKIQFEYKRLDRSLRSLESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSNLLVSKVYRLDLSQYTDA 2007
            K KM+  ED+VF+EFC  IGV NIR++EE ++    E   K L+F+NQ  +L  Q D+EK+  +  Q  +  + + +K ++ EIEK +  E +    ++    +  +L+ +    K +    + E+ ++ +      K++  L KEV  IET+L+ +R+DRH+L+QA K+ D+ LP+ +G+M      +SQ   S+ G+D  +G   S+ +  I+  E  I+ +Y  L   L+  ++E E+ + +  +Q ++++    +Q+I  PN++A +KL+SV ++ ++T  +FE  R RA+KAK  FE++K+ R+DRF  CF  V  +ID IYK L+RN  AQA L P N EEPYLD I + CVAPGKRF+ MD+LSGGEKT+AALALLFA H+Y P+PFFVLDEIDAALDNTNIGKVA++I+E ++   Q IVISLKEEFY++A++LIG+ +    + ++SKV   DL++Y DA
Sbjct:  744 KEKMNQVEDEVFEEFCREIGVRNIREFEEEKVKRQNEIAKKRLEFENQKTRLGIQLDFEKNQLKEDQDKVHMWEQTVKKDENEIEKLKKEEQRHMKIIDETMAQLQDLKNQHLAKKSEVNDKNHEMEEIRKKLGGANKEMTHLQKEVTAIETKLEQKRSDRHNLLQACKMQDIKLPLSKGTM----DDISQEEGSSQGEDSVSG---SQRISSIYAREALIEIDYGDLCEDLKDAQAEEEIKQEMNTLQQKLNEQQSVLQRIAAPNMKAMEKLESVRDKFQETSDEFEAARKRAKKAKQAFEQIKKERFDRFNACFESVATNIDEIYKALSRNSSAQAFLGPENPEEPYLDGINYNCVAPGKRFRPMDNLSGGEKTVAALALLFAIHSYKPAPFFVLDEIDAALDNTNIGKVANYIKEQSTCNFQAIVISLKEEFYTKAESLIGV-YPEQGDCVISKVLTFDLTKYPDA 1204          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Human
Match: SMC1B (structural maintenance of chromosomes 1B [Source:HGNC Symbol;Acc:HGNC:11112])

HSP 1 Score: 325.865 bits (834), Expect = 1.123e-96
Identity = 194/477 (40.67%), Postives = 278/477 (58.28%), Query Frame = 1
Query:  616 KMDSAEDDVFKEFCNSIGVENIRQYEERELIIARERDLKLLDFKNQLQKLKNQHDYEKSRNTQAILDKYSEAMKNEKLEIEKAEANXXXXXXXXXXXXNRRDELETRLAEFK-------QKCESVDSELADLHRSRNTKQKDIQKLTKEVNQIETRLDSRRADRHSLIQAAKIDDLDLPVKEGSMTIYESTLSQNLNSTGDDLDAGEMGSEE-----MLRIFKAEEKIQFEYKRLDRSLRSLESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSNLLVSKVYRLDLSQYTDAE 2010
            K+D  EDD+F+ FC  IGVENIR++E + +   +E D K L+F+ Q  +L  Q +Y +S      L K    +   K  I+K   +   LK   E      +EL  +  + K          E V +++ +  +      +++ KL KEV  I+T L+ +R ++H+L+   K+ D+++ +  GS+               DD+   EMG+E       + I++ EE  + +Y  L   L++L+S+ E+   +  +  +V      + K   PNLRA + L +V ++ +++   FE +R  AR  + +FE+VK+ RYD F  CF  V   ID IYK L RN  AQA L P N EEPYL+ I + CVAPGKRF  MD+LSGGEK +AALALLFA H++ P+PFFVLDE+DAALDNTNIGKV+S+I+E   D+ Q+IVISLKEEFYSRADALIGI    D + + S+V  LDLSQY D E
Sbjct:  768 KIDKVEDDIFQHFCEEIGVENIREFENKHVKRQQEIDQKRLEFEKQKTRLNVQLEYSRSH-----LKKKLNKINTLKETIQKGSEDIDHLKKAEENCLQTVNELMAKQQQLKDIRVTQNSSAEKVQTQIEEERKKFLAVDREVGKLQKEVVSIQTSLEQKRLEKHNLLLDCKVQDIEIILLSGSL---------------DDIIEVEMGTEAESTQATIDIYEKEEAFEIDYSSLKEDLKALQSDQEIEAHLRLLLQQVASQEDILLKTAAPNLRALENLKTVRDKFQESTDAFEASRKEARLCRQEFEQVKKRRYDLFTQCFEHVSISIDQIYKKLCRNNSAQAFLSPENPEEPYLEGISYNCVAPGKRFMPMDNLSGGEKCVAALALLFAVHSFRPAPFFVLDEVDAALDNTNIGKVSSYIKEQTQDQFQMIVISLKEEFYSRADALIGIYPEYD-DCMFSRVLTLDLSQYPDTE 1223          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Human
Match: SMC1A (structural maintenance of chromosomes 1A [Source:HGNC Symbol;Acc:HGNC:11111])

HSP 1 Score: 204.912 bits (520), Expect = 4.415e-60
Identity = 112/247 (45.34%), Postives = 165/247 (66.80%), Query Frame = 1
Query: 1030 LTKEVNQIETRLDSRRADRHSLIQAAKIDDLDLPVKEGSMTIYESTLSQNLNST-GDDLDAGEMGSEEMLRIFKAEEKIQFEYKRLDRSLRSLESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNY 1767
            L KEV  IET+L+ +R+DRH+L+QA K+ D+ LP+ +G+M      +SQ   S+ G+D      GS+ +  I+  E  I+ +Y  L   L+  ++E E+ + +  +Q ++++    +Q+I  PN++A +KL+SV ++ ++T  +FE  R RA+KAK  FE++K+ R+DRF  CF  V  +ID IYK L+RN  AQA L P N EEPYLD I + CVAPGKRF+ MD+LSGGEKT+AALALLFA H +
Sbjct:    5 LQKEVTAIETKLEQKRSDRHNLLQACKMQDIKLPLSKGTM----DDISQEEGSSQGED---SVSGSQRISSIYAREALIEIDYGDLCEDLKDAQAEEEIKQEMNTLQQKLNEQQSVLQRIAAPNMKAMEKLESVRDKFQETSDEFEAARKRAKKAKQAFEQIKKERFDRFNACFESVATNIDEIYKALSRNSSAQAFLGPENPEEPYLDGINYNCVAPGKRFRPMDNLSGGEKTVAALALLFAIHRW 244          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Human
Match: SMC1B (structural maintenance of chromosomes 1B [Source:HGNC Symbol;Acc:HGNC:11112])

HSP 1 Score: 139.043 bits (349), Expect = 3.519e-33
Identity = 105/346 (30.35%), Postives = 173/346 (50.00%), Query Frame = 1
Query:  616 KMDSAEDDVFKEFCNSIGVENIRQYEERELIIARERDLKLLDFKNQLQKLKNQHDYEKSRNTQAILDKYSEAMKNEKLEIEKAEANXXXXXXXXXXXXNRRDELETRLAEFK-------QKCESVDSELADLHRSRNTKQKDIQKLTKEVNQIETRLDSRRADRHSLIQAAKIDDLDLPVKEGSMTIYESTLSQNLNSTGDDLDAGEMGSEE-----MLRIFKAEEKIQFEYKRLDRSLRSLESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQAS 1617
            K+D  EDD+F+ FC  IGVENIR++E + +   +E D K L+F+ Q  +L  Q +Y +S      L K    +   K  I+K   +   LK   E      +EL  +  + K          E V +++ +  +      +++ KL KEV  I+T L+ +R ++H+L+   K+ D+++ +  GS+               DD+   EMG+E       + I++ EE  + +Y  L   L++L+S+ E+   +  +  +V      + K   PNLRA + L +V ++ +++   FE +R  AR  + +FE+VK+ RYD F  CF  V   ID IYK L RN  AQ S
Sbjct:  768 KIDKVEDDIFQHFCEEIGVENIREFENKHVKRQQEIDQKRLEFEKQKTRLNVQLEYSRSH-----LKKKLNKINTLKETIQKGSEDIDHLKKAEENCLQTVNELMAKQQQLKDIRVTQNSSAEKVQTQIEEERKKFLAVDREVGKLQKEVVSIQTSLEQKRLEKHNLLLDCKVQDIEIILLSGSL---------------DDIIEVEMGTEAESTQATIDIYEKEEAFEIDYSSLKEDLKALQSDQEIEAHLRLLLQQVASQEDILLKTAAPNLRALENLKTVRDKFQESTDAFEASRKEARLCRQEFEQVKKRRYDLFTQCFEHVSISIDQIYKKLCRNNSAQVS 1093          

HSP 2 Score: 75.485 bits (184), Expect = 2.641e-13
Identity = 40/74 (54.05%), Postives = 51/74 (68.92%), Query Frame = 1
Query: 1789 LDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSNLLVSKVYRLDLSQYTDAE 2010
            +D+I   L   N  +V+S+I+E   D+ Q+IVISLKEEFYSRADALIGI    D + + S+V  LDLSQY D E
Sbjct: 1077 IDQIYKKLCRNNSAQVSSYIKEQTQDQFQMIVISLKEEFYSRADALIGIYPEYD-DCMFSRVLTLDLSQYPDTE 1149          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Celegans
Match: him-1 (Structural maintenance of chromosomes protein 1 [Source:UniProtKB/Swiss-Prot;Acc:O01789])

HSP 1 Score: 313.538 bits (802), Expect = 1.840e-92
Identity = 191/497 (38.43%), Postives = 284/497 (57.14%), Query Frame = 1
Query:  565 CNTKMQELQISINNEKLKMDSAEDDVFKEFCNSIGVENIRQYEERELIIARERDLKLLDFKNQLQKLKNQHDYEKSRNTQAILDKYSEAMKNEKLEIEKAEANXXXXXXXXXXXXNRRDELETR------------LAEFKQKCESVDSELADLHRSRNTKQKDIQKLTKEVNQIETRLDSRRADRHSLIQAAKIDDLDLPVKEGSMTIYE-------STLSQNLNSTGDDLDAGEMGSEEMLRIFKAEEKIQFEYKRLDRSLRSLESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSNLLVSKVYRLDLSQY 1998
            C  K++  + ++ + + K +   D +F +FC  +G+ +IR YE RE+ I +E + KL  F + +QKL     YE        +D  +E   N K+E+EK + ++   + +    + +      +            L E K     +++E  ++ +      KD  K  KE+ ++E+ L  ++ +RHSL+ + K+  + LP+K GSM   E        T SQ+  S  D    G   SEE +   + E+ I+  Y  L R  + ++ +  V +    +  E+D++  N+ K+  PNL+A  ++  V+ER  ++  + E+ R +A++ +  FEKVK  RY RF + F+ V + ID IYK L+RN  AQA L   N EEPYLD IQ+ CVAPGKRF+ MD+LSGGEKTIAALALLFA H  NP+PFFVLDEIDAALDNTNIGKVAS+I E A +  QIIVISLKEEFY++AD+LIGI     +    S V   DL+++
Sbjct:  767 CQEKLERSESTLKSLQTKSNEVADRIFADFCTRVGIASIRDYENREMRIKQEMEDKLRSFDDDIQKLA----YE--------IDFVTEQDGNRKVEVEKEKVSQIDRQYKDMKKKEKTAAAALKEHTESMEQDKEVLEEKKALSHKLETEWNEVKKIAQVAMKDFTKAEKELLRLESLLTKKQYERHSLLHSVKLGQIALPLKSGSMADVEYEEDDGDDTASQSSQSATD----GPSVSEEQI---QREQHIKINYDSLPREYKDVDDDDGVRQMSNRLNVEIDELQKNVSKMNAPNLKANQRMAEVKEREAESTEELENARKKAKRIRQQFEKVKTDRYRRFQDFFDPVANTIDDIYKQLSRNTSAQAFLGADNMEEPYLDGIQYNCVAPGKRFRPMDNLSGGEKTIAALALLFAVHGRNPAPFFVLDEIDAALDNTNIGKVASYICESAREHMQIIVISLKEEFYNKADSLIGIF-PYPAACTTSGVLTFDLTRF 1243          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Celegans
Match: him-1 (Structural maintenance of chromosomes protein 1 [Source:UniProtKB/Swiss-Prot;Acc:O01789])

HSP 1 Score: 170.244 bits (430), Expect = 1.658e-49
Identity = 84/121 (69.42%), Postives = 97/121 (80.17%), Query Frame = 1
Query: 1636 EEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSNLLVSKVYRLDLSQY 1998
            EEPYLD IQ+ CVAPGKRF+ MD+LSGGEKTIAALALLFA H  NP+PFFVLDEIDAALDNTNIGKVAS+I E A +  QIIVISLKEEFY++AD+LIGI     +    S V   DL+++
Sbjct:    2 EEPYLDGIQYNCVAPGKRFRPMDNLSGGEKTIAALALLFAVHGRNPAPFFVLDEIDAALDNTNIGKVASYICESAREHMQIIVISLKEEFYNKADSLIGIF-PYPAACTTSGVLTFDLTRF 121          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Celegans
Match: smc-4 (Structural maintenance of chromosomes protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q20060])

HSP 1 Score: 114.775 bits (286), Expect = 6.947e-26
Identity = 54/151 (35.76%), Postives = 92/151 (60.93%), Query Frame = 1
Query: 1483 RKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGI 1935
            RK   + +++K+ R + F + F  +  H+  ++K L    G  A L   + ++P+   I F      K ++ +  LSGGEKT+++LAL+FA H + P+PF+V+DEIDAALD  N+  +A ++R+  ++ AQ I+ISL+   +  A+ L+GI
Sbjct: 1205 RKHNQELQRIKQMRLEEFHSAFEFIGKHLVAVFKMLTD--GGDAKLEYIDKDDPFRQGISFMVRPAKKAWKQIQFLSGGEKTLSSLALIFALHMFRPTPFYVMDEIDAALDYRNVSIIAQYVRQ-KTENAQFIIISLRNNMFELANRLVGI 1352          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Celegans
Match: smc-4 (Structural maintenance of chromosomes protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q20060])

HSP 1 Score: 114.775 bits (286), Expect = 6.947e-26
Identity = 54/151 (35.76%), Postives = 92/151 (60.93%), Query Frame = 1
Query: 1483 RKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGI 1935
            RK   + +++K+ R + F + F  +  H+  ++K L    G  A L   + ++P+   I F      K ++ +  LSGGEKT+++LAL+FA H + P+PF+V+DEIDAALD  N+  +A ++R+  ++ AQ I+ISL+   +  A+ L+GI
Sbjct: 1205 RKHNQELQRIKQMRLEEFHSAFEFIGKHLVAVFKMLTD--GGDAKLEYIDKDDPFRQGISFMVRPAKKAWKQIQFLSGGEKTLSSLALIFALHMFRPTPFYVMDEIDAALDYRNVSIIAQYVRQ-KTENAQFIIISLRNNMFELANRLVGI 1352          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Celegans
Match: dpy-27 (Chromosome condensation protein dpy-27 [Source:UniProtKB/Swiss-Prot;Acc:P48996])

HSP 1 Score: 91.6633 bits (226), Expect = 9.069e-19
Identity = 41/100 (41.00%), Postives = 67/100 (67.00%), Query Frame = 1
Query: 1639 EPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDR-AQIIVISLKEEFYSRADALIGI 1935
            +P+   I+F      K ++ +++LSGGEKT+A+L  +FA H+Y P+P +V+DEIDAALD  N+  +A++I+     R AQ I+ISL+ + +   + L+GI
Sbjct: 1222 DPFDGGIKFSVRPAKKSWKLIENLSGGEKTLASLCFVFAMHHYRPTPLYVMDEIDAALDLNNVSLIANYIKHSERTRNAQFIIISLRNQMFEVGNRLLGI 1321          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Fly
Match: SMC1 (gene:FBgn0040283 transcript:FBtr0084541)

HSP 1 Score: 331.643 bits (849), Expect = 5.314e-99
Identity = 194/488 (39.75%), Postives = 302/488 (61.89%), Query Frame = 1
Query:  574 KMQELQISINNEKLKMDSAEDDVFKEFCNSIGVENIRQYEERELIIARERDLKLLDFKNQLQKLKNQHDYEKSRNTQAILDKYSEAMKNEKLEIEK---AEANXXXXXXXXXXXXNRRDELETRLAEFKQKCESVDSELADLHRSRNTKQKDIQKLTKEVNQI-------ETRLDSRRADRHSLIQAAKIDDLDLPVKEGSMTIYESTLSQNLNSTGDDLDAGEMGSEEMLRIFKAEEKIQFEYKRLDRSLRSLESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSNLLVSKVYRLDLSQYTDA 2007
            +MQ  +  I   K  M++ ED V+  FC  +GV+NIRQYEEREL++ +ER  K  +F+ Q+  + +Q D+EK ++T+  ++++  ++++E+  +E    AEA   K            DE + ++ +FKQ  ++    + D+    +  +KD+  L KE++ +       E+++++++ +R +++  AK D + +P+  GS       L   +  +  D+ +     E +         I+ +Y  L R    L+ ++   K  E +Q ++   +  +++IQTPN++A  KLD+V E+++ T  +FE+ R +A++AK  FE+VK  R  RF+ C   + D IDGIYK LARN  AQA + P N EEPYLD I + CVAPGKRFQ M++LSGGEKTIAALALLF+TH+++P+PFFVLDEIDAALDNTNIGKVAS+IR++ ++  Q IVISLKEEFY  ADAL+GI    + + LVS VY +DL+ + D 
Sbjct:  779 RMQNREEHIQEIKENMNNVEDKVYASFCRRLGVKNIRQYEERELVMQQERARKRAEFEQQIDSINSQLDFEKQKDTKKNVERWERSVQDEEDALEGLKLAEARYLKEI----------DEDKEKMEKFKQDKQAKKQAVDDMEEDISKARKDVANLAKEIHNVGSHLSAVESKIEAKKNERQNILLQAKTDCIVVPLLRGS-------LDDAVRQSDPDVPSTSAAMENI---------IEVDYSSLPREYTKLKDDSAFKKTHEMLQKDLQSKLDVLERIQTPNMKALQKLDAVTEKVQSTNEEFENARKKAKRAKAAFERVKNERSSRFVACCQHISDAIDGIYKKLARNEAAQAYIGPDNPEEPYLDGINYNCVAPGKRFQPMNNLSGGEKTIAALALLFSTHSFHPAPFFVLDEIDAALDNTNIGKVASYIRDHTTN-LQTIVISLKEEFYGHADALVGIT-PGEGDCLVSNVYIMDLTTFEDT 1238          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Fly
Match: glu (gene:FBgn0015391 transcript:FBtr0080935)

HSP 1 Score: 119.013 bits (297), Expect = 3.571e-27
Identity = 56/164 (34.15%), Postives = 98/164 (59.76%), Query Frame = 1
Query: 1459 FEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTD 1950
             ED   +  + +  +E+V++ RY  FM+ F+++   +  +Y+ +    G  A L   +  +P+ + + F    P K ++++ +LSGGEKT+++LAL+FA H Y PSP + +DEIDAALD  N+  V  +I+E   + AQ I++SL+   +  A+ L+GI   +D
Sbjct: 1125 LEDITSKRNEMRDKYEEVRKRRYKEFMDGFSIITRKLKEMYQMITL--GGDAELELVDSMDPFTEGVNFTVRPPKKSWKYISNLSGGEKTLSSLALVFALHYYKPSPLYFMDEIDAALDFKNVSIVGHYIKERTKN-AQFIIVSLRVNMFELANFLVGIYKVSD 1285          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Fly
Match: SMC2 (gene:FBgn0027783 transcript:FBtr0087461)

HSP 1 Score: 86.6557 bits (213), Expect = 4.206e-17
Identity = 88/376 (23.40%), Postives = 177/376 (47.07%), Query Frame = 1
Query:  952 QKCESVDSELADLHRSRNTKQKDIQKLTKEVNQIETRLDSRRADRHSLIQAAKIDDLDLPVKEGSMTIYESTLSQNLNSTGDDLDAGEMGSEEMLRIFKAEEKIQFEYKRLDRSLRSLESEA-EVNKRVEHIQNEVDQMMCNIQKIQTPNLR----------AGDKLDSVEER---------------LRQTETQFEDTRHRARKAKMDFEKVKRCRY-------DRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSNLLVSKVYR 1980
            Q+ E++  E+ +L +S  T +K  Q++   + + +  LD+ + +  S   A+++ +L+  +KE             L     ++    +  E+ML   K  ++I+ E K+ +   + + S+A E  KR+E ++ +   +          N R          AG+KL  ++E+               L + E  F++T  R     MD EK+K+          D+       V  +  GI+ +L   PGA+A L P  H    L  ++ +    G   + +  LSGG+K++ AL+L+ A   ++P+P ++LDE+DAALD ++   + S ++++ ++ +Q +++SLK+  ++ A+ L   +     + +  +V R
Sbjct:  815 QEFETLQLEITELQKSIETAKKQHQEMIDNLEKFKAELDALKVNSSSA--ASEVTELEQAIKEQK---------DKLRDQNKEMRNQLVKKEKML---KENQEIELEVKKKENEQKKISSDAKEAKKRMEALEAKYPWIPEEKNCFGMKNTRYDYSKEDPHEAGNKLAKMQEKKDKMERTLNMNAIMVLDREEENFKETERRRNIVAMDKEKIKKIIVKMDEEEQDQLNKAATEVNTNFSGIFSSLL--PGAEAKLNPV-HTNGCLTGLEIKVGFNGIWKESLGELSGGQKSLVALSLVLAMLKFSPAPLYILDEVDAALDMSHTQNIGSMLKQHFTN-SQFLIVSLKDGLFNHANVLFRTLFEEGVSTITRQVSR 1172          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Fly
Match: SMC3 (gene:FBgn0015615 transcript:FBtr0074290)

HSP 1 Score: 71.2478 bits (173), Expect = 2.511e-12
Identity = 33/79 (41.77%), Postives = 48/79 (60.76%), Query Frame = 1
Query: 1699 MDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGI 1935
            M+ LSGG+K++ ALAL+F+    +P+PF++ DEID ALD  +   VA+ I E  SD AQ I  + + E    A    G+
Sbjct: 1095 MNQLSGGQKSLVALALIFSIQKCDPAPFYLFDEIDQALDAMHRKAVANMIHEL-SDTAQFITTTFRPELLENAHKFYGV 1172          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Zebrafish
Match: smc1a (structural maintenance of chromosomes 1A [Source:ZFIN;Acc:ZDB-GENE-090506-9])

HSP 1 Score: 345.895 bits (886), Expect = 3.896e-104
Identity = 202/475 (42.53%), Postives = 299/475 (62.95%), Query Frame = 1
Query:  616 KMDSAEDDVFKEFCNSIGVENIRQYEERELIIARERDLKLLDFKNQLQKLKNQHDYEKS--RNTQAILDKYSEAMKNEKLEIEKAEANXXXXXXXXXXXXNRRDELETRLAEFKQKCESVDSELADLHRSRNTKQKDIQKLTKEVNQIETRLDSRRADRHSLIQAAKIDDLDLPVKEGSMTIYESTLSQNLNSTGDDLDAGEMGS--EEMLRIFKA-------EEKIQFEYKRLDRSLRSLESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSNLLVSKVYRLDLSQYTDA 2007
            +M+  ED+VF EFC  IGV NIR++EE ++    E   K L+F+ Q  +L  Q DYEK+  +  Q  +  + + +K ++ EIE+ +  E +    ++    +  +L+ +    K +    + E+ ++ +   +  K++ +L KEV  IET+L+ +R+DRH+L+QA K+ D+ LP+K G+M               DD+  GE GS  E+ +   KA       E  I+ +Y  L+  L+   SE E+   +  +Q  +++    +Q+I  PN++A +KL+SV ++ ++T  +FE  R RA+KAK  FE++K+ R+DRF  CF  V  +ID IYK L+RN  AQA L P N EEPYLD I + CVAPGKRF+ MD+LSGGEKT+AALALLFA H+Y P+PFFVLDEIDAALDNTNIGKVA++I++ +    Q IVISLKEEFY++AD+LIG+ +    + ++SKV   DLSQY DA
Sbjct:  768 RMNLVEDEVFFEFCKEIGVRNIREFEEEKVKRQNEIAKKRLEFETQKTRLAIQLDYEKNQLKEDQEKVMMWEQTVKKDENEIERLKKEEHRHMKIIDETMAQLQDLKNQHLTKKGEVNDKNREMEEIRKKLGSANKELTQLQKEVTAIETKLEQKRSDRHNLLQACKMQDIKLPLKSGTM---------------DDISQGEGGSQVEDAISSPKASSSVHAKEALIEIDYSNLNEDLKDALSEDEIKGEMNTLQQRLNEQQSILQRISAPNMKAMEKLESVRDKFQETSDEFEAARKRAKKAKQAFEQIKKERFDRFNACFESVATNIDEIYKALSRNSSAQAFLGPENPEEPYLDGINYNCVAPGKRFRPMDNLSGGEKTVAALALLFAIHSYKPAPFFVLDEIDAALDNTNIGKVANYIKDQSVQNFQAIVISLKEEFYTKADSLIGV-YPEQGDCVISKVLTFDLSQYPDA 1226          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Zebrafish
Match: smc1al (structural maintenance of chromosomes 1A, like [Source:ZFIN;Acc:ZDB-GENE-040426-57])

HSP 1 Score: 338.576 bits (867), Expect = 1.623e-101
Identity = 194/466 (41.63%), Postives = 294/466 (63.09%), Query Frame = 1
Query:  616 KMDSAEDDVFKEFCNSIGVENIRQYEERELIIARERDLKLLDFKNQLQKLKNQHDYEKS--RNTQAILDKYSEAMKNEKLEIEKAEANXXXXXXXXXXXXNRRDELETRLAEFKQKCESVDSELADLHRSRNTKQKDIQKLTKEVNQIETRLDSRRADRHSLIQAAKIDDLDLPVKEGSMTIYESTLSQNLNSTGDDLDAGEMGSEEMLRIFKAEEKIQFEYKRLDRSLRSLESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSNLLVSKVYRLDLSQYTDA 2007
            +M+  ED+VF EFC  IGV NIR++EE ++    E   K L+F+ Q  +L  Q DYEK+  +  Q  +  + + +K ++ EIEK +  E +    ++    +  +L+ +    K +    + E+ ++ +      K++ +L KEV  IET+L+ +R+DRH+L+QA K+ D+ LP++ G+M   +    +  NS  ++  +    +     +   E  I+ +Y  L   L+   S+ E+   +  +Q  +++    +Q+I  PN++A +KL+SV ++ ++T  +FE  R RA+KAK  FE++K+ R+DRF  CF  V  +ID IYK L+RN  AQA L P N EEPYLD I + CVAPGKRF+ MD+LSGGEKT+AALALLFA H+Y P+PFFVLDEIDAALDNTNIGKVA++I++ +    Q IVISLKEEFY++AD+LIG+ +    + ++SKV   DLSQY DA
Sbjct:  768 RMNVVEDEVFVEFCKEIGVRNIREFEEEKVKRQNEIAKKRLEFETQKTRLAIQLDYEKNQLKEDQEKVVMWEQTVKKDENEIEKLKKEEQRNMKIIDETMAQLQDLKNQHLTKKSEVNDKNHEMEEIRKKLGGANKELTQLQKEVTAIETKLEQKRSDRHNLLQACKMQDIKLPLRSGTM---DDISQEEGNSQAEESLSSSQKTSST--VLAKEALIEIDYNSLSEDLKDSLSDEEIKAEMNTLQQRLNEQQSILQRISAPNMKAMEKLESVRDKFQETSDEFEAARKRAKKAKQAFEQIKKERFDRFHACFESVATNIDEIYKALSRNSSAQAFLGPENPEEPYLDGINYNCVAPGKRFRPMDNLSGGEKTVAALALLFAIHSYKPAPFFVLDEIDAALDNTNIGKVANYIKDQSVQNFQAIVISLKEEFYTKADSLIGV-YPEQGDCVISKVLTFDLSQYADA 1227          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Zebrafish
Match: smc1al (structural maintenance of chromosomes 1A, like [Source:ZFIN;Acc:ZDB-GENE-040426-57])

HSP 1 Score: 338.576 bits (867), Expect = 2.153e-101
Identity = 194/466 (41.63%), Postives = 294/466 (63.09%), Query Frame = 1
Query:  616 KMDSAEDDVFKEFCNSIGVENIRQYEERELIIARERDLKLLDFKNQLQKLKNQHDYEKS--RNTQAILDKYSEAMKNEKLEIEKAEANXXXXXXXXXXXXNRRDELETRLAEFKQKCESVDSELADLHRSRNTKQKDIQKLTKEVNQIETRLDSRRADRHSLIQAAKIDDLDLPVKEGSMTIYESTLSQNLNSTGDDLDAGEMGSEEMLRIFKAEEKIQFEYKRLDRSLRSLESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSNLLVSKVYRLDLSQYTDA 2007
            +M+  ED+VF EFC  IGV NIR++EE ++    E   K L+F+ Q  +L  Q DYEK+  +  Q  +  + + +K ++ EIEK +  E +    ++    +  +L+ +    K +    + E+ ++ +      K++ +L KEV  IET+L+ +R+DRH+L+QA K+ D+ LP++ G+M   +    +  NS  ++  +    +     +   E  I+ +Y  L   L+   S+ E+   +  +Q  +++    +Q+I  PN++A +KL+SV ++ ++T  +FE  R RA+KAK  FE++K+ R+DRF  CF  V  +ID IYK L+RN  AQA L P N EEPYLD I + CVAPGKRF+ MD+LSGGEKT+AALALLFA H+Y P+PFFVLDEIDAALDNTNIGKVA++I++ +    Q IVISLKEEFY++AD+LIG+ +    + ++SKV   DLSQY DA
Sbjct:  786 RMNVVEDEVFVEFCKEIGVRNIREFEEEKVKRQNEIAKKRLEFETQKTRLAIQLDYEKNQLKEDQEKVVMWEQTVKKDENEIEKLKKEEQRNMKIIDETMAQLQDLKNQHLTKKSEVNDKNHEMEEIRKKLGGANKELTQLQKEVTAIETKLEQKRSDRHNLLQACKMQDIKLPLRSGTM---DDISQEEGNSQAEESLSSSQKTSST--VLAKEALIEIDYNSLSEDLKDSLSDEEIKAEMNTLQQRLNEQQSILQRISAPNMKAMEKLESVRDKFQETSDEFEAARKRAKKAKQAFEQIKKERFDRFHACFESVATNIDEIYKALSRNSSAQAFLGPENPEEPYLDGINYNCVAPGKRFRPMDNLSGGEKTVAALALLFAIHSYKPAPFFVLDEIDAALDNTNIGKVANYIKDQSVQNFQAIVISLKEEFYTKADSLIGV-YPEQGDCVISKVLTFDLSQYADA 1245          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Zebrafish
Match: smc1b (structural maintenance of chromosomes 1B [Source:ZFIN;Acc:ZDB-GENE-091217-1])

HSP 1 Score: 285.804 bits (730), Expect = 1.674e-82
Identity = 179/467 (38.33%), Postives = 261/467 (55.89%), Query Frame = 1
Query:  616 KMDSAEDDVFKEFCNSIGVENIRQYEERELIIARERDLKLLDFKNQLQKLKNQHDYEKSRNTQAI--LDKYSEAMKNEKLEIEKAEANXXXXXXXXXXXXNRRDELETRLAEFKQKCESVDSELADLHRSRNTKQKDIQKLTKEVNQIETRLDSRRADRHSLIQAAKIDDLDLPVKEGSMTIYESTLSQNLNSTGDDLDAGEMGSEE----MLRIFKAEEKIQFEYKRLDRSLRSLESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSNLLVSKVYRLDLSQY 1998
            K+   ED VF +FC  IGV NIR+YE+  L + +E + K L F++Q  +L  Q +YE+++  + +  + K  E ++ EK  I   +  E  +   +E  ++   +L  + +E      +  +EL         + K + KL K+    +  L+  R  +H+L+   KID L L +  G++               DD+   ++ SE      L IF+ E ++ F++  LD SL+ L  E+EV   +E ++  V  +   I   + PNL+A +K+  V++  R+    F+ +    +K   +FE+VK  R+  F  CF  V   ID IYK L RN  AQA L   N  EPYLD I + CVAPGKRF  MD+LSGGEK IAALAL+FA H++ P+PFFVLDE+DAALDNTNIGKV  F R  + +  QIIVISLKEEFYSRADAL+G+    D   + S++  LDL+ Y
Sbjct:  770 KIHQMEDLVFADFCAEIGVANIREYEQDYLRLQQELEKKRLQFESQQTRLSTQLEYEQAQLEKLVKLMKKIEETIEKEKNIIISLKEGEDNILIAVEQTQSNLLKLNNQHSEKTHLVNNAKTELDKALTGLQERNKVLMKLQKQTISTDAALEHLRLTKHNLLLTCKIDGLPLTLISGAL---------------DDISEIQLDSESQSVSTLDIFEREAQMVFDFSALDNSLKMLTEESEVEAMLEKLKEGVSSLESMIMMSRAPNLKALEKIREVKDSYREVLDAFDISTITTKKRNQEFEQVKAKRFHLFSQCFEHVSVVIDQIYKKLCRNASAQAILSAENPNEPYLDGINYNCVAPGKRFMAMDNLSGGEKAIAALALVFAIHSFRPAPFFVLDEVDAALDNTNIGKVTGFFRMMSRESCQIIVISLKEEFYSRADALLGVYSMFDE-CMFSRLLTLDLTPY 1220          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Zebrafish
Match: smc4 (structural maintenance of chromosomes 4 [Source:ZFIN;Acc:ZDB-GENE-020419-21])

HSP 1 Score: 117.857 bits (294), Expect = 1.147e-26
Identity = 68/194 (35.05%), Postives = 106/194 (54.64%), Query Frame = 1
Query: 1393 PNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGI--MHTTDSNLLVS 1968
            PNL A  +    EE   Q   + +D   +    K   E +++ R   FM  FN++ + +   Y+ L    G  A L   +  +P+ + I F    P K ++ + +LSGGEKT+++LAL+FA H++ P+P + +DEIDAALD  N+  VA +I E   + AQ I+ISL+   +  AD LIGI   H T  N+ ++
Sbjct: 1087 PNLGAIAEFKKKEELYLQRVAELDDITTQRDSFKRGCEDLRKQRLHEFMAGFNIITNKLKENYQMLTL--GGDAELELVDSLDPFSEGIMFSVRPPKKSWKKIYNLSGGEKTLSSLALVFALHHFKPTPLYFMDEIDAALDFKNVSIVACYIYEQTKN-AQFIIISLRNNMFEMADRLIGIYKTHNTTKNVAIN 1277          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Xenopus
Match: sia1 (siamois homeodomain 1 [Source:Xenbase;Acc:XB-GENE-482368])

HSP 1 Score: 340.887 bits (873), Expect = 2.881e-102
Identity = 195/477 (40.88%), Postives = 296/477 (62.05%), Query Frame = 1
Query:  610 KLKMDSAEDDVFKEFCNSIGVENIRQYEERELIIARERDLKLLDFKNQLQKLKNQHDYEKS--RNTQAILDKYSEAMKNEKLEIEKAEANXXXXXXXXXXXXNRRDELETRLAEFKQKCESVDSELADLHRSRNTKQKDIQKLTKEVNQIETRLDSRRADRHSLIQAAKIDDLDLPVKEGSMTIYESTLSQNLNSTGDDLDAGEMGSE---------EMLRIFKAEEKIQFEYKRLDRSLRSLESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSNLLVSKVYRLDLSQYTDA 2007
            K KM+  ED+VF+EFC  IGV NIR++EE ++    E   K L+F+NQ  +L  Q DYEK+  +  Q  +  + +++K +  EIEK +  E +    ++    +  +L+ +    K +    +  + D+ +   +  K++  L KEV  IET+L+ +R+DRH+L+QA K+ D+ LP+ +G+M               DD+   E GS+             ++  E  ++ +Y  L   L+   ++ ++ + +  +  ++++    +Q+I  PN++A +KL+SV ++ ++T  +FE  R RA+KAK  FE+ K+ R+DRF  CF  V  +ID IYK L+RN  AQA L P N EEPYLD I + CVAPGKRF+ MD+LSGGEKT+AALALLFA H+Y PSPFFVLDEIDAALDNTNIGKVA++I+E +    Q IVISLKEEFY++A++LIG+ +    + ++SKV   DL++Y DA
Sbjct:  749 KEKMNQVEDEVFEEFCREIGVRNIREFEEEKVKRQNEIAKKRLEFENQKTRLGIQLDYEKNQLKEDQGKVQTWEQSVKKDDNEIEKLKKEEQRHMKIIDETMAQLQDLKNQHLAKKSEVNDKNHLMEDIRKKLGSANKEVTHLQKEVTAIETKLEQKRSDRHNLLQACKMQDIKLPLSKGTM---------------DDISQEEGGSQGEESVSSSQRSSTVYAKEALLEIDYSDLSEDLKDAVADDDIKQEMSALHQKLNEQQSILQRIAAPNMKAMEKLESVRDKFQETSDEFEAARKRAKKAKQAFEQTKKERFDRFNACFESVATNIDEIYKALSRNSSAQAFLGPENPEEPYLDGINYNCVAPGKRFRPMDNLSGGEKTVAALALLFAIHSYKPSPFFVLDEIDAALDNTNIGKVANYIKEQSMSNFQAIVISLKEEFYTKAESLIGV-YPEQGDCVISKVLTFDLTKYPDA 1209          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Xenopus
Match: sia1 (siamois homeodomain 1 [Source:Xenbase;Acc:XB-GENE-482368])

HSP 1 Score: 340.887 bits (873), Expect = 3.637e-102
Identity = 195/477 (40.88%), Postives = 296/477 (62.05%), Query Frame = 1
Query:  610 KLKMDSAEDDVFKEFCNSIGVENIRQYEERELIIARERDLKLLDFKNQLQKLKNQHDYEKS--RNTQAILDKYSEAMKNEKLEIEKAEANXXXXXXXXXXXXNRRDELETRLAEFKQKCESVDSELADLHRSRNTKQKDIQKLTKEVNQIETRLDSRRADRHSLIQAAKIDDLDLPVKEGSMTIYESTLSQNLNSTGDDLDAGEMGSE---------EMLRIFKAEEKIQFEYKRLDRSLRSLESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSNLLVSKVYRLDLSQYTDA 2007
            K KM+  ED+VF+EFC  IGV NIR++EE ++    E   K L+F+NQ  +L  Q DYEK+  +  Q  +  + +++K +  EIEK +  E +    ++    +  +L+ +    K +    +  + D+ +   +  K++  L KEV  IET+L+ +R+DRH+L+QA K+ D+ LP+ +G+M               DD+   E GS+             ++  E  ++ +Y  L   L+   ++ ++ + +  +  ++++    +Q+I  PN++A +KL+SV ++ ++T  +FE  R RA+KAK  FE+ K+ R+DRF  CF  V  +ID IYK L+RN  AQA L P N EEPYLD I + CVAPGKRF+ MD+LSGGEKT+AALALLFA H+Y PSPFFVLDEIDAALDNTNIGKVA++I+E +    Q IVISLKEEFY++A++LIG+ +    + ++SKV   DL++Y DA
Sbjct:  762 KEKMNQVEDEVFEEFCREIGVRNIREFEEEKVKRQNEIAKKRLEFENQKTRLGIQLDYEKNQLKEDQGKVQTWEQSVKKDDNEIEKLKKEEQRHMKIIDETMAQLQDLKNQHLAKKSEVNDKNHLMEDIRKKLGSANKEVTHLQKEVTAIETKLEQKRSDRHNLLQACKMQDIKLPLSKGTM---------------DDISQEEGGSQGEESVSSSQRSSTVYAKEALLEIDYSDLSEDLKDAVADDDIKQEMSALHQKLNEQQSILQRIAAPNMKAMEKLESVRDKFQETSDEFEAARKRAKKAKQAFEQTKKERFDRFNACFESVATNIDEIYKALSRNSSAQAFLGPENPEEPYLDGINYNCVAPGKRFRPMDNLSGGEKTVAALALLFAIHSYKPSPFFVLDEIDAALDNTNIGKVANYIKEQSMSNFQAIVISLKEEFYTKAESLIGV-YPEQGDCVISKVLTFDLTKYPDA 1222          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Xenopus
Match: sia1 (siamois homeodomain 1 [Source:Xenbase;Acc:XB-GENE-482368])

HSP 1 Score: 330.487 bits (846), Expect = 1.327e-98
Identity = 194/471 (41.19%), Postives = 290/471 (61.57%), Query Frame = 1
Query:  610 KLKMDSAEDDVFKEFCNSIGVENIRQYEERELIIARERDLKLLDFKNQLQKLKNQHDYEKS--RNTQAILDKYSEAMKNEKLEIEKAEANXXXXXXXXXXXXNRRDELETRLAEFKQKCESVDSELADLHRSRNTKQKDIQKLTKEVNQIETRLDSRRADRHSLIQAAKIDDLDLPVKEGSMTIYESTLSQNLNSTGDDLDAGEMGSEEMLR---IFKAEEKIQFEYKRLDRSLRSLESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSNLLVSKVYRLDLSQYTDA 2007
            K KM+  ED+VF+EFC  IGV NIR++EE ++    E   K L+F+NQ  +L  Q DYEK+  +  Q  +  + +++K +  EIEK +  E +    ++    +  +L+ +    K +    +  + D+ +   +  K++  L KEV  IET+L+ +R+DRH+L+QA K+ D+ LP+ +G+M               DD+   E       R   ++  E  ++ +Y  L   L+ + +          +  ++++    +Q+I  PN++A +KL+SV ++ ++T  +FE  R RA+KAK  FE+ K+ R+DRF  CF  V  +ID IYK L+RN  AQA L P N EEPYLD I + CVAPGKRF+ MD+LSGGEKT+AALALLFA H+Y PSPFFVLDEIDAALDNTNIGKVA++I+E +    Q IVISLKEEFY++A++LIG+ +    + ++SKV   DL++Y DA
Sbjct:  753 KEKMNQVEDEVFEEFCREIGVRNIREFEEEKVKRQNEIAKKRLEFENQKTRLGIQLDYEKNQLKEDQGKVQTWEQSVKKDDNEIEKLKKEEQRHMKIIDETMAQLQDLKNQHLAKKSEVNDKNHLMEDIRKKLGSANKEVTHLQKEVTAIETKLEQKRSDRHNLLQACKMQDIKLPLSKGTM---------------DDISQEEESVSSSQRSSTVYAKEALLEIDYSDLSEDLKEMSA----------LHQKLNEQQSILQRIAAPNMKAMEKLESVRDKFQETSDEFEAARKRAKKAKQAFEQTKKERFDRFNACFESVATNIDEIYKALSRNSSAQAFLGPENPEEPYLDGINYNCVAPGKRFRPMDNLSGGEKTVAALALLFAIHSYKPSPFFVLDEIDAALDNTNIGKVANYIKEQSMSNFQAIVISLKEEFYTKAESLIGV-YPEQGDCVISKVLTFDLTKYPDA 1197          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Xenopus
Match: sia1 (siamois homeodomain 1 [Source:Xenbase;Acc:XB-GENE-482368])

HSP 1 Score: 327.405 bits (838), Expect = 2.184e-97
Identity = 191/477 (40.04%), Postives = 292/477 (61.22%), Query Frame = 1
Query:  610 KLKMDSAEDDVFKEFCNSIGVENIRQYEERELIIARERDLKLLDFKNQLQKLKNQHDYEKS--RNTQAILDKYSEAMKNEKLEIEKAEANXXXXXXXXXXXXNRRDELETRLAEFKQKCESVDSELADLHRSRNTKQKDIQKLTKEVNQIETRLDSRRADRHSLIQAAKIDDLDLPVKEGSMTIYESTLSQNLNSTGDDLDAGEMGSE---------EMLRIFKAEEKIQFEYKRLDRSLRSLESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSNLLVSKVYRLDLSQYTDA 2007
            K KM+  ED+VF+EFC  IGV NIR++EE ++    E   K L+F+NQ  +L  Q DYEK+  +  Q  +  + +++K +  EIEK +  E +    ++    +  +L+ +    K +    +  + D+ +   +  K++  L KEV  IET+L+ +R+DRH+L+QA K+ D+ LP+ +G+M               DD+   E GS+             ++  E  ++ +Y  L   L+   ++ ++ + +  +  ++++    +Q+I  PN++A +KL+SV ++ ++T  +FE  R RA+KAK  FE+ K+ R+DRF  CF  V  +ID IYK L+RN  AQA L P N EEPYLD I + CVAPGKRF+ MD+LSGGEKT+AALALLFA H+Y PSPFFVLDEIDAALDNTNIGK  S++  ++      IVISLKEEFY++A++LIG+ +    + ++SKV   DL++Y DA
Sbjct:  734 KEKMNQVEDEVFEEFCREIGVRNIREFEEEKVKRQNEIAKKRLEFENQKTRLGIQLDYEKNQLKEDQGKVQTWEQSVKKDDNEIEKLKKEEQRHMKIIDETMAQLQDLKNQHLAKKSEVNDKNHLMEDIRKKLGSANKEVTHLQKEVTAIETKLEQKRSDRHNLLQACKMQDIKLPLSKGTM---------------DDISQEEGGSQGEESVSSSQRSSTVYAKEALLEIDYSDLSEDLKDAVADDDIKQEMSALHQKLNEQQSILQRIAAPNMKAMEKLESVRDKFQETSDEFEAARKRAKKAKQAFEQTKKERFDRFNACFESVATNIDEIYKALSRNSSAQAFLGPENPEEPYLDGINYNCVAPGKRFRPMDNLSGGEKTVAALALLFAIHSYKPSPFFVLDEIDAALDNTNIGKEFSYMNIFSFS----IVISLKEEFYTKAESLIGV-YPEQGDCVISKVLTFDLTKYPDA 1190          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Xenopus
Match: sia1 (siamois homeodomain 1 [Source:Xenbase;Acc:XB-GENE-482368])

HSP 1 Score: 327.02 bits (837), Expect = 4.309e-97
Identity = 191/477 (40.04%), Postives = 292/477 (61.22%), Query Frame = 1
Query:  610 KLKMDSAEDDVFKEFCNSIGVENIRQYEERELIIARERDLKLLDFKNQLQKLKNQHDYEKS--RNTQAILDKYSEAMKNEKLEIEKAEANXXXXXXXXXXXXNRRDELETRLAEFKQKCESVDSELADLHRSRNTKQKDIQKLTKEVNQIETRLDSRRADRHSLIQAAKIDDLDLPVKEGSMTIYESTLSQNLNSTGDDLDAGEMGSE---------EMLRIFKAEEKIQFEYKRLDRSLRSLESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSNLLVSKVYRLDLSQYTDA 2007
            K KM+  ED+VF+EFC  IGV NIR++EE ++    E   K L+F+NQ  +L  Q DYEK+  +  Q  +  + +++K +  EIEK +  E +    ++    +  +L+ +    K +    +  + D+ +   +  K++  L KEV  IET+L+ +R+DRH+L+QA K+ D+ LP+ +G+M               DD+   E GS+             ++  E  ++ +Y  L   L+   ++ ++ + +  +  ++++    +Q+I  PN++A +KL+SV ++ ++T  +FE  R RA+KAK  FE+ K+ R+DRF  CF  V  +ID IYK L+RN  AQA L P N EEPYLD I + CVAPGKRF+ MD+LSGGEKT+AALALLFA H+Y PSPFFVLDEIDAALDNTNIGK  S++  ++      IVISLKEEFY++A++LIG+ +    + ++SKV   DL++Y DA
Sbjct:  766 KEKMNQVEDEVFEEFCREIGVRNIREFEEEKVKRQNEIAKKRLEFENQKTRLGIQLDYEKNQLKEDQGKVQTWEQSVKKDDNEIEKLKKEEQRHMKIIDETMAQLQDLKNQHLAKKSEVNDKNHLMEDIRKKLGSANKEVTHLQKEVTAIETKLEQKRSDRHNLLQACKMQDIKLPLSKGTM---------------DDISQEEGGSQGEESVSSSQRSSTVYAKEALLEIDYSDLSEDLKDAVADDDIKQEMSALHQKLNEQQSILQRIAAPNMKAMEKLESVRDKFQETSDEFEAARKRAKKAKQAFEQTKKERFDRFNACFESVATNIDEIYKALSRNSSAQAFLGPENPEEPYLDGINYNCVAPGKRFRPMDNLSGGEKTVAALALLFAIHSYKPSPFFVLDEIDAALDNTNIGKEFSYMNIFSFS----IVISLKEEFYTKAESLIGV-YPEQGDCVISKVLTFDLTKYPDA 1222          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Mouse
Match: Smc1a (structural maintenance of chromosomes 1A [Source:MGI Symbol;Acc:MGI:1344345])

HSP 1 Score: 348.591 bits (893), Expect = 4.764e-105
Identity = 198/468 (42.31%), Postives = 302/468 (64.53%), Query Frame = 1
Query:  610 KLKMDSAEDDVFKEFCNSIGVENIRQYEERELIIARERDLKLLDFKNQLQKLKNQHDYEKS--RNTQAILDKYSEAMKNEKLEIEKAEANXXXXXXXXXXXXNRRDELETRLAEFKQKCESVDSELADLHRSRNTKQKDIQKLTKEVNQIETRLDSRRADRHSLIQAAKIDDLDLPVKEGSMTIYESTLSQNLNSTGDDLDAGEMGSEEMLRIFKAEEKIQFEYKRLDRSLRSLESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSNLLVSKVYRLDLSQYTDA 2007
            K KM+  ED+VF+EFC  IGV NIR++EE ++    E   K L+F+NQ  +L  Q D+EK+  +  Q  +  + + +K ++ EIEK +  E +    ++    +  +L+ +    K +    + E+ ++ +      K++  L KEV  IET+L+ +R+DRH+L+QA K+ D+ LP+ +G+M      +SQ   S+  +      GS+    I+  E  I+ +Y  L   L+  ++E E+ + +  +Q ++++    +Q+I  PN++A +KL+SV ++ ++T  +FE  R RA+KAK  FE++K+ R+DRF  CF  V  +ID IYK L+RN  AQA L P N EEPYLD I + CVAPGKRF+ MD+LSGGEKT+AALALLFA H+Y P+PFFVLDEIDAALDNTNIGKVA++I+E ++   Q IVISLKEEFY++A++LIG+ +    + ++SKV   DL++Y DA
Sbjct:  766 KEKMNQVEDEVFEEFCREIGVRNIREFEEEKVKRQNEIAKKRLEFENQKTRLGIQLDFEKNQLKEDQDKVHMWEQTVKKDENEIEKLKKEEQRHMKIIDETMAQLQDLKNQHLAKKSEVNDKNHEMEEIRKKLGGANKEMTHLQKEVTAIETKLEQKRSDRHNLLQACKMQDIKLPLSKGTM----DDISQEEGSSQGEESVS--GSQRTSSIYAREALIEIDYGDLCEDLKDAQAEEEIKQEMNTLQQKLNEQQSVLQRIAAPNMKAMEKLESVRDKFQETSDEFEAARKRAKKAKQAFEQIKKERFDRFNACFESVATNIDEIYKALSRNSSAQAFLGPENPEEPYLDGINYNCVAPGKRFRPMDNLSGGEKTVAALALLFAIHSYKPAPFFVLDEIDAALDNTNIGKVANYIKEQSTCNFQAIVISLKEEFYTKAESLIGV-YPEQGDCVISKVLTFDLTKYPDA 1226          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Mouse
Match: Smc1b (structural maintenance of chromosomes 1B [Source:MGI Symbol;Acc:MGI:2154049])

HSP 1 Score: 317.775 bits (813), Expect = 7.763e-94
Identity = 183/471 (38.85%), Postives = 284/471 (60.30%), Query Frame = 1
Query:  616 KMDSAEDDVFKEFCNSIGVENIRQYEERELIIARERDLKLLDFKNQLQKLKNQHDYEKSRNTQAI--LDKYSEAMKNEKLEIEKAEANXXXXXXXXXXXXNRRDELETRLAEFKQKCESVDSELADLHRSRNTKQKDIQKLTKEVNQIETRLDSRRADRHSLIQAAKIDDLDLPVKEGSM---TIYESTLSQNLNSTGDDLDAGEMGSEEMLRIFKAEEKIQFEYKRLDRSLRSLESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSNLLVSKVYRLDLSQYTDAEE 2013
            K+D  EDD+F++FC  IGVENIR++E + +   +E D K L+F+ Q  +L  Q +Y +++  + +  +D     ++  K +I+  +  E +    +E L  ++++++  LA      E +  ++ +  +      +++ KL KEV  I+  L+ +  ++H+L+   K+ D+D+ +  GS+      E T +++  +T D              I++ E  IQ +Y  L   L++L+S+ EV   +  +  +V      + K   PNLRA + L +V ++ +++   FE +R  AR  + +FE+VKR RYD F  CF  +   ID IYK L RN  AQA L P N EEPYLD I + CVAPGKRF  MD+LSGGEK +AALALLFA H++ P+PFFVLDE+DAALDNTNIGKV+S+I+E + ++ Q+I+ISLKEEFYS+ADALIG+ +   +  + S V  LDLS+Y D E+
Sbjct:  768 KIDEVEDDIFQDFCEEIGVENIREFENKHVKQQQENDQKRLEFEKQKTRLNIQLEYSRNQLKKKLNNIDTLKTTIQKGKEDIDNLKKTEEECLKIVEELMVKQEQIKEVLATQSSNIEKIHIQIEEERKKVLAVDREVGKLQKEVVIIQGSLEQKLLEKHNLLLDCKVQDIDISLVLGSLEDIIEMELTETESTQATAD--------------IYEKEASIQIDYSPLREDLKALQSDKEVEAHLTLLLQQVASQENTLLKTTAPNLRAQENLKTVRDKFQESADVFEASRKEARICRQEFEQVKRRRYDAFSQCFEHISVSIDQIYKKLCRNNSAQAFLSPENPEEPYLDGISYNCVAPGKRFMPMDNLSGGEKCVAALALLFAVHSFRPAPFFVLDEVDAALDNTNIGKVSSYIKEQSQEQFQMIIISLKEEFYSKADALIGV-YPEHNECMFSHVLTLDLSKYPDTED 1223          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Mouse
Match: Smc4 (structural maintenance of chromosomes 4 [Source:MGI Symbol;Acc:MGI:1917349])

HSP 1 Score: 115.161 bits (287), Expect = 9.271e-26
Identity = 72/221 (32.58%), Postives = 118/221 (53.39%), Query Frame = 1
Query: 1306 ESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSNLLVS 1968
            + E E  K  E I NE+  +    ++++ PNL A  +    E+   Q   + +         +  +E +++ R + FM  F V+ + +   Y+ L    G  A L   +  +P+ + I F    P K ++ + +LSGGEKT+++LAL+FA H+Y P+P + +DEIDAALD  N+  VA +I E   + AQ I+ISL+   +  +D LIGI  T +S   V+
Sbjct: 1033 QEELEAIKNPESITNEIALLEAQCREMK-PNLGAIAEYKKKEDLYLQRVAELDKITSERDNFRQAYEDLRKQRLNEFMAGFYVITNKLKENYQMLTL--GGDAELELVDSLDPFSEGIMFSVRPPKKSWKKIFNLSGGEKTLSSLALVFALHHYKPTPLYFMDEIDAALDFKNVSIVAFYIYEQTKN-AQFIIISLRNNMFEISDRLIGIYKTYNSTKSVA 1249          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Mouse
Match: Smc4 (structural maintenance of chromosomes 4 [Source:MGI Symbol;Acc:MGI:1917349])

HSP 1 Score: 114.775 bits (286), Expect = 1.040e-25
Identity = 72/221 (32.58%), Postives = 118/221 (53.39%), Query Frame = 1
Query: 1306 ESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSNLLVS 1968
            + E E  K  E I NE+  +    ++++ PNL A  +    E+   Q   + +         +  +E +++ R + FM  F V+ + +   Y+ L    G  A L   +  +P+ + I F    P K ++ + +LSGGEKT+++LAL+FA H+Y P+P + +DEIDAALD  N+  VA +I E   + AQ I+ISL+   +  +D LIGI  T +S   V+
Sbjct: 1058 QEELEAIKNPESITNEIALLEAQCREMK-PNLGAIAEYKKKEDLYLQRVAELDKITSERDNFRQAYEDLRKQRLNEFMAGFYVITNKLKENYQMLTL--GGDAELELVDSLDPFSEGIMFSVRPPKKSWKKIFNLSGGEKTLSSLALVFALHHYKPTPLYFMDEIDAALDFKNVSIVAFYIYEQTKN-AQFIIISLRNNMFEISDRLIGIYKTYNSTKSVA 1274          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Mouse
Match: Smc2 (structural maintenance of chromosomes 2 [Source:MGI Symbol;Acc:MGI:106067])

HSP 1 Score: 79.337 bits (194), Expect = 1.161e-14
Identity = 62/233 (26.61%), Postives = 110/233 (47.21%), Query Frame = 1
Query: 1318 EVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYD---RFMNCFNVVVDHID----GIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSNLLVSKVYRLDLSQ 1995
            E  +R++ +Q   +++  N+      NLRA + L   EER       + D   + R  + D  K+     D   +     N+    ++     I+  L   PGA A L P   +   LD ++F+        +++  LSGG++++ AL+L+ +   + P+P ++LDE+DAALD ++   +   +R + +  +Q IV+SLKE  ++ A+ L            VS V R   SQ
Sbjct:  964 EAGQRLQKLQEVKEKLGRNV------NLRAMNVLTEAEER-------YNDLMKKKRIVENDKSKILATIEDLDQKKNQALNIAWQKVNKDFGSIFSTLL--PGANAMLAPPEGQ-TVLDGLEFKVALGNTWKENLTELSGGQRSLVALSLILSMLLFKPAPIYILDEVDAALDLSHTQNIGQMLRTHFT-HSQFIVVSLKEGMFNNANVLFKTKFVDG----VSTVARFTQSQ 1175          
BLAST of Structural maintenance of chromosomes protein vs. UniProt/SwissProt
Match: sp|Q14683|SMC1A_HUMAN (Structural maintenance of chromosomes protein 1A OS=Homo sapiens OX=9606 GN=SMC1A PE=1 SV=2)

HSP 1 Score: 349.747 bits (896), Expect = 9.372e-105
Identity = 200/469 (42.64%), Postives = 306/469 (65.25%), Query Frame = 1
Query:  610 KLKMDSAEDDVFKEFCNSIGVENIRQYEERELIIARERDLKLLDFKNQLQKLKNQHDYEKS--RNTQAILDKYSEAMKNEKLEIEKAEANXXXXXXXXXXXXNRRDELETRLAEFKQKCESVDSELADLHRSRNTKQKDIQKLTKEVNQIETRLDSRRADRHSLIQAAKIDDLDLPVKEGSMTIYESTLSQNLNST-GDDLDAGEMGSEEMLRIFKAEEKIQFEYKRLDRSLRSLESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSNLLVSKVYRLDLSQYTDA 2007
            K KM+  ED+VF+EFC  IGV NIR++EE ++    E   K L+F+NQ  +L  Q D+EK+  +  Q  +  + + +K ++ EIEK +  E +    ++    +  +L+ +    K +    + E+ ++ +      K++  L KEV  IET+L+ +R+DRH+L+QA K+ D+ LP+ +G+M      +SQ   S+ G+D  +G   S+ +  I+  E  I+ +Y  L   L+  ++E E+ + +  +Q ++++    +Q+I  PN++A +KL+SV ++ ++T  +FE  R RA+KAK  FE++K+ R+DRF  CF  V  +ID IYK L+RN  AQA L P N EEPYLD I + CVAPGKRF+ MD+LSGGEKT+AALALLFA H+Y P+PFFVLDEIDAALDNTNIGKVA++I+E ++   Q IVISLKEEFY++A++LIG+ +    + ++SKV   DL++Y DA
Sbjct:  766 KEKMNQVEDEVFEEFCREIGVRNIREFEEEKVKRQNEIAKKRLEFENQKTRLGIQLDFEKNQLKEDQDKVHMWEQTVKKDENEIEKLKKEEQRHMKIIDETMAQLQDLKNQHLAKKSEVNDKNHEMEEIRKKLGGANKEMTHLQKEVTAIETKLEQKRSDRHNLLQACKMQDIKLPLSKGTM----DDISQEEGSSQGEDSVSG---SQRISSIYAREALIEIDYGDLCEDLKDAQAEEEIKQEMNTLQQKLNEQQSVLQRIAAPNMKAMEKLESVRDKFQETSDEFEAARKRAKKAKQAFEQIKKERFDRFNACFESVATNIDEIYKALSRNSSAQAFLGPENPEEPYLDGINYNCVAPGKRFRPMDNLSGGEKTVAALALLFAIHSYKPAPFFVLDEIDAALDNTNIGKVANYIKEQSTCNFQAIVISLKEEFYTKAESLIGV-YPEQGDCVISKVLTFDLTKYPDA 1226          
BLAST of Structural maintenance of chromosomes protein vs. UniProt/SwissProt
Match: sp|O97593|SMC1A_BOVIN (Structural maintenance of chromosomes protein 1A OS=Bos taurus OX=9913 GN=SMC1A PE=1 SV=1)

HSP 1 Score: 349.362 bits (895), Expect = 1.741e-104
Identity = 200/469 (42.64%), Postives = 305/469 (65.03%), Query Frame = 1
Query:  610 KLKMDSAEDDVFKEFCNSIGVENIRQYEERELIIARERDLKLLDFKNQLQKLKNQHDYEKS--RNTQAILDKYSEAMKNEKLEIEKAEANXXXXXXXXXXXXNRRDELETRLAEFKQKCESVDSELADLHRSRNTKQKDIQKLTKEVNQIETRLDSRRADRHSLIQAAKIDDLDLPVKEGSMTIYESTLSQNLNST-GDDLDAGEMGSEEMLRIFKAEEKIQFEYKRLDRSLRSLESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSNLLVSKVYRLDLSQYTDA 2007
            K KM+  ED+VF+EFC  IGV NIR++EE ++    E   K L+F+NQ  +L  Q D+EK+  +  Q  +  + + +K ++ EIEK +  E +    ++    +  +L+ +    K +    + E+ ++ +      K++  L KEV  IET+L+ +R+DRH+L+QA K+ D+ LP+ +G+M      +SQ   S+ G+D  +G   S+    I+  E  I+ +Y  L   L+  ++E E+ + +  +Q ++++    +Q+I  PN++A +KL+SV ++ ++T  +FE  R RA+KAK  FE++K+ R+DRF  CF  V  +ID IYK L+RN  AQA L P N EEPYLD I + CVAPGKRF+ MD+LSGGEKT+AALALLFA H+Y P+PFFVLDEIDAALDNTNIGKVA++I+E ++   Q IVISLKEEFY++A++LIG+ +    + ++SKV   DL++Y DA
Sbjct:  766 KEKMNQVEDEVFEEFCREIGVRNIREFEEEKVKRQNEIAKKRLEFENQKTRLGIQLDFEKNQLKEDQDKVHMWEQTVKKDENEIEKLKKEEQRHMKIIDETMAQLQDLKNQHLAKKSEVNDKNHEMEEIRKKLGGANKEMTHLQKEVTAIETKLEQKRSDRHNLLQACKMQDIKLPLSKGTM----DDISQEEGSSQGEDSVSG---SQRTSNIYAREALIEIDYGDLCEDLKDAQAEEEIKQEMNTLQQKLNEQQSVLQRIAAPNMKAMEKLESVRDKFQETSDEFEAARKRAKKAKQAFEQIKKERFDRFNACFESVATNIDEIYKALSRNSSAQAFLGPENPEEPYLDGINYNCVAPGKRFRPMDNLSGGEKTVAALALLFAIHSYKPAPFFVLDEIDAALDNTNIGKVANYIKEQSTCNFQAIVISLKEEFYTKAESLIGV-YPEQGDCVISKVLTFDLTKYPDA 1226          
BLAST of Structural maintenance of chromosomes protein vs. UniProt/SwissProt
Match: sp|Q9CU62|SMC1A_MOUSE (Structural maintenance of chromosomes protein 1A OS=Mus musculus OX=10090 GN=Smc1a PE=1 SV=4)

HSP 1 Score: 348.591 bits (893), Expect = 3.333e-104
Identity = 198/468 (42.31%), Postives = 302/468 (64.53%), Query Frame = 1
Query:  610 KLKMDSAEDDVFKEFCNSIGVENIRQYEERELIIARERDLKLLDFKNQLQKLKNQHDYEKS--RNTQAILDKYSEAMKNEKLEIEKAEANXXXXXXXXXXXXNRRDELETRLAEFKQKCESVDSELADLHRSRNTKQKDIQKLTKEVNQIETRLDSRRADRHSLIQAAKIDDLDLPVKEGSMTIYESTLSQNLNSTGDDLDAGEMGSEEMLRIFKAEEKIQFEYKRLDRSLRSLESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSNLLVSKVYRLDLSQYTDA 2007
            K KM+  ED+VF+EFC  IGV NIR++EE ++    E   K L+F+NQ  +L  Q D+EK+  +  Q  +  + + +K ++ EIEK +  E +    ++    +  +L+ +    K +    + E+ ++ +      K++  L KEV  IET+L+ +R+DRH+L+QA K+ D+ LP+ +G+M      +SQ   S+  +      GS+    I+  E  I+ +Y  L   L+  ++E E+ + +  +Q ++++    +Q+I  PN++A +KL+SV ++ ++T  +FE  R RA+KAK  FE++K+ R+DRF  CF  V  +ID IYK L+RN  AQA L P N EEPYLD I + CVAPGKRF+ MD+LSGGEKT+AALALLFA H+Y P+PFFVLDEIDAALDNTNIGKVA++I+E ++   Q IVISLKEEFY++A++LIG+ +    + ++SKV   DL++Y DA
Sbjct:  766 KEKMNQVEDEVFEEFCREIGVRNIREFEEEKVKRQNEIAKKRLEFENQKTRLGIQLDFEKNQLKEDQDKVHMWEQTVKKDENEIEKLKKEEQRHMKIIDETMAQLQDLKNQHLAKKSEVNDKNHEMEEIRKKLGGANKEMTHLQKEVTAIETKLEQKRSDRHNLLQACKMQDIKLPLSKGTM----DDISQEEGSSQGEESVS--GSQRTSSIYAREALIEIDYGDLCEDLKDAQAEEEIKQEMNTLQQKLNEQQSVLQRIAAPNMKAMEKLESVRDKFQETSDEFEAARKRAKKAKQAFEQIKKERFDRFNACFESVATNIDEIYKALSRNSSAQAFLGPENPEEPYLDGINYNCVAPGKRFRPMDNLSGGEKTVAALALLFAIHSYKPAPFFVLDEIDAALDNTNIGKVANYIKEQSTCNFQAIVISLKEEFYTKAESLIGV-YPEQGDCVISKVLTFDLTKYPDA 1226          
BLAST of Structural maintenance of chromosomes protein vs. UniProt/SwissProt
Match: sp|Q9Z1M9|SMC1A_RAT (Structural maintenance of chromosomes protein 1A OS=Rattus norvegicus OX=10116 GN=Smc1a PE=1 SV=1)

HSP 1 Score: 347.821 bits (891), Expect = 4.753e-104
Identity = 198/468 (42.31%), Postives = 301/468 (64.32%), Query Frame = 1
Query:  610 KLKMDSAEDDVFKEFCNSIGVENIRQYEERELIIARERDLKLLDFKNQLQKLKNQHDYEKS--RNTQAILDKYSEAMKNEKLEIEKAEANXXXXXXXXXXXXNRRDELETRLAEFKQKCESVDSELADLHRSRNTKQKDIQKLTKEVNQIETRLDSRRADRHSLIQAAKIDDLDLPVKEGSMTIYESTLSQNLNSTGDDLDAGEMGSEEMLRIFKAEEKIQFEYKRLDRSLRSLESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSNLLVSKVYRLDLSQYTDA 2007
            K KM+  ED+VF+EFC  IGV NIR++EE ++    E   K L+F+NQ  +L  Q D+EK+  +  Q  +  + + +K ++ EIEK +  E +    ++    +  +L+ +    K +    + E+ ++ +      K++  L KEV  IET+L+ +R+DRH+L+QA K+ D+ LP+ +G+M      +SQ     G   +    GS+    I+  E  I+ +Y  L   L+  ++E E+ + +  +Q ++++    +Q+I  PN++A +KL+SV ++ ++T  +FE  R RA+KAK  FE++K+ R+DRF  CF  V  +ID IYK L+RN  AQA L P N EEPYLD I + CVAPGKRF+ MD+LSGGEKT+AALALLFA H+Y P+PFFVLDEIDAALDNTNIGKVA++I+E ++   Q IVISLKEEFY++A++LIG+ +    + ++SKV   DL++Y DA
Sbjct:  766 KEKMNQVEDEVFEEFCREIGVRNIREFEEEKVKRQNEIAKKRLEFENQKTRLGIQLDFEKNQLKEDQDKVHMWEQTVKKDENEIEKLKKEEQRHMKIIDETMAQLQDLKNQHLAKKSEVNDKNHEMEEIRKKLGGANKEMTHLQKEVTAIETKLEQKRSDRHNLLQACKMQDIKLPLSKGTM----DDISQE--EGGSQGEESVSGSQRTSSIYAREALIEIDYGDLCEDLKDAQAEEEIKQEMNTLQQKLNEQQSVLQRIAAPNMKAMEKLESVRDKFQETSDEFEAARKRAKKAKQAFEQIKKERFDRFNACFESVATNIDEIYKALSRNSSAQAFLGPENPEEPYLDGINYNCVAPGKRFRPMDNLSGGEKTVAALALLFAIHSYKPAPFFVLDEIDAALDNTNIGKVANYIKEQSTCNFQAIVISLKEEFYTKAESLIGV-YPEQGDCVISKVLTFDLTKYPDA 1226          
BLAST of Structural maintenance of chromosomes protein vs. UniProt/SwissProt
Match: sp|O93308|SMC1A_XENLA (Structural maintenance of chromosomes protein 1A OS=Xenopus laevis OX=8355 GN=smc1a PE=1 SV=1)

HSP 1 Score: 341.273 bits (874), Expect = 1.449e-101
Identity = 196/469 (41.79%), Postives = 300/469 (63.97%), Query Frame = 1
Query:  610 KLKMDSAEDDVFKEFCNSIGVENIRQYEERELIIARERDLKLLDFKNQLQKLKNQHDYEKS--RNTQAILDKYSEAMKNEKLEIEKAEANXXXXXXXXXXXXNRRDELETRLAEFKQKCESVDSELADLHRSRNTKQKDIQKLTKEVNQIETRLDSRRADRHSLIQAAKIDDLDLPVKEGSMTIYESTLSQNLNST-GDDLDAGEMGSEEMLRIFKAEEKIQFEYKRLDRSLRSLESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSNLLVSKVYRLDLSQYTDA 2007
            K KM+  ED+VF+EFC  IGV NIR++EE ++    E   K L+F+NQ  +L  Q DYEK+  +  Q  +  + +++K +  EIEK +  E +    ++    +  +L+ +    K +    +  + D+ +   +  K++  L KEV  IET+L+ +R+DRH+L+QA K+ D+ LP+ +G+M      +SQ   S+ G++  +    S+    ++  E  I+ +Y  L   L+   ++ ++ + +  +  ++++    +Q+I  PN++A +KL+SV ++ ++T  +FE  R RA+KAK  FE+ K+ R+DRF  CF  V  +ID IYK L+RN  AQA L P N EEPYLD I + CVAPGKRF+ MD+LSGGEKT+AALALLFA H+Y PSPFFVLDEIDAALDNTNIGKVA++I+E +    Q IVISLKEEFY++A++LIG+ +    + ++SKV   DL++Y DA
Sbjct:  766 KEKMNQVEDEVFEEFCREIGVRNIREFEEEKVKRQNEIAKKRLEFENQKTRLGIQLDYEKNQLKEDQGKVQTWEQSVKKDDNEIEKLKKEEQRHMKIIDETMAQLQDLKNQHLAKKSEVNDKNHLMEDIRKKLGSANKEVTHLQKEVTAIETKLEQKRSDRHNLLQACKMSDIKLPLSKGTM----DDISQEEGSSQGEESASS---SQRSSTVYAKEALIEIDYSDLSEDLKDAVADDDIKQEMSALHQKINEQQSILQRISAPNMKAMEKLESVRDKFQETSDEFEAARKRAKKAKQAFEQTKKERFDRFNACFESVATNIDEIYKALSRNSSAQAFLGPENPEEPYLDGINYNCVAPGKRFRPMDNLSGGEKTVAALALLFAIHSYKPSPFFVLDEIDAALDNTNIGKVANYIKEQSMSNFQAIVISLKEEFYTKAESLIGV-YPEQGDCVISKVLTFDLTKYPDA 1226          
BLAST of Structural maintenance of chromosomes protein vs. TrEMBL
Match: H2KS10 (Structural maintenance of chromosome 1 (Fragment) OS=Clonorchis sinensis OX=79923 GN=CLF_107785 PE=4 SV=1)

HSP 1 Score: 585.104 bits (1507), Expect = 0.000e+0
Identity = 315/511 (61.64%), Postives = 401/511 (78.47%), Query Frame = 1
Query:  481 EEKLLSSNXXXXXXXXXXXXXXXXXSERCNTKMQELQISINNEKLKMDSAEDDVFKEFCNSIGVENIRQYEERELIIARERDLKLLDFKNQLQKLKNQHDYEKSRNTQAILDKYSEAMKNEKLEIEKAEANXXXXXXXXXXXXNRRDELETRLAEFKQKCESVDSELADLHRSRNTKQKDIQKLTKEVNQIETRLDSRRADRHSLIQAAKIDDLDLPVKEGSMTIYESTLSQNLNSTGDDLDAGEMGSEEMLRIFKAEEKIQFEYKRLDRSLRSLESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSNLLVSKVYRLDLSQYTDAEE 2013
            EEKLLS+NE+EM ++ RE+ EVEER  RC TKMQELQIS+N EK KMD+ ED VF +FC  IGV+NIRQYE+REL +ARERD K L+F NQLQ++ NQ DYE+SR+T+  + ++ E +  EK+E++K +  E K+K EME  E R+ ELE+RL + K + E +D EL+++ R   +KQ+DIQK  KE+NQ E RL+SRRA+RHSL+Q+AK++DL++P+K G+  I E  L   L++  + LD     SEEM RI++ E ++  ++KRL++ LR L  + +V+++ E +QN+VD M+ N+ +IQ PNLRAGDKL SVEERLR TE +FEDTR RA++AK  FE+V+R RY+ FMNCF  + D+ID IYK+L+RNPGAQASLLPTN EEPYL+EIQFQCVAPGKRFQ MDSLSGGEKTIAALALLFA H YNPSPFFVLDEIDAALDNTNIGKVASFIREYA+ RAQIIVISLKEEFYSRAD+LIGI    ++N LVS+V   D+S+Y D  E
Sbjct:  688 EEKLLSTNEEEMTQIARELEEVEERLARCQTKMQELQISVNAEKAKMDTVEDTVFHDFCVQIGVDNIRQYEDRELRVARERDRKRLEFTNQLQRINNQLDYERSRDTEGAVKRWEETVAAEKIEMDKCKKQEKKVKEEMEQEERRKTELESRLGDLKLRAEELDMELSEVKRRLVSKQRDIQKQQKELNQSEARLESRRAERHSLLQSAKMEDLEIPLKPGASPIAE--LESQLSADPESLDPS---SEEMARIYELEARLPIDFKRLEKPLRQLSDDKDVSRKAEELQNQVDSMLNNLSRIQAPNLRAGDKLGSVEERLRSTEAEFEDTRRRAKRAKARFERVRRLRYNAFMNCFLSITDNIDPIYKSLSRNPGAQASLLPTNAEEPYLEEIQFQCVAPGKRFQQMDSLSGGEKTIAALALLFAMHRYNPSPFFVLDEIDAALDNTNIGKVASFIREYATQRAQIIVISLKEEFYSRADSLIGIYPDIENNCLVSRVLSFDISKYIDTGE 1193          
BLAST of Structural maintenance of chromosomes protein vs. TrEMBL
Match: A0A4S2M8U9 (Structural maintenance of chromosomes protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001815 PE=3 SV=1)

HSP 1 Score: 584.334 bits (1505), Expect = 0.000e+0
Identity = 315/511 (61.64%), Postives = 399/511 (78.08%), Query Frame = 1
Query:  481 EEKLLSSNXXXXXXXXXXXXXXXXXSERCNTKMQELQISINNEKLKMDSAEDDVFKEFCNSIGVENIRQYEERELIIARERDLKLLDFKNQLQKLKNQHDYEKSRNTQAILDKYSEAMKNEKLEIEKAEANXXXXXXXXXXXXNRRDELETRLAEFKQKCESVDSELADLHRSRNTKQKDIQKLTKEVNQIETRLDSRRADRHSLIQAAKIDDLDLPVKEGSMTIYESTLSQNLNSTGDDLDAGEMGSEEMLRIFKAEEKIQFEYKRLDRSLRSLESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSNLLVSKVYRLDLSQYTDAEE 2013
            EEKLLS+NE+EM ++ RE+ EVEER  RC TKMQELQIS+N EK KMD+ ED VF +FC  IGV+NIRQYE+REL +ARERD K L+F NQLQ++ NQ DYE+SR+T+  + ++ E +  EK+E++K +  E K+K EME  E R+ ELE+RL + K + E +D EL+++ R    KQ+DIQK  KE+NQ E RL+SRRA+RHSL+Q+AK++DL++P+K G+  I E  L   L++  + LD     SEEM RI++ E ++  ++KRL++ LR L  + +V ++ E +QN+VD M+ N+ +IQ PNLRAGDKL SVEERLR TE +FEDTR RA++AK  FE+V+R RY+ FMNCF  + D+ID IYK+L+RNPGAQASLLPTN EEPYL+EIQFQCVAPGKRFQ MDSLSGGEKTIAALALLFA H YNPSPFFVLDEIDAALDNTNIGKVASFIREYA+ RAQIIVISLKEEFYSRAD+LIGI    ++N LVS+V   D+S+Y D  E
Sbjct:  729 EEKLLSTNEEEMTQIARELEEVEERLARCQTKMQELQISVNAEKAKMDTVEDTVFHDFCVQIGVDNIRQYEDRELRVARERDRKRLEFTNQLQRINNQLDYERSRDTEGAVKRWEETVAAEKIEMDKCKKQEKKVKEEMEQEERRKTELESRLGDLKLRAEELDMELSEVKRRLVAKQRDIQKQQKELNQFEARLESRRAERHSLLQSAKMEDLEIPLKPGASPIAE--LESQLSADPESLDPS---SEEMARIYELEARLPIDFKRLEKPLRQLSDDKDVARKAEELQNQVDSMLNNLSRIQAPNLRAGDKLGSVEERLRSTEAEFEDTRRRAKRAKARFERVRRLRYNAFMNCFLSITDNIDPIYKSLSRNPGAQASLLPTNAEEPYLEEIQFQCVAPGKRFQQMDSLSGGEKTIAALALLFAMHRYNPSPFFVLDEIDAALDNTNIGKVASFIREYATQRAQIIVISLKEEFYSRADSLIGIYPDIENNCLVSRVLSFDISKYIDTGE 1234          
BLAST of Structural maintenance of chromosomes protein vs. TrEMBL
Match: A0A419PXH1 (Structural maintenance of chromosomes protein OS=Clonorchis sinensis OX=79923 GN=Smc1a PE=3 SV=1)

HSP 1 Score: 584.334 bits (1505), Expect = 0.000e+0
Identity = 315/511 (61.64%), Postives = 401/511 (78.47%), Query Frame = 1
Query:  481 EEKLLSSNXXXXXXXXXXXXXXXXXSERCNTKMQELQISINNEKLKMDSAEDDVFKEFCNSIGVENIRQYEERELIIARERDLKLLDFKNQLQKLKNQHDYEKSRNTQAILDKYSEAMKNEKLEIEKAEANXXXXXXXXXXXXNRRDELETRLAEFKQKCESVDSELADLHRSRNTKQKDIQKLTKEVNQIETRLDSRRADRHSLIQAAKIDDLDLPVKEGSMTIYESTLSQNLNSTGDDLDAGEMGSEEMLRIFKAEEKIQFEYKRLDRSLRSLESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSNLLVSKVYRLDLSQYTDAEE 2013
            EEKLLS+NE+EM ++ RE+ EVEER  RC TKMQELQIS+N EK KMD+ ED VF +FC  IGV+NIRQYE+REL +ARERD K L+F NQLQ++ NQ DYE+SR+T+  + ++ E +  EK+E++K +  E K+K EME  E R+ ELE+RL + K + E +D EL+++ R   +KQ+DIQK  KE+NQ E RL+SRRA+RHSL+Q+AK++DL++P+K G+  I E  L   L++  + LD     SEEM RI++ E ++  ++KRL++ LR L  + +V+++ E +QN+VD M+ N+ +IQ PNLRAGDKL SVEERLR TE +FEDTR RA++AK  FE+V+R RY+ FMNCF  + D+ID IYK+L+RNPGAQASLLPTN EEPYL+EIQFQCVAPGKRFQ MDSLSGGEKTIAALALLFA H YNPSPFFVLDEIDAALDNTNIGKVASFIREYA+ RAQIIVISLKEEFYSRAD+LIGI    ++N LVS+V   D+S+Y D  E
Sbjct:  729 EEKLLSTNEEEMTQIARELEEVEERLARCQTKMQELQISVNAEKAKMDTVEDTVFHDFCVQIGVDNIRQYEDRELRVARERDRKRLEFTNQLQRINNQLDYERSRDTEGAVKRWEETVAAEKIEMDKCKKQEKKVKEEMEQEERRKTELESRLGDLKLRAEELDMELSEVKRRLVSKQRDIQKQQKELNQSEARLESRRAERHSLLQSAKMEDLEIPLKPGASPIAE--LESQLSADPESLDPS---SEEMARIYELEARLPIDFKRLEKPLRQLSDDKDVSRKAEELQNQVDSMLNNLSRIQAPNLRAGDKLGSVEERLRSTEAEFEDTRRRAKRAKARFERVRRLRYNAFMNCFLSITDNIDPIYKSLSRNPGAQASLLPTNAEEPYLEEIQFQCVAPGKRFQQMDSLSGGEKTIAALALLFAMHRYNPSPFFVLDEIDAALDNTNIGKVASFIREYATQRAQIIVISLKEEFYSRADSLIGIYPDIENNCLVSRVLSFDISKYIDTGE 1234          
BLAST of Structural maintenance of chromosomes protein vs. TrEMBL
Match: A0A1S8WKK3 (Structural maintenance of chromosomes protein OS=Opisthorchis viverrini OX=6198 GN=X801_09237 PE=3 SV=1)

HSP 1 Score: 583.563 bits (1503), Expect = 0.000e+0
Identity = 314/511 (61.45%), Postives = 400/511 (78.28%), Query Frame = 1
Query:  481 EEKLLSSNXXXXXXXXXXXXXXXXXSERCNTKMQELQISINNEKLKMDSAEDDVFKEFCNSIGVENIRQYEERELIIARERDLKLLDFKNQLQKLKNQHDYEKSRNTQAILDKYSEAMKNEKLEIEKAEANXXXXXXXXXXXXNRRDELETRLAEFKQKCESVDSELADLHRSRNTKQKDIQKLTKEVNQIETRLDSRRADRHSLIQAAKIDDLDLPVKEGSMTIYESTLSQNLNSTGDDLDAGEMGSEEMLRIFKAEEKIQFEYKRLDRSLRSLESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSNLLVSKVYRLDLSQYTDAEE 2013
            EEKLLS+NE+EM ++ RE+ EVEER  RC TKMQELQIS+N EK KMD+ ED VF +FC  IGV+NIRQYE+REL +ARERD K L+F NQLQ++ NQ DYE+SR+T+  + ++ E +  EK+E++K +  E K+K EME  E R+ ELE+RL + K + E +D EL+++ R    KQ+DIQK  KE+NQ E RL+SRRA+RHSL+Q+AK++DL++P+K G+  I E  L   L++  + LD     SEEM RI++ E ++  ++KRL++ LR L  + +++++ E +QN+VD M+ N+ +IQ PNLRAGDKL SVEERLR TE +FEDTR RA++AK  FE+V+R RY+ FMNCF  + D+ID IYK+L+RNPGAQASLLPTN EEPYL+EIQFQCVAPGKRFQ MDSLSGGEKTIAALALLFA H YNPSPFFVLDEIDAALDNTNIGKVASFIREYA+ RAQIIVISLKEEFYSRAD+LIGI    ++N LVS+V   D+S+Y D  E
Sbjct:  729 EEKLLSTNEEEMTQIARELEEVEERLARCQTKMQELQISVNAEKAKMDTVEDTVFHDFCVQIGVDNIRQYEDRELRVARERDRKRLEFTNQLQRINNQLDYERSRDTEGAVKRWEETVAAEKIEMDKCKKQEKKVKEEMEQEERRKTELESRLGDLKLRAEELDMELSEVKRRLVAKQRDIQKQQKELNQSEARLESRRAERHSLLQSAKMEDLEIPLKPGASPIAE--LESQLSADPESLDPS---SEEMARIYELEARLPIDFKRLEKPLRQLSDDKDISRKAEELQNQVDSMLNNLSRIQAPNLRAGDKLGSVEERLRSTEAEFEDTRRRAKRAKARFERVRRLRYNAFMNCFLSITDNIDPIYKSLSRNPGAQASLLPTNAEEPYLEEIQFQCVAPGKRFQQMDSLSGGEKTIAALALLFAMHRYNPSPFFVLDEIDAALDNTNIGKVASFIREYATQRAQIIVISLKEEFYSRADSLIGIYPDIENNCLVSRVLSFDISKYIDTGE 1234          
BLAST of Structural maintenance of chromosomes protein vs. TrEMBL
Match: A0A183SEI1 (SMC hinge domain-containing protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS2629 PE=4 SV=1)

HSP 1 Score: 580.096 bits (1494), Expect = 0.000e+0
Identity = 299/511 (58.51%), Postives = 397/511 (77.69%), Query Frame = 1
Query:  481 EEKLLSSNXXXXXXXXXXXXXXXXXSERCNTKMQELQISINNEKLKMDSAEDDVFKEFCNSIGVENIRQYEERELIIARERDLKLLDFKNQLQKLKNQHDYEKSRNTQAILDKYSEAMKNEKLEIEKAEANXXXXXXXXXXXXNRRDELETRLAEFKQKCESVDSELADLHRSRNTKQKDIQKLTKEVNQIETRLDSRRADRHSLIQAAKIDDLDLPVKEGSMTIYESTLSQNLNSTGDDLDAGEMGSEEMLRIFKAEEKIQFEYKRLDRSLRSLESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSNLLVSKVYRLDLSQYTDAEE 2013
            EEKLLS NE+EM  +  ++ +V ER  RC TKMQELQISIN EK KMD+ ED V  +FC SIGVENIR+YE+REL IARERD K L+F NQLQ++ NQ +YEKSR+TQA + ++ E +  E+ E+E+ +  E +LK EME+ E R+ +LET+L EF+QK + ++ EL +L R   ++Q+++QK  KE+NQIE RL+++R++RHSL+Q+AK+DDL LP+K G+ ++ E        S G DL+     SEEM+R+++ E K+  +YK+L++ LR +  E EVN++ + +QN++D+M  N+ +IQ PNLRA  KL +VE+RLR TE +FE+TR +A++A+  FE+++R RY+ FMNCFN + D+ID +YK+L+RNPGAQASLLPTN EEPYL+++QFQCVAPGKRFQ MDSLSGGEKTIAALAL FA H YNPSPFFVLDEIDAALDNTNIGKVASFIREY+  RAQ+IVISLKEEFYSRAD+LIGI    ++N LVS+V   DLS+Y D E+
Sbjct:  545 EEKLLSGNEEEMTSLRAKLDDVNERLGRCQTKMQELQISINAEKAKMDNVEDTVLHDFCVSIGVENIREYEDRELRIARERDRKRLEFNNQLQRINNQLEYEKSRDTQANVHRWEETVTGERSEMERCKKQEKRLKEEMEVEEARKADLETQLTEFQQKNDQLEGELGELRRRLVSRQREVQKQQKELNQIENRLENKRSERHSLLQSAKMDDLQLPLKPGASSMPELESQLVAESEGADLN-----SEEMMRLYEMEAKLPLDYKQLEKPLRMIADEKEVNRKADEMQNDIDRMANNLARIQAPNLRASAKLGNVEQRLRSTEAEFEETRRKAKRARAQFERIRRLRYNAFMNCFNSIADNIDPLYKSLSRNPGAQASLLPTNAEEPYLEDLQFQCVAPGKRFQQMDSLSGGEKTIAALALSFAMHQYNPSPFFVLDEIDAALDNTNIGKVASFIREYSRTRAQVIVISLKEEFYSRADSLIGIYPDIENNCLVSRVLTFDLSKYVDTED 1050          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Cavefish
Match: smc1a (structural maintenance of chromosomes 1A [Source:NCBI gene;Acc:103021942])

HSP 1 Score: 340.117 bits (871), Expect = 3.573e-102
Identity = 196/474 (41.35%), Postives = 293/474 (61.81%), Query Frame = 1
Query:  616 KMDSAEDDVFKEFCNSIGVENIRQYEERELIIARERDLKLLDFKNQLQKLKNQHDYEKS--RNTQAILDKYSEAMKNEKLEIEKAEANXXXXXXXXXXXXNRRDELETRLAEFKQKCESVDSELADLHRSRNTKQKDIQKLTKEVNQIETRLDSRRADRHSLIQAAKIDDLDLPVKEGSMTIYESTLSQNLNSTGDDLDAGEMGSE--------EMLRIFKAEEKIQFEYKRLDRSLRSLESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSNLLVSKVYRLDLSQYTDA 2007
            +M+  ED+VF EFC  IGV NIR++EE ++    E   K L+F+ Q  +L  Q DYEK+  +  Q  +  + + +K ++ EIE+ +  E +    ++    +  +L+ +    K +    + E+ ++ +   +  K++  L KEV  IET+L+ +R+DRH+L+QA K+ D+ LP+K G+M               DD+  GE  S+            +   E  I+ +Y  L+  L+    + E+   +  +Q  +++    +Q+I  PN++A +KL+SV ++ ++T  +FE  R RA+KAK  FE++K+ R+DRF  CF  V  +ID IYK L+RN  AQA L P N EEPYLD I + CVAPGKRF+ MD+LSGGEKT+AALALLFA H+Y P+PFFVLDEIDAALDNTNIGKVA++I++ +    Q IVISLKEEFY++AD+LIG+ +    + ++SKV   DLSQY DA
Sbjct:  768 RMNLVEDEVFLEFCEEIGVRNIREFEEEKVKRQNEIAKKRLEFETQKTRLAIQLDYEKNQLKEDQEKVMMWEQTVKKDENEIERLKKEEHRHMKIIDETMAQLQDLKNQHLTKKGEVNDKNREMEEIRKKLGSANKELTHLQKEVTAIETKLEQKRSDRHNLLQACKMQDIKLPLKSGTM---------------DDISQGEGSSQVDESSSQKTSSSVHAKEALIEIDYSNLNEDLKDALCDEEIKAEMNTLQQRLNEQQSILQRISAPNMKAMEKLESVRDKFQETSDEFEAARKRAKKAKQAFEQIKKERFDRFNTCFESVATNIDEIYKALSRNSSAQAFLGPENPEEPYLDGINYNCVAPGKRFRPMDNLSGGEKTVAALALLFAIHSYKPAPFFVLDEIDAALDNTNIGKVANYIKDQSVQNFQAIVISLKEEFYTKADSLIGV-YPEQGDCVISKVLTFDLSQYPDA 1225          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Cavefish
Match: smc1al (structural maintenance of chromosomes 1A, like [Source:ZFIN;Acc:ZDB-GENE-040426-57])

HSP 1 Score: 300.442 bits (768), Expect = 7.984e-88
Identity = 179/466 (38.41%), Postives = 275/466 (59.01%), Query Frame = 1
Query:  616 KMDSAEDDVFKEFCNSIGVENIRQYEERELIIARERDLKLLDFKNQLQKLKNQHDYEKS--RNTQAILDKYSEAMKNEKLEIEKAEANXXXXXXXXXXXXNRRDELETRLAEFKQKCESVDSELADLHRSRNTKQKDIQKLTKEVNQIETRLDSRRADRHSLIQAAKIDDLDLPVKEGSMTIYESTLSQNLNSTGDDLDAGEMGSEEMLRIFKAEEKIQFEYKRLDRSLRSLESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSNLLVSKVYRLDLSQYTDA 2007
            +M+  ED+VF EFC  IGV NIR++EE ++    E   K L+F+ Q  +L  Q DYEK+  +  Q  +  + + +K ++ EIEK +  E +    ++    +  +L+ +    K +    + E+ ++ +   +  K++ +L KEV  IET+L+ +R+DRH+L+QA K+ D+ LP++ G+M         +   +           +    +   E  I+ +Y  L   L+   S+ E+   +  +Q  +++    +Q+I  PN++A +KL+SV ++ ++T  +FE  R RA+KAK  FE++K+ R+DRF  CF  V  +ID IYK L+RN  AQA L P N EEPYLD I + CVAPGKRF+ MD+LSGGEKT+AALALLFA H+Y P+PFFVLDEID     +           Y +   Q IVISLKEEFY++AD+L+G+ +    + ++SKV   DLSQY DA
Sbjct:  768 RMNVVEDEVFFEFCKEIGVRNIREFEEEKVKRQNEIAKKRLEFETQKTRLAIQLDYEKNQLKEDQEKVVMWEQTVKKDENEIEKLKKEEQRHMKIIDETMAQLQDLKNQHLTKKSEVNDKNHEMEEIRKKLGSANKELTQLQKEVTAIETKLEQKRSDRHNLLQACKMQDIKLPLRSGTMEDISQEEGSSQEESM------SSSQKTSSTVLAKEALIEIDYSSLSEDLKDALSDEELKGEMNTLQQRLNEQQSILQRISAPNMKAMEKLESVRDKFQETSDEFEAARKRAKKAKQAFEQIKKERFDRFNACFESVATNIDEIYKALSRNSSAQAFLGPENPEEPYLDGINYNCVAPGKRFRPMDNLSGGEKTVAALALLFAIHSYKPAPFFVLDEIDVGFHQSQCLNDPKL---YKNKNFQAIVISLKEEFYTKADSLVGV-YPEQGDCVISKVLTFDLSQYPDA 1223          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Cavefish
Match: smc1b (structural maintenance of chromosomes 1B [Source:ZFIN;Acc:ZDB-GENE-091217-1])

HSP 1 Score: 290.426 bits (742), Expect = 1.540e-84
Identity = 188/472 (39.83%), Postives = 271/472 (57.42%), Query Frame = 1
Query:  616 KMDSAEDDVFKEFCNSIGVENIRQYEERELIIARERDLKLLDFKNQLQKLKNQHDYEKSRNTQAILDKYSEAMKNEKLEIEKAEANXXXXXXXXXXXXNRRDELETRLAEF-------KQKCESVDSELADLHRSRNTKQKDIQKLTKEVNQIETRLDSRRADRHSLIQAAKIDDLDLPVKEGSMTIYESTLSQNLNSTGDDLDAGEMGSEE----MLRIFKAEEKIQFEYKRLDRSLRSLESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSNLLVSKVYRLDLSQY 1998
            +++  ED VF EFC  IGV NIR+YE   L    E + K L F+ Q  +L  Q +YE+ +     LDK  + M   +  + K E +   +K E E L    DE +++L+E        K       SEL    +    K  D+ K  KE+   ET L+ +R  +H+L+ A KI+  +L +  G++               DD+   ++ SE      L I++ E +I F+YK+L   L SL +E EV +++  ++ +V  +   IQ  +TPNL+A +K+  V E   +  + FE +   ++K   +FE+VK  R+  F  CF  V   ++ IYK L RN  A A L   N +EPYLD I + CVAPGKRF  MD+LSGGEK+IAALAL+FA H++ P+PFFVLDE+DAALDNTNIGKV S+IRE + +  QIIVISLKEEFYSR+DAL+G+    D + + S++  +DL+ Y
Sbjct:  701 QVNQMEDMVFLEFCAEIGVANIREYELDYLRQQEELEQKRLQFETQRTRLTAQLEYEQEQ-----LDKQQKNMSKMEDSVRKVEDDILAMKEEEERLLAVVDETQSKLSELNEQLVEQKSCVNDAKSELDIKVKGHREKSSDLVKQQKELISAETALEQQRLCKHNLLLACKIEGQNLTLLSGTL---------------DDISDVQLDSESQSTCTLDIYEREAQIVFDYKQLGDRLMSLTTEEEVEEQLATMREKVSSLDKLIQVSKTPNLKALEKMREVRESFHEVLSAFESSTIISKKCNQEFEQVKAKRFHLFSKCFEHVSVAVNQIYKQLCRNDSALAILSAENPDEPYLDGISYNCVAPGKRFMAMDNLSGGEKSIAALALVFAIHSFRPAPFFVLDEVDAALDNTNIGKVTSYIREQSRENLQIIVISLKEEFYSRSDALLGVYSEFD-DCMYSRLLSVDLTPY 1151          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Cavefish
Match: smc1b (structural maintenance of chromosomes 1B [Source:ZFIN;Acc:ZDB-GENE-091217-1])

HSP 1 Score: 285.804 bits (730), Expect = 1.126e-82
Identity = 183/451 (40.58%), Postives = 260/451 (57.65%), Query Frame = 1
Query:  616 KMDSAEDDVFKEFCNSIGVENIRQYEERELIIARERDLKLLDFKNQLQKLKNQHDYEKSRNTQAILDKYSEAMKNEKLEIEKAEANXXXXXXXXXXXXNRRDELETRLAEF-------KQKCESVDSELADLHRSRNTKQKDIQKLTKEVNQIETRLDSRRADRHSLIQAAKIDDLDLPVKEGSMTIYESTLSQNLNSTGDDLDAGEMGSEE----MLRIFKAEEKIQFEYKRLDRSLRSLESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGI 1935
            +++  ED VF EFC  IGV NIR+YE   L    E + K L F+ Q  +L  Q +YE+ +     LDK  + M   +  + K E +   +K E E L    DE +++L+E        K       SEL    +    K  D+ K  KE+   ET L+ +R  +H+L+ A KI+  +L +  G++               DD+   ++ SE      L I++ E +I F+YK+L   L SL +E EV +++  ++ +V  +   IQ  +TPNL+A +K+  V E   +  + FE +   ++K   +FE+VK  R+  F  CF  V   ++ IYK L RN  A A L   N +EPYLD I + CVAPGKRF  MD+LSGGEK+IAALAL+FA H++ P+PFFVLDE+DAALDNTNIGKV S+IRE + +  QIIVISLKEEFYSR+DAL+G+
Sbjct:  701 QVNQMEDMVFLEFCAEIGVANIREYELDYLRQQEELEQKRLQFETQRTRLTAQLEYEQEQ-----LDKQQKNMSKMEDSVRKVEDDILAMKEEEERLLAVVDETQSKLSELNEQLVEQKSCVNDAKSELDIKVKGHREKSSDLVKQQKELISAETALEQQRLCKHNLLLACKIEGQNLTLLSGTL---------------DDISDVQLDSESQSTCTLDIYEREAQIVFDYKQLGDRLMSLTTEEEVEEQLATMREKVSSLDKLIQVSKTPNLKALEKMREVRESFHEVLSAFESSTIISKKCNQEFEQVKAKRFHLFSKCFEHVSVAVNQIYKQLCRNDSALAILSAENPDEPYLDGISYNCVAPGKRFMAMDNLSGGEKSIAALALVFAIHSFRPAPFFVLDEVDAALDNTNIGKVTSYIREQSRENLQIIVISLKEEFYSRSDALLGV 1131          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Cavefish
Match: smc4 (structural maintenance of chromosomes 4 [Source:NCBI gene;Acc:103045898])

HSP 1 Score: 116.316 bits (290), Expect = 2.356e-26
Identity = 67/194 (34.54%), Postives = 107/194 (55.15%), Query Frame = 1
Query: 1393 PNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGI--MHTTDSNLLVS 1968
            PNL A  +    EE   Q   + ++   +    K   E +++ R + FM  FN++ + +   Y+ L    G  A L   +  +P+ + I F    P K ++ + +LSGGEKT+++LAL+FA H++ P+P + +DEIDAALD  N+  VA +I E   + AQ I+ISL+   +  AD LIGI   H T  N+ ++
Sbjct:  946 PNLGAIAEFKKKEELYLQRVAELDEITTQRDDFKRGCEDLRKQRLNEFMAGFNIITNKLKENYQMLTL--GGDAELELVDSLDPFSEGIMFSVRPPKKSWKKIYNLSGGEKTLSSLALVFALHHFKPTPLYFMDEIDAALDFKNVSIVACYIYEQTKN-AQFIIISLRNNMFEMADRLIGIYKTHNTTKNVGIN 1136          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000346.1 (pep scaffold:Pmarinus_7.0:GL477118:44770:74561:-1 gene:ENSPMAG00000000296.1 transcript:ENSPMAT00000000346.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 326.25 bits (835), Expect = 9.708e-98
Identity = 183/465 (39.35%), Postives = 281/465 (60.43%), Query Frame = 1
Query:  616 KMDSAEDDVFKEFCNSIGVENIRQYEERELIIARERDLKLLDFKNQLQKLKNQHDYEKS--RNTQAILDKYSEAMKNEKLEIEKAEANXXXXXXXXXXXXNRRDELETRLAEFKQKCESVDSELADLHRSRNTKQKDIQKLTKEVNQIETRLDSRRADRHSLIQAAKIDDLDLPVKEGSMTIYESTLSQNLNSTGDDLDAGEMGSEEMLRIFKAEEKIQFEYKRLDRSLRSLESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSNLLVSKVYRLDLSQYTD 2004
            KM+  ED+VFK+FC   GV N R++EE +L    E   K  +F NQ  +L  Q DYE+   +  Q+ +  +  A+  ++ EI+  + +E + +  +E L +    L+ +L   + +  +      ++ R      +   +L  EV  +ET+L+ +R  RH+L+   K+ D+ LP++ G           NL+S   + ++    SE    ++  E  I+ +Y++L R  + +  E E+N+  + +  +V  +   +Q I  PN++A +K ++V  +  +T    E++R R+++A+M F KV+R R+DRF  C   +   ID IYK LA+N  AQA L P N EEPYLD I + CVAPGKR+Q MD+LSGGEKT+AALALLFA H+Y PSPFFVLDEIDAALDNTNIGKVA++I+E + +  Q+IVISLKEE ++RADALIG+ +    + L+S V  +DLS++ D
Sbjct:  765 KMNKLEDEVFKDFCVEAGVANTREFEEVKLKWREEVTKKGSEFDNQKTRLGIQLDYERMQLKQEQSKVKMWDAAIAKDEAEIDCVKKDEQRYRDRVEHLLSEMHSLKNQLLAKQGEVTNKAQATEEVRRKLLAFSRQAVQLQNEVTALETKLEQQRNARHNLLLTCKLQDIKLPLRNG-----------NLDSISQEPESTTESSEHTNSVYAREAAIEVDYRKLSRQYKEINREDEINRATDELNTQVTNLQTGMQHIVAPNMKATEKFENVRGKFLETTEALEESRKRSKQAQMAFNKVQRLRFDRFNGCLEHLSIAIDDIYKKLAQNNSAQAFLGPENAEEPYLDGINYNCVAPGKRYQPMDNLSGGEKTVAALALLFAIHSYRPSPFFVLDEIDAALDNTNIGKVANYIKEQSVENFQVIVISLKEELFARADALIGV-YPEQGDCLISHVVTMDLSRFPD 1217          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Sea Lamprey
Match: SMC1A (structural maintenance of chromosomes 1A [Source:HGNC Symbol;Acc:HGNC:11111])

HSP 1 Score: 307.375 bits (786), Expect = 1.051e-93
Identity = 172/421 (40.86%), Postives = 265/421 (62.95%), Query Frame = 1
Query:  580 QELQISINNEKLKMDSAEDDVFKEFCNSIGVENIRQYEERELIIARERDLKLLDFKNQLQKLKNQHDYEKS--RNTQAILDKYSEAMKNEKLEIEKAEANXXXXXXXXXXXXNRRDELETRLAEFKQKCESVDSELADLHRSRNTKQKDIQKLTKEVNQIETRLDSRRADRHSLIQAAKIDDLDLPVKEGSMTIYESTLSQNLNSTGDDLDAGEMGSEEMLRIFKAEEKIQFEYKRLDRSLRSLESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKV 1836
            QE+++ I     KM+  ED++F+EFC  IGV NIR++EE ++   +E   K  +F+NQ  +L  Q +YE++  +  Q  +  + +A+K ++ E+EK +  E +    ++    +  +L+ +L   K +      E+ ++ +      K++  L KEV  IET+++ +R+DRH+L+QA K+ D+ LP++ G+M      +SQ   S+  D +     S+    ++  E  IQ  Y  L+  L+ L S+ E+   +  ++++V +    +Q+I  PN+RA +KL+SV ++ ++T  +FE  R RA+K+K  FE++K+ R+DRF  CF  V  +ID IYK L+RN  AQA L P N EEPYLD I + CVAPGKRF+ MD+LSGGEKT+AALALLFATH+Y P+PFFVLDEIDAALDNTNI KV
Sbjct:  390 QEIKLIIE----KMNQVEDEIFEEFCREIGVRNIREFEEEKVKRQQEIAKKRSEFENQKTRLGIQLEYERTQLKEDQDKVTMWEDAVKKDETEVEKLKKEEQRHMKIIDETMAQLQDLKNQLLSKKSEVADKTHEMEEIRKKLGGFSKEMTHLQKEVTAIETKIEQKRSDRHNLLQACKMQDVRLPMRHGTM----DDISQEEGSSQADTETS-GSSQRSSNMYAREALIQINYNELNDDLKDLSSDEEIKAELNGLEHKVTEHQNIMQRISAPNMRAMEKLESVRDKFQETADEFEAARKRAKKSKQAFEQIKKERFDRFNACFEAVSTNIDEIYKALSRNASAQAFLGPENPEEPYLDGINYNCVAPGKRFRPMDNLSGGEKTVAALALLFATHSYKPAPFFVLDEIDAALDNTNISKV 801          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008608.1 (pep scaffold:Pmarinus_7.0:GL477381:37203:71735:-1 gene:ENSPMAG00000007778.1 transcript:ENSPMAT00000008608.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 116.701 bits (291), Expect = 4.125e-27
Identity = 72/224 (32.14%), Postives = 118/224 (52.68%), Query Frame = 1
Query: 1285 DRSLRSLESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSN 1956
            +R L  LE    +  ++  ++ +  QM  N+  I     +    L  V E L     Q ++ RH        +E +++ R   FM  FNV+ + +   Y+ L +  G  A L   +  +P+ + I F    P K ++ + +LSGGEKT+++LAL+FA H+Y P+P + +DEIDAALD  N+  VA ++ E   + AQ I+ISL+   +  +D LIGI  T ++ 
Sbjct: 1070 NRELEELEDPVALANKIAILEEKTLQMKPNLGAISDYKKKEEIYLQRVSE-LDAITAQRDEFRH-------SYEDLRKSRLQEFMAGFNVITNKLKENYQMLTQ--GGDAELELVDSLDPFSEGIVFSVRPPKKSWKKIFNLSGGEKTLSSLALVFALHHYKPTPLYFMDEIDAALDFKNVSIVALYVYEQTKN-AQFIIISLRNNMFEMSDRLIGIYKTNNTT 1282          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Sea Lamprey
Match: smc2 (structural maintenance of chromosomes 2 [Source:ZFIN;Acc:ZDB-GENE-030131-105])

HSP 1 Score: 69.3218 bits (168), Expect = 2.181e-12
Identity = 39/135 (28.89%), Postives = 77/135 (57.04%), Query Frame = 1
Query: 1546 FNVVVDHIDGIYKNLARN--PGAQASLLPT----NHEEPYLDEIQFQCVAPGKRF-QHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALI 1929
             N+    ++G + ++     PG+QA L P     +     L  ++F+ VA G  + +++  LSGG++++ AL+L+ A   + P+P ++LDE+DAALD ++   +   +R +    +Q +V+SLK+  ++ A+ L 
Sbjct: 1029 LNLAWRQVNGDFSSIFSTLLPGSQARLTPVESSSSSTSSLLQGLEFR-VALGSVWKENLSELSGGQRSLVALSLILAMLLFKPAPIYILDEVDAALDLSHTQNIGHMLRTHFLT-SQFVVVSLKDGMFNNANVLF 1161          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Yeast
Match: SMC1 (Subunit of the multiprotein cohesin complex; essential protein involved in chromosome segregation and in double-strand DNA break repair; SMC chromosomal ATPase family member, binds DNA with a preference for DNA with secondary structure [Source:SGD;Acc:S000001886])

HSP 1 Score: 202.986 bits (515), Expect = 3.347e-55
Identity = 143/470 (30.43%), Postives = 251/470 (53.40%), Query Frame = 1
Query:  622 DSAEDDVFKEFCNSIGVENIRQYEERELIIARERDLKLLDFKNQLQKLKNQHDYEKSR--NTQAILDKYSEAMKNEKLEIEKAEANXXXXXXXXXXXXNRRDELETRLAEFKQKCESVDSELADLHRSRNTKQKDIQKLTKEVNQIETRLDSRRADRHSLIQAAKIDDLDLPVKEGSMTIYESTLSQNLNSTGDDLDAGEMGSEEMLRIFKAEEKIQFEYKRLDRSLRSLESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNP-------GAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSNLLVSKVYRLDLSQYTD 2004
            ++ ++++FKEF + IG   I++YE     + R++  +L   + Q+  ++N+  +E  R   TQ   +K  + ++N ++E++  E  E  ++ ++  +E++ +E +  L E ++K  +  SEL            ++Q L +E + I+  ++    +R + ++  KI ++++P+        E+T+        DDL      +E +         I   YK L +  +   +++   K +E   +EV++++  +Q    PN RA ++ D  E R      + E  +   +K    F K+K+ R + F   F+ V DH+D IY+ L +NP       G  ASL   + +EP+   I++    P KRF+ M+ LSGGEKT+AALALLFA ++Y PSPFFVLDE+DAALD TN+ ++A++IR + +   Q IVISLK   + ++DAL+G+      N   SK+  LDLS Y +
Sbjct:  782 EALQNNIFKEFTSKIGF-TIKEYENHSGELMRQQSKELQQLQKQILTVENKLQFETDRLSTTQRRYEKAQKDLENAQVEMKSLEEQEYAIEMKIGSIESKLEEHKNHLDELQKKFVTKQSELNSSEDILEDMNSNLQVLKRERDGIKEDIEKFDLERVTALKNCKISNINIPISS------ETTI--------DDLPISSTDNEAI----TISNSIDINYKGLPKKYKENNTDS-ARKELEQKIHEVEEILNELQ----PNARALERYDEAEGRFEVINNETEQLKAEEKKILNQFLKIKKKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQEN--SSKIITLDLSNYAE 1225          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Yeast
Match: SMC4 (Subunit of the condensin complex; condensin reorganizes chromosomes during both mitosis and meiosis; forms a subcomplex with Smc2p that has ATP-hydrolyzing and DNA-binding activity, but other condensin subunits are required for chromatin binding; required for tRNA gene clustering at the nucleolus; potential Cdc28p substrate [Source:SGD;Acc:S000004076])

HSP 1 Score: 120.168 bits (300), Expect = 2.739e-28
Identity = 55/142 (38.73%), Postives = 91/142 (64.08%), Query Frame = 1
Query: 1510 VKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGI 1935
            +K+ R+D FM  FN++   +  +Y+ +    G  A L   +  +P+ + + F  + P K ++++ +LSGGEKT+++LAL+FA H Y P+P +V+DEIDAALD  N+  VA++I+E   + AQ IVISL+   +  A  L+G+
Sbjct: 1259 LKKKRFDEFMAGFNIISMTLKEMYQMITM--GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-AQFIVISLRNNMFELAQQLVGV 1397          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Yeast
Match: SMC3 (Subunit of the multiprotein cohesin complex; required for sister chromatid cohesion in mitotic cells; also required, with Rec8p, for cohesion and recombination during meiosis; phylogenetically conserved SMC chromosomal ATPase family member [Source:SGD;Acc:S000003610])

HSP 1 Score: 62.3882 bits (150), Expect = 1.738e-10
Identity = 29/82 (35.37%), Postives = 49/82 (59.76%), Query Frame = 1
Query: 1696 HMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMH 1941
            H++ LSGG+KT+ A+AL+ A    +P+ F++ DEIDAALD      VA+ ++E + + AQ I  + + +    AD    + +
Sbjct: 1122 HVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKELSKN-AQFICTTFRTDMLQVADKFFRVKY 1202          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Yeast
Match: SMC2 (Subunit of the condensin complex; condensin reorganizes chromosomes during both mitosis and meiosis; essential SMC chromosomal ATPase family member that forms a subcomplex with Smc2p that has ATP-hydrolyzing and DNA-binding activity, but other condensin subunits are required for chromatin binding; required for clustering of tRNA genes at the nucleolus [Source:SGD;Acc:S000001927])

HSP 1 Score: 62.3882 bits (150), Expect = 1.950e-10
Identity = 27/71 (38.03%), Postives = 47/71 (66.20%), Query Frame = 1
Query: 1708 LSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRAD 1920
            LSGG++++ AL+L+ A   + P+P ++LDE+DAALD ++   +   I+      +Q IV+SLKE  ++ A+
Sbjct: 1084 LSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG-SQFIVVSLKEGMFANAN 1153          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Nematostella
Match: EDO49596 (Structural maintenance of chromosomes protein [Source:UniProtKB/TrEMBL;Acc:A7RFF3])

HSP 1 Score: 378.252 bits (970), Expect = 1.074e-116
Identity = 207/484 (42.77%), Postives = 308/484 (63.64%), Query Frame = 1
Query:  562 RCNTKMQELQISINNEKLKMDSAEDDVFKEFCNSIGVENIRQYEERELIIARERDLKLLDFKNQLQKLKNQHDYEKSRNTQAILDKYSEAMKNEKLEIEKAEANXXXXXXXXXXXXNRRDELETRLAEFKQKCESVDSELADLHRSRNTKQKDIQKLTKEVNQIETRLDSRRADRHSLIQAAKIDDLDLPVKEGS---MTIYESTLSQNLNSTGDDLDAGEMGSEEMLRIFKAEEKIQFEYKRLDRSLRSLESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSNLLVSKVYRLDLSQYTD 2004
            R    M E +  I   + +M+  ED VF+EFC +IGV+ IRQYEE++L   +ER  K L+F  Q  +L+NQ DYE+SR+T++ + K   ++KN++ EI+K +A E +    ++   +  ++L    +  K + E  + E+ ++ ++ N   KD+  L K++  +ET+L+ ++ADRHSL+++ K++D++LP K G+   + + E T S   + +   ++   M S+     ++ E  I  +Y  L R L+  +   EV      + N+V ++   +Q+IQ PN++A +KL+    R ++T  +FE  R RARKAK++FE VK+ RYDRFM+ F  V   ID IYK LA NP AQA L P + EEPYL  I + CVAPGKRF+ MD+LSGGEKT+AALALLF+ H+Y P+PFFVLDEIDAALDNTNI KVA  I     +  Q IVISLKEEFY+RA+ALIGI    +    VS+V+ LDL+++ +
Sbjct:  733 RILASMGEREQIIKKTEAEMNQVEDKVFQEFCQTIGVDTIRQYEEKQLKAQQERSKKRLEFTKQESRLQNQLDYERSRDTKSQVKKLETSIKNDEEEIKKLKAEEKEHLKVIDTETSELEKLRLERSAKKSELEEKELEMKEIRKALNAHLKDVSALQKQMTSLETQLEQKKADRHSLLKSCKMEDIELPFKRGTVDDIELGEPTSSHVESESSSAMEIDSMSSQGAKITYEREANIIIDYSSLSRRLKEHDDPEEVRNMANELSNKVSKLQSTLQRIQAPNMKALEKLEGASSRFQETNNEFEQARSRARKAKIEFETVKKERYDRFMSAFEHVSTKIDDIYKELANNPSAQAFLGPEDAEEPYLGGINYNCVAPGKRFRPMDNLSGGEKTVAALALLFSIHSYQPAPFFVLDEIDAALDNTNINKVARHIINQTKEYFQCIVISLKEEFYTRAEALIGITAEPEHECTVSQVFTLDLTKFAE 1216          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Nematostella
Match: EDO40646 (Structural maintenance of chromosomes protein [Source:UniProtKB/TrEMBL;Acc:A7S6N1])

HSP 1 Score: 120.553 bits (301), Expect = 5.326e-28
Identity = 58/151 (38.41%), Postives = 95/151 (62.91%), Query Frame = 1
Query: 1498 DFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTD 1950
            + E +++ R D FM  F+++   +  +Y+ +    G  A L   +  +P+ + I F    P K ++++ +LSGGEKT+++LAL+FA H++ P+P +V+DEIDAALD  N+  VA++I+E   + AQ I+ISL+   +  AD LIGI  T D
Sbjct: 1058 EHEALRKKRLDEFMAGFSIITTKLKEMYQMITL--GGDAELELVDSLDPFSEGIVFSVRPPKKSWKNISNLSGGEKTLSSLALVFALHHFKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-AQFIIISLRNNMFELADRLIGIYKTYD 1205          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Nematostella
Match: EDO34135 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ79])

HSP 1 Score: 67.0106 bits (162), Expect = 1.070e-13
Identity = 34/79 (43.04%), Postives = 47/79 (59.49%), Query Frame = 1
Query: 1699 MDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGI 1935
            M+ LSGG+K++ ALAL+FA    +P+PF++ DEID ALD      VA  IR  A  +AQ I  + + E    AD   G+
Sbjct:    1 MNQLSGGQKSLVALALIFAIQKCDPAPFYLFDEIDQALDPQFRKAVAEMIRNLAV-KAQFITTTFRPELLESADKFYGV 78          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Medaka
Match: smc1al (structural maintenance of chromosomes 1A [Source:NCBI gene;Acc:100049244])

HSP 1 Score: 343.199 bits (879), Expect = 2.664e-103
Identity = 197/474 (41.56%), Postives = 292/474 (61.60%), Query Frame = 1
Query:  616 KMDSAEDDVFKEFCNSIGVENIRQYEERELIIARERDLKLLDFKNQLQKLKNQHDYEKS--RNTQAILDKYSEAMKNEKLEIEKAEANXXXXXXXXXXXXNRRDELETRLAEFKQKCESVDSELADLHRSRNTKQKDIQKLTKEVNQIETRLDSRRADRHSLIQAAKIDDLDLPVKEGSMTIYESTLSQNLNSTGDDLDAGEMGSE--------EMLRIFKAEEKIQFEYKRLDRSLRSLESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSNLLVSKVYRLDLSQYTDA 2007
            +M+  ED+VF EFC  IGV NIR++EE ++    E   K L+F+ Q  +L  Q DYEK+  +  Q  +  + + +K ++ EIE+ +  E +    ++    +  +L+ +    K +    + E+ ++ +      K++ +L KEV  IET+L+ +R+DRH+L+QA K+ D+ LP++ G+M               DD+  GE  S+            +   E  I+ +Y  L   L+   SE E+      +Q  +++    +Q+I  PN++A +KL+SV ++ ++T  +FE  R RA+KAK  FE++K+ R+DRF  CF  V  +ID IYK L+RN  AQA L P N EEPYLD I + CVAPGKRF+ MD+LSGGEKT+AALALLFA H+Y P+PFFVLDEIDAALDNTNIGKVA++I++ +    Q IVISLKEEFY++AD+LIG+ +    + ++SKV   DLSQY DA
Sbjct:  768 RMNLVEDEVFIEFCKEIGVRNIREFEEEKVKRQNEIAKKRLEFETQKTRLGIQVDYEKNQLKEDQEKVMMWEQTVKKDEAEIERLKKEEHRHMKIIDETMAQLQDLKNQHLTKKSEVNDKNHEMEEIRKKLGGANKELTQLQKEVTAIETKLEQKRSDRHNLLQACKMQDIRLPLRSGTM---------------DDISQGEGSSQTDESSSQRTSSSVLAKEALIEIDYSSLSEDLKDALSEEEIKAETNTLQQRLNEQQSILQRISAPNMKAMEKLESVRDKFQETSDEFEAARKRAKKAKQAFEQIKKERFDRFNTCFESVATNIDEIYKALSRNSSAQAFLGPENPEEPYLDGINYNCVAPGKRFRPMDNLSGGEKTVAALALLFAIHSYKPAPFFVLDEIDAALDNTNIGKVANYIKDQSVQNFQAIVISLKEEFYTKADSLIGV-YPEQGDCVISKVLTFDLSQYQDA 1225          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Medaka
Match: smc1b (meiosis-specific cohesin subunit SMC1 beta [Source:NCBI gene;Acc:100049500])

HSP 1 Score: 243.047 bits (619), Expect = 1.098e-67
Identity = 174/487 (35.73%), Postives = 270/487 (55.44%), Query Frame = 1
Query:  577 MQELQISINNEKL-----KMDSAEDDVFKEFCNSIGVENIRQYEERELIIARERDLKLLDFKNQLQKLKNQ--HDYEKSRNTQAILDKYSEAMKNEKLEIEKAEANXXXXXXXXXXXXNRRDELETRLAEFKQKCESVDSELADLHRSRNTKQKDIQKLTKEVNQIETRLDSRRADRHSLIQAAKIDDLDLPVKEGSM-TIYESTLSQNLNSTGDDLDAGEMGSEEMLRIFKAEEKIQFEYKRLDRSLRSLESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSNLLVSKVYRLDLSQYTDAEE 2013
            MQ+  +   NE++     ++D  ED VF +FC  IGV++IR+YE+  L    E D K ++F++Q  +LK +  ++ E     +  L K  E +  ++  + + + +E KL   +E    +  EL+ +L   K + ++V +EL    ++     K   KL +EV   E+ L+ +R  RH+L+   KI  L + +  G++  I E  L  +  ST   L+           I++ E ++  +Y  L   LRS+++E E+   +E ++  V      +     PNL+A +K+  V+++ ++    F+ +   ARK  ++FE+VK  R+ RF  C   V   ID IYK + +N  AQA L     +EPYL  I + CVAPGKRF  MD+LSGGEK IAALA LFA  ++ P+PF VLDE+DAALDN+NIGKV SFIRE +    Q+I IS K+EF+SR+D L+G+    D   + S++  LDL  Y   EE
Sbjct:  754 MQKESLEAKNEEMMKIRKQIDQVEDLVFSDFCAEIGVDSIREYEQEHLKQQAELDKKRMEFESQCGRLKTRLEYEEEHLEQERQKLHKLEENISEDEKIVSERKQDEIKLLELVEQRLEKLSELKNKLVSKKAQVDAVKAELDQKTKTLQEIHKCSLKLQREVMSAESALEQKRLARHNLLLGCKIKGLPIILLSGNLDEISEVQLETDSESTAATLN-----------IYEREAQLLIDYSDLQSQLRSIQAEEEMEAALEKLRESVSNTEGVLHNTTAPNLKALEKMREVKDKWQEVTDAFDLSTKAARKCSLEFEQVKAQRFHRFSRCLEHVSVVIDQIYKRICKNSSAQAILTAECADEPYLGGINYNCVAPGKRFMSMDNLSGGEKAIAALAFLFAVQSFCPAPFLVLDEVDAALDNSNIGKVTSFIREQSRQSMQVIAISHKQEFFSRSDGLLGVYSDVD-ECMFSRILTLDLRPYPLVEE 1228          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Medaka
Match: smc1b (meiosis-specific cohesin subunit SMC1 beta [Source:NCBI gene;Acc:100049500])

HSP 1 Score: 178.333 bits (451), Expect = 2.685e-46
Identity = 139/390 (35.64%), Postives = 195/390 (50.00%), Query Frame = 1
Query:  946 FKQKCESVDSELADLHRSRNTKQKDIQKLTKEVNQIETRLDSRRADRHSLIQAAKIDDLDLPVKEGSMTIYESTLSQNLNSTGDDLDAGEMGSEEMLRIFKAEEKIQFEYKRLDRSLRSLESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEER----------LRQTE------------------------TQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSNLLVSKVYRLDLSQYTDAEE 2013
             K++ E + SEL DL R +  K+ ++++++ +     TRL   +AD   L + A      +P  +  ++  ES L+ NL                   I++   K+Q       R + S ES  E  +   H  N +  + C I+ +  P +     LD + ER          L QTE                        T F+ +   ARK  ++FE+VK  R+ RF  C   V   ID IYK + +N  AQA L     +EPYL  I + CVAPGKRF  MD+LSGGEK IAALA LFA  ++ P+PF VLDE+DAALDN+NIGKV SFIRE +    Q+I IS K+EF+SR+D L+G+    D   + S++  LDL  Y   EE
Sbjct:  665 LKERKEHLTSELRDLMRKKR-KESELKQISAQAQGARTRLKYSKADLEHLEKKA------IPKCQAEISRLESELA-NL-------------------IYECSLKLQ-------REVMSAESALEQKRLARH--NLL--LGCKIKGL--PIILLSGNLDEISERSLFTWFCSQALVQTEMGHTSVVCLLCLSLCFVMEALLSLTAFDLSTKAARKCSLEFEQVKAQRFHRFSRCLEHVSVVIDQIYKRICKNSSAQAILTAECADEPYLGGINYNCVAPGKRFMSMDNLSGGEKAIAALAFLFAVQSFCPAPFLVLDEVDAALDNSNIGKVTSFIREQSRQSMQVIAISHKQEFFSRSDGLLGVYSDVD-ECMFSRILTLDLRPYPLVEE 1013          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Medaka
Match: smc4 (structural maintenance of chromosomes 4 [Source:NCBI gene;Acc:101157474])

HSP 1 Score: 120.553 bits (301), Expect = 1.326e-27
Identity = 67/188 (35.64%), Postives = 104/188 (55.32%), Query Frame = 1
Query: 1393 PNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSN 1956
            PNL A  +    EE   Q   Q ++        K  +E +++ R + FM  FN++ + +   Y+ L    G  A L   +  +P+ + I F    P K ++ + +LSGGEKT+++LAL+FA H+Y P+P + +DEIDAALD  N+  VA +I E   + AQ I+ISL+   +  AD LIGI  T ++ 
Sbjct: 1014 PNLGAISEYKKKEELYLQRVAQLDEITAERDTFKCSYEDLRKRRLNEFMTGFNMITNKLKENYQMLTL--GGDAELELVDSLDPFSEGIMFSVRPPKKSWKKIFNLSGGEKTLSSLALVFALHHYKPTPLYFMDEIDAALDFKNVSIVACYIYEQTKN-AQFIIISLRNNMFEIADRLIGIYKTHNTT 1198          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Medaka
Match: smc4 (structural maintenance of chromosomes 4 [Source:NCBI gene;Acc:101157474])

HSP 1 Score: 120.553 bits (301), Expect = 1.378e-27
Identity = 67/188 (35.64%), Postives = 104/188 (55.32%), Query Frame = 1
Query: 1393 PNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSN 1956
            PNL A  +    EE   Q   Q ++        K  +E +++ R + FM  FN++ + +   Y+ L    G  A L   +  +P+ + I F    P K ++ + +LSGGEKT+++LAL+FA H+Y P+P + +DEIDAALD  N+  VA +I E   + AQ I+ISL+   +  AD LIGI  T ++ 
Sbjct: 1092 PNLGAISEYKKKEELYLQRVAQLDEITAERDTFKCSYEDLRKRRLNEFMTGFNMITNKLKENYQMLTL--GGDAELELVDSLDPFSEGIMFSVRPPKKSWKKIFNLSGGEKTLSSLALVFALHHYKPTPLYFMDEIDAALDFKNVSIVACYIYEQTKN-AQFIIISLRNNMFEIADRLIGIYKTHNTT 1276          
BLAST of Structural maintenance of chromosomes protein vs. Planmine SMEST
Match: SMESG000022017.1 (SMESG000022017.1)

HSP 1 Score: 985.712 bits (2547), Expect = 0.000e+0
Identity = 512/512 (100.00%), Postives = 512/512 (100.00%), Query Frame = 1
Query:  481 EEKLLSSNXXXXXXXXXXXXXXXXXSERCNTKMQELQISINNEKLKMDSAEDDVFKEFCNSIGVENIRQYEERELIIARERDLKLLDFKNQLQKLKNQHDYEKSRNTQAILDKYSEAMKNEKLEIEKAEANXXXXXXXXXXXXNRRDELETRLAEFKQKCESVDSELADLHRSRNTKQKDIQKLTKEVNQIETRLDSRRADRHSLIQAAKIDDLDLPVKEGSMTIYESTLSQNLNSTGDDLDAGEMGSEEMLRIFKAEEKIQFEYKRLDRSLRSLESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSNLLVSKVYRLDLSQYTDAEEL 2016
            EEKLLSSNEDEMERMNREMIEVEERSERCNTKMQELQISINNEKLKMDSAEDDVFKEFCNSIGVENIRQYEERELIIARERDLKLLDFKNQLQKLKNQHDYEKSRNTQAILDKYSEAMKNEKLEIEKAEANESKLKSEMELLENRRDELETRLAEFKQKCESVDSELADLHRSRNTKQKDIQKLTKEVNQIETRLDSRRADRHSLIQAAKIDDLDLPVKEGSMTIYESTLSQNLNSTGDDLDAGEMGSEEMLRIFKAEEKIQFEYKRLDRSLRSLESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSNLLVSKVYRLDLSQYTDAEEL
Sbjct:  731 EEKLLSSNEDEMERMNREMIEVEERSERCNTKMQELQISINNEKLKMDSAEDDVFKEFCNSIGVENIRQYEERELIIARERDLKLLDFKNQLQKLKNQHDYEKSRNTQAILDKYSEAMKNEKLEIEKAEANESKLKSEMELLENRRDELETRLAEFKQKCESVDSELADLHRSRNTKQKDIQKLTKEVNQIETRLDSRRADRHSLIQAAKIDDLDLPVKEGSMTIYESTLSQNLNSTGDDLDAGEMGSEEMLRIFKAEEKIQFEYKRLDRSLRSLESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGDKLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGIMHTTDSNLLVSKVYRLDLSQYTDAEEL 1242          
BLAST of Structural maintenance of chromosomes protein vs. Planmine SMEST
Match: SMESG000036986.1 (SMESG000036986.1)

HSP 1 Score: 126.331 bits (316), Expect = 1.525e-29
Identity = 80/219 (36.53%), Postives = 122/219 (55.71%), Query Frame = 1
Query: 1387 QTPNLRAGDKLDSVEE--RLRQTE----TQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVDHIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGI---MHTTDSNLLVSKVYRLDLSQYTDAEEL 2016
            Q PNL A ++    EE   LR  E    TQF D +      +   EK+KR R+  F   FN++   +  +Y+ +    G  A L   +  +P+ + I F    P K ++++ +LSGGEKT+++LAL+FA H++ P+PF+V+DEIDAALD  N+  VA++I++   + AQ I+ISL+   Y  AD LIGI    + T + LL  K     L    + E+L
Sbjct: 1076 QKPNLAAIEEYRMKEELYMLRAAELTEVTQFRDQQ------RDQLEKMKRQRHQEFTAGFNLITTKLKEMYQMITM--GGDAELELVDSLDPFSEGILFSVRPPKKSWKNISNLSGGEKTLSSLALVFALHHFKPTPFYVMDEIDAALDFKNVSIVANYIKDRTKN-AQFIIISLRNNMYELADCLIGINKPFNFTKTCLLNLKAVDCSLQHVCNTEKL 1285          
BLAST of Structural maintenance of chromosomes protein vs. Planmine SMEST
Match: SMESG000017173.1 (SMESG000017173.1)

HSP 1 Score: 69.3218 bits (168), Expect = 7.350e-12
Identity = 33/93 (35.48%), Postives = 51/93 (54.84%), Query Frame = 1
Query: 1657 IQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGI 1935
            I+        + + M+ LSGG+K++ AL L+FA    +P+PF++ DEIDAALD      VA  I+  + D AQ I  + + E    A+   G+
Sbjct:  805 IEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKD-AQFITTTFRPEMLEAAERFYGV 896          
BLAST of Structural maintenance of chromosomes protein vs. Planmine SMEST
Match: SMESG000017173.1 (SMESG000017173.1)

HSP 1 Score: 69.3218 bits (168), Expect = 7.701e-12
Identity = 33/93 (35.48%), Postives = 51/93 (54.84%), Query Frame = 1
Query: 1657 IQFQCVAPGKRFQHMDSLSGGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYASDRAQIIVISLKEEFYSRADALIGI 1935
            I+        + + M+ LSGG+K++ AL L+FA    +P+PF++ DEIDAALD      VA  I+  + D AQ I  + + E    A+   G+
Sbjct:  795 IEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKD-AQFITTTFRPEMLEAAERFYGV 886          
The following BLAST results are available for this feature:
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SMC1A1.952e-10542.64structural maintenance of chromosomes 1A [Source:H... [more]
SMC1A2.021e-10542.64structural maintenance of chromosomes 1A [Source:H... [more]
SMC1B1.123e-9640.67structural maintenance of chromosomes 1B [Source:H... [more]
SMC1A4.415e-6045.34structural maintenance of chromosomes 1A [Source:H... [more]
SMC1B3.519e-3330.35structural maintenance of chromosomes 1B [Source:H... [more]
back to top
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
him-11.840e-9238.43Structural maintenance of chromosomes protein 1 [... [more]
him-11.658e-4969.42Structural maintenance of chromosomes protein 1 [... [more]
smc-46.947e-2635.76Structural maintenance of chromosomes protein 4 [... [more]
smc-46.947e-2635.76Structural maintenance of chromosomes protein 4 [... [more]
dpy-279.069e-1941.00Chromosome condensation protein dpy-27 [Source:Un... [more]
back to top
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
SMC15.314e-9939.75gene:FBgn0040283 transcript:FBtr0084541[more]
glu3.571e-2734.15gene:FBgn0015391 transcript:FBtr0080935[more]
SMC24.206e-1723.40gene:FBgn0027783 transcript:FBtr0087461[more]
SMC32.511e-1241.77gene:FBgn0015615 transcript:FBtr0074290[more]
back to top
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smc1a3.896e-10442.53structural maintenance of chromosomes 1A [Source:Z... [more]
smc1al1.623e-10141.63structural maintenance of chromosomes 1A, like [So... [more]
smc1al2.153e-10141.63structural maintenance of chromosomes 1A, like [So... [more]
smc1b1.674e-8238.33structural maintenance of chromosomes 1B [Source:Z... [more]
smc41.147e-2635.05structural maintenance of chromosomes 4 [Source:ZF... [more]
back to top
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sia12.881e-10240.88siamois homeodomain 1 [Source:Xenbase;Acc:XB-GENE-... [more]
sia13.637e-10240.88siamois homeodomain 1 [Source:Xenbase;Acc:XB-GENE-... [more]
sia11.327e-9841.19siamois homeodomain 1 [Source:Xenbase;Acc:XB-GENE-... [more]
sia12.184e-9740.04siamois homeodomain 1 [Source:Xenbase;Acc:XB-GENE-... [more]
sia14.309e-9740.04siamois homeodomain 1 [Source:Xenbase;Acc:XB-GENE-... [more]
back to top
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Smc1a4.764e-10542.31structural maintenance of chromosomes 1A [Source:M... [more]
Smc1b7.763e-9438.85structural maintenance of chromosomes 1B [Source:M... [more]
Smc49.271e-2632.58structural maintenance of chromosomes 4 [Source:MG... [more]
Smc41.040e-2532.58structural maintenance of chromosomes 4 [Source:MG... [more]
Smc21.161e-1426.61structural maintenance of chromosomes 2 [Source:MG... [more]
back to top
BLAST of Structural maintenance of chromosomes protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q14683|SMC1A_HUMAN9.372e-10542.64Structural maintenance of chromosomes protein 1A O... [more]
sp|O97593|SMC1A_BOVIN1.741e-10442.64Structural maintenance of chromosomes protein 1A O... [more]
sp|Q9CU62|SMC1A_MOUSE3.333e-10442.31Structural maintenance of chromosomes protein 1A O... [more]
sp|Q9Z1M9|SMC1A_RAT4.753e-10442.31Structural maintenance of chromosomes protein 1A O... [more]
sp|O93308|SMC1A_XENLA1.449e-10141.79Structural maintenance of chromosomes protein 1A O... [more]
back to top
BLAST of Structural maintenance of chromosomes protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H2KS100.000e+061.64Structural maintenance of chromosome 1 (Fragment) ... [more]
A0A4S2M8U90.000e+061.64Structural maintenance of chromosomes protein OS=O... [more]
A0A419PXH10.000e+061.64Structural maintenance of chromosomes protein OS=C... [more]
A0A1S8WKK30.000e+061.45Structural maintenance of chromosomes protein OS=O... [more]
A0A183SEI10.000e+058.51SMC hinge domain-containing protein OS=Schistoceph... [more]
back to top
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smc1a3.573e-10241.35structural maintenance of chromosomes 1A [Source:N... [more]
smc1al7.984e-8838.41structural maintenance of chromosomes 1A, like [So... [more]
smc1b1.540e-8439.83structural maintenance of chromosomes 1B [Source:Z... [more]
smc1b1.126e-8240.58structural maintenance of chromosomes 1B [Source:Z... [more]
smc42.356e-2634.54structural maintenance of chromosomes 4 [Source:NC... [more]
back to top
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000000346.19.708e-9839.35pep scaffold:Pmarinus_7.0:GL477118:44770:74561:-1 ... [more]
SMC1A1.051e-9340.86structural maintenance of chromosomes 1A [Source:H... [more]
ENSPMAT00000008608.14.125e-2732.14pep scaffold:Pmarinus_7.0:GL477381:37203:71735:-1 ... [more]
smc22.181e-1228.89structural maintenance of chromosomes 2 [Source:ZF... [more]
back to top
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
SMC13.347e-5530.43Subunit of the multiprotein cohesin complex; essen... [more]
SMC42.739e-2838.73Subunit of the condensin complex; condensin reorga... [more]
SMC31.738e-1035.37Subunit of the multiprotein cohesin complex; requi... [more]
SMC21.950e-1038.03Subunit of the condensin complex; condensin reorga... [more]
back to top
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO495961.074e-11642.77Structural maintenance of chromosomes protein [So... [more]
EDO406465.326e-2838.41Structural maintenance of chromosomes protein [So... [more]
EDO341351.070e-1343.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smc1al2.664e-10341.56structural maintenance of chromosomes 1A [Source:N... [more]
smc1b1.098e-6735.73meiosis-specific cohesin subunit SMC1 beta [Source... [more]
smc1b2.685e-4635.64meiosis-specific cohesin subunit SMC1 beta [Source... [more]
smc41.326e-2735.64structural maintenance of chromosomes 4 [Source:NC... [more]
smc41.378e-2735.64structural maintenance of chromosomes 4 [Source:NC... [more]
back to top
BLAST of Structural maintenance of chromosomes protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000022017.10.000e+0100.00SMESG000022017.1[more]
SMESG000036986.11.525e-2936.53SMESG000036986.1[more]
SMESG000017173.17.350e-1235.48SMESG000017173.1[more]
SMESG000017173.17.701e-1235.48SMESG000017173.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029269 ID=SMED30029269|Name=Structural maintenance of chromosomes protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2123bp
GAAAGAAATAACAATAAATAGGTAAAATATGAAAAAATCATACATATTTG
TAATCACAAATAGCTCTAACTCATTTTCACTAGAAGTGACTTATGCCACT
TTCAAAACTAATGGCTCGTGTAATATGCTCAAGTGTTTGCTGCATCCTGA
AAAAATAGTCAACCTACATCTTTCAATGAGGCTGGAACTAAAAAACACTA
TTTCAACCAGACATAAACTCTTTTACGATCTCTTAGTGTTTGGAATAATC
GGCTCAGTTTCGAACTCATTTATACGATTTCATTCGAATTTACCATATAA
TATTCCATACAAGTCCGCTATAGTCGATATTACGGATAAAGGCTTTACTA
ATTTATTAATTATAGAAATAAACAAAAATATGTAATATTTTTTAGTTTTT
TGGACTTAATAATGACTGCTGAAAATTTTATATAAAATTTTTTGTTAATT
TATAGTTATGTAAAAAAATCATGATTTTAGGAAGAAAAACTCCTTAGTTC
TAATGAAGATGAAATGGAAAGAATGAATAGAGAAATGATTGAAGTTGAAG
AACGAAGTGAAAGATGTAACACCAAAATGCAAGAGTTACAAATTAGTATT
AATAATGAAAAATTGAAAATGGATTCAGCTGAAGATGATGTTTTTAAGGA
ATTTTGCAATTCAATTGGCGTTGAGAATATTAGACAATATGAAGAGCGAG
AACTTATTATTGCTCGAGAACGAGATTTAAAACTTCTTGATTTTAAGAAT
CAACTTCAAAAATTAAAAAATCAACATGATTACGAAAAATCACGAAATAC
TCAAGCTATTTTGGACAAGTATTCAGAGGCCATGAAAAACGAAAAATTGG
AAATTGAAAAGGCTGAAGCAAATGAAAGTAAATTAAAATCAGAAATGGAG
TTATTGGAAAATAGACGAGATGAACTGGAAACTAGGCTAGCGGAATTCAA
GCAGAAATGTGAATCGGTCGACAGTGAACTGGCTGATTTGCATCGATCGA
GAAACACTAAACAAAAGGATATACAAAAGTTAACTAAAGAAGTAAATCAA
ATCGAAACAAGATTGGACAGCCGTAGAGCCGATAGGCATTCACTTATTCA
AGCGGCAAAAATTGATGATCTTGATCTTCCTGTTAAAGAAGGATCAATGA
CAATTTACGAAAGCACATTATCTCAAAATCTCAATTCCACTGGAGATGAT
TTAGATGCCGGAGAAATGGGCAGTGAGGAAATGCTGCGCATTTTTAAGGC
AGAAGAAAAAATTCAATTTGAATACAAAAGATTGGACCGGTCATTGAGGT
CGTTGGAATCCGAAGCGGAAGTAAATAAGAGAGTGGAACACATACAAAAT
GAGGTCGATCAAATGATGTGCAATATCCAAAAAATTCAAACTCCAAATTT
GAGAGCAGGCGATAAATTGGACAGTGTCGAAGAGAGATTGAGACAAACCG
AAACCCAATTCGAGGATACGAGACATAGGGCTAGGAAAGCGAAAATGGAC
TTTGAAAAAGTCAAAAGATGTCGCTATGATAGATTTATGAATTGCTTCAA
TGTTGTTGTTGATCACATCGATGGAATTTACAAAAACCTCGCGAGAAATC
CCGGTGCACAGGCAAGTTTATTACCTACTAATCACGAGGAGCCATACCTG
GATGAAATACAATTCCAATGCGTAGCTCCAGGGAAAAGATTTCAACATAT
GGATAGTTTAAGTGGTGGTGAAAAAACAATAGCAGCTCTAGCATTGTTAT
TTGCAACACACAATTACAATCCTTCTCCATTTTTTGTATTGGACGAGATC
GACGCAGCCCTAGACAACACAAATATTGGAAAAGTGGCAAGTTTCATTAG
GGAATATGCTAGTGACAGGGCCCAAATTATTGTTATTTCATTGAAAGAAG
AGTTCTATAGCAGAGCTGATGCACTGATTGGAATAATGCATACAACAGAT
TCAAATCTCCTGGTCAGTAAAGTTTATCGATTAGATCTTAGTCAATACAC
CGATGCTGAAGAGCTATGATGTTAAATTTCCCTGTATTTTATATTTCTTG
TGATTATCTGTAATAAATTTGCTATGTTTATATTGTTTTATTATTTTTGG
TTTGGTGTATATTTATGTGTTCA
back to top

protein sequence of SMED30029269-orf-1

>SMED30029269-orf-1 ID=SMED30029269-orf-1|Name=SMED30029269-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=502bp
MERMNREMIEVEERSERCNTKMQELQISINNEKLKMDSAEDDVFKEFCNS
IGVENIRQYEERELIIARERDLKLLDFKNQLQKLKNQHDYEKSRNTQAIL
DKYSEAMKNEKLEIEKAEANESKLKSEMELLENRRDELETRLAEFKQKCE
SVDSELADLHRSRNTKQKDIQKLTKEVNQIETRLDSRRADRHSLIQAAKI
DDLDLPVKEGSMTIYESTLSQNLNSTGDDLDAGEMGSEEMLRIFKAEEKI
QFEYKRLDRSLRSLESEAEVNKRVEHIQNEVDQMMCNIQKIQTPNLRAGD
KLDSVEERLRQTETQFEDTRHRARKAKMDFEKVKRCRYDRFMNCFNVVVD
HIDGIYKNLARNPGAQASLLPTNHEEPYLDEIQFQCVAPGKRFQHMDSLS
GGEKTIAALALLFATHNYNPSPFFVLDEIDAALDNTNIGKVASFIREYAS
DRAQIIVISLKEEFYSRADALIGIMHTTDSNLLVSKVYRLDLSQYTDAEE
L*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR003395RecF/RecN/SMC_N
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0003682chromatin binding
GO:0005524ATP binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005694chromosome
GO:0008278cohesin complex
Vocabulary: biological process
TermDefinition
GO:0006281DNA repair
GO:0007064mitotic sister chromatid cohesion
GO:0051276chromosome organization
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1..42
NoneNo IPR availableCOILSCoilCoilcoord: 67..87
NoneNo IPR availableCOILSCoilCoilcoord: 100..190
NoneNo IPR availableCOILSCoilCoilcoord: 247..267
NoneNo IPR availableCOILSCoilCoilcoord: 295..322
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 220..497
e-value: 1.6E-44
score: 154.9
NoneNo IPR availablePANTHERPTHR18937STRUCTURAL MAINTENANCE OF CHROMOSOMES SMC FAMILY MEMBERcoord: 3..499
IPR003395RecF/RecN/SMC, N-terminalPFAMPF02463SMC_Ncoord: 91..478
e-value: 6.6E-29
score: 100.9
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 264..479