Werner syndrome ATP-dependent helicase

Overview
NameWerner syndrome ATP-dependent helicase
Smed IDSMED30029264
Length (bp)708
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Werner syndrome ATP-dependent helicase (SMED30029264) t-SNE clustered cells

Violin plots show distribution of expression levels for Werner syndrome ATP-dependent helicase (SMED30029264) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Werner syndrome ATP-dependent helicase (SMED30029264) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Werner syndrome ATP-dependent helicase (SMED30029264) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029264

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30029264SMESG000065456.1 SMESG000047271.1 SmedASXL_011461SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
zeta neoblastSMED30029264SMESG000065456.1 SMESG000047271.1 dd_Smed_v4_16426_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029264SMESG000065456.1 SMESG000047271.1 SMED_08941_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30029264SMESG000065456.1 SMESG000047271.1 SMED_08941_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Werner syndrome ATP-dependent helicase vs. Ensembl Human
Match: WRN (WRN RecQ like helicase [Source:HGNC Symbol;Acc:HGNC:12791])

HSP 1 Score: 108.997 bits (271), Expect = 1.339e-26
Identity = 65/188 (34.57%), Postives = 107/188 (56.91%), Query Frame = 2
Query:  125 FNYSGKIVYSAETNEINMWSKLILDDFGKLPIID-KVIGFDMEWP--MNR----KTAVVQLYSEMHGVFVFQI--LTLLPNVLLEIIRNNSIKKVGLNIANDIKKLEKDFDQNLDDVIINGLCDVGNLARKKFNNSERWSLSNLILNLTGQILPKPSAIRCGNWNQFPLSGEQIKYAGLDSYASFYAY 661
              ++G IVYS + ++ +  S+ I      + + D  V+GFDMEWP   NR    K A++QL       ++F +  +++ P  L  ++ N ++KK G+ I  D  KL +DFD  L + +     ++ ++A KK   +E WSL++L+ +L G+ L K  +IRC NW++FPL+ +Q  YA  D+YA F  Y
Sbjct:   47 LEFTGSIVYSYDASDCSFLSEDI-----SMSLSDGDVVGFDMEWPPLYNRGKLGKVALIQLCVSESKCYLFHVSSMSVFPQGLKMLLENKAVKKAGVGIEGDQWKLLRDFDIKLKNFV-----ELTDVANKKLKCTETWSLNSLVKHLLGKQLLKDKSIRCSNWSKFPLTEDQKLYAATDAYAGFIIY 224          
BLAST of Werner syndrome ATP-dependent helicase vs. Ensembl Human
Match: EXD2 (exonuclease 3'-5' domain containing 2 [Source:HGNC Symbol;Acc:HGNC:20217])

HSP 1 Score: 53.9138 bits (128), Expect = 8.071e-8
Identity = 48/191 (25.13%), Postives = 86/191 (45.03%), Query Frame = 2
Query:  137 GKIVYSAETNEINMWSKLILDDFGKLPIIDKVIGFDMEW----PMNRKTAVVQLYSEMHGVFVFQILTL------LPNVLLEIIRNNSIKKVGLNIANDIKKLEKDFDQNLDDVIINGLCDVGNLARKKFNN--SERWSLSNLILNLTGQILPKPSAIRCGNWNQFPLSGEQIKYAGLDSYASFYAYSLLM 673
             K+V  ++  E +    L+  +    P    V+G D EW          +++Q+ S      + ++  L      LP  LL+I+ + +I KVG+  + D  KL +D+      +++ G  D+  LA ++ NN      SL +L   +    L K   +RC NW+   L+ +Q+ YA  D+  S   +  L+
Sbjct:   77 AKVVTVSQEAEWDQIEPLLRSELEDFP----VLGIDCEWVNLEGKASPLSLLQMASPSGLCVLVRLPKLICGGKTLPRTLLDILADGTILKVGVGCSEDASKLLQDYG-----LVVRGCLDLRYLAMRQRNNLLCNGLSLKSLAETVLNFPLDKSLLLRCSNWDAETLTEDQVIYAARDAQISVALFLHLL 258          
BLAST of Werner syndrome ATP-dependent helicase vs. Ensembl Human
Match: EXD2 (exonuclease 3'-5' domain containing 2 [Source:HGNC Symbol;Acc:HGNC:20217])

HSP 1 Score: 53.9138 bits (128), Expect = 8.071e-8
Identity = 48/191 (25.13%), Postives = 86/191 (45.03%), Query Frame = 2
Query:  137 GKIVYSAETNEINMWSKLILDDFGKLPIIDKVIGFDMEW----PMNRKTAVVQLYSEMHGVFVFQILTL------LPNVLLEIIRNNSIKKVGLNIANDIKKLEKDFDQNLDDVIINGLCDVGNLARKKFNN--SERWSLSNLILNLTGQILPKPSAIRCGNWNQFPLSGEQIKYAGLDSYASFYAYSLLM 673
             K+V  ++  E +    L+  +    P    V+G D EW          +++Q+ S      + ++  L      LP  LL+I+ + +I KVG+  + D  KL +D+      +++ G  D+  LA ++ NN      SL +L   +    L K   +RC NW+   L+ +Q+ YA  D+  S   +  L+
Sbjct:   77 AKVVTVSQEAEWDQIEPLLRSELEDFP----VLGIDCEWVNLEGKASPLSLLQMASPSGLCVLVRLPKLICGGKTLPRTLLDILADGTILKVGVGCSEDASKLLQDYG-----LVVRGCLDLRYLAMRQRNNLLCNGLSLKSLAETVLNFPLDKSLLLRCSNWDAETLTEDQVIYAARDAQISVALFLHLL 258          
BLAST of Werner syndrome ATP-dependent helicase vs. Ensembl Human
Match: EXD2 (exonuclease 3'-5' domain containing 2 [Source:HGNC Symbol;Acc:HGNC:20217])

HSP 1 Score: 50.8322 bits (120), Expect = 6.863e-7
Identity = 35/116 (30.17%), Postives = 59/116 (50.86%), Query Frame = 2
Query:  332 LPNVLLEIIRNNSIKKVGLNIANDIKKLEKDFDQNLDDVIINGLCDVGNLARKKFNN--SERWSLSNLILNLTGQILPKPSAIRCGNWNQFPLSGEQIKYAGLDSYASFYAYSLLM 673
            LP  LL+I+ + +I KVG+  + D  KL +D+      +++ G  D+  LA ++ NN      SL +L   +    L K   +RC NW+   L+ +Q+ YA  D+  S   +  L+
Sbjct:   23 LPRTLLDILADGTILKVGVGCSEDASKLLQDYG-----LVVRGCLDLRYLAMRQRNNLLCNGLSLKSLAETVLNFPLDKSLLLRCSNWDAETLTEDQVIYAARDAQISVALFLHLL 133          
BLAST of Werner syndrome ATP-dependent helicase vs. Ensembl Human
Match: EXD2 (exonuclease 3'-5' domain containing 2 [Source:HGNC Symbol;Acc:HGNC:20217])

HSP 1 Score: 50.8322 bits (120), Expect = 6.863e-7
Identity = 35/116 (30.17%), Postives = 59/116 (50.86%), Query Frame = 2
Query:  332 LPNVLLEIIRNNSIKKVGLNIANDIKKLEKDFDQNLDDVIINGLCDVGNLARKKFNN--SERWSLSNLILNLTGQILPKPSAIRCGNWNQFPLSGEQIKYAGLDSYASFYAYSLLM 673
            LP  LL+I+ + +I KVG+  + D  KL +D+      +++ G  D+  LA ++ NN      SL +L   +    L K   +RC NW+   L+ +Q+ YA  D+  S   +  L+
Sbjct:   23 LPRTLLDILADGTILKVGVGCSEDASKLLQDYG-----LVVRGCLDLRYLAMRQRNNLLCNGLSLKSLAETVLNFPLDKSLLLRCSNWDAETLTEDQVIYAARDAQISVALFLHLL 133          
BLAST of Werner syndrome ATP-dependent helicase vs. Ensembl Fly
Match: WRNexo (gene:FBgn0038608 transcript:FBtr0083586)

HSP 1 Score: 83.1889 bits (204), Expect = 2.318e-18
Identity = 58/207 (28.02%), Postives = 96/207 (46.38%), Query Frame = 2
Query:   95 PSFRTNKVENF---NYSGKIVYSAETNEINMWSKLILDDFGKLPIIDKVI--GFDMEWPMN-----RKTAVVQLYSEMHGVFVFQILTL--LPNVLLEIIRNNSIKKVGLNIANDIKKLEKDFDQNLDDVIINGLCDVGNLARKKFNNSERWSLSNLILNLTGQILPKPSAIRCGNWNQFPLSGEQIKYAGLDSYASFYAYSLLMKK 679
            PS    K E      Y G I Y  E+ +I   +  +L    K    D+V+   FDMEWP +      K+AV+Q+  +    +++Q+  +  LP  L+ +I +  ++  G+NI ND +KL +DF +   + +I    D+G    +      RWSL  L   +  + + K   +R   W+  PL   Q+ YA +D Y     Y  L ++
Sbjct:  110 PSPEKEKPEKLPFIKYKGAIKYFTESQDIAASADDVLQWVEKQ--KDEVVPMAFDMEWPFSFQTGPGKSAVIQICVDEKCCYIYQLTNVKKLPAALVALINHPKVRLHGVNIKNDFRKLARDFPEVTAEPLIEKCVDLGLWCNEVCETGGRWSLERLTNFIAKKAMDKSKKVRMSKWHVIPLDENQLMYAAIDVYIGQVIYRELERR 314          
BLAST of Werner syndrome ATP-dependent helicase vs. Ensembl Fly
Match: WRNexo (gene:FBgn0038608 transcript:FBtr0339976)

HSP 1 Score: 83.1889 bits (204), Expect = 2.364e-18
Identity = 58/207 (28.02%), Postives = 96/207 (46.38%), Query Frame = 2
Query:   95 PSFRTNKVENF---NYSGKIVYSAETNEINMWSKLILDDFGKLPIIDKVI--GFDMEWPMN-----RKTAVVQLYSEMHGVFVFQILTL--LPNVLLEIIRNNSIKKVGLNIANDIKKLEKDFDQNLDDVIINGLCDVGNLARKKFNNSERWSLSNLILNLTGQILPKPSAIRCGNWNQFPLSGEQIKYAGLDSYASFYAYSLLMKK 679
            PS    K E      Y G I Y  E+ +I   +  +L    K    D+V+   FDMEWP +      K+AV+Q+  +    +++Q+  +  LP  L+ +I +  ++  G+NI ND +KL +DF +   + +I    D+G    +      RWSL  L   +  + + K   +R   W+  PL   Q+ YA +D Y     Y  L ++
Sbjct:  110 PSPEKEKPEKLPFIKYKGAIKYFTESQDIAASADDVLQWVEKQ--KDEVVPMAFDMEWPFSFQTGPGKSAVIQICVDEKCCYIYQLTNVKKLPAALVALINHPKVRLHGVNIKNDFRKLARDFPEVTAEPLIEKCVDLGLWCNEVCETGGRWSLERLTNFIAKKAMDKSKKVRMSKWHVIPLDENQLMYAAIDVYIGQVIYRELERR 314          
BLAST of Werner syndrome ATP-dependent helicase vs. Ensembl Fly
Match: WRNexo (gene:FBgn0038608 transcript:FBtr0302307)

HSP 1 Score: 83.1889 bits (204), Expect = 2.431e-18
Identity = 58/207 (28.02%), Postives = 96/207 (46.38%), Query Frame = 2
Query:   95 PSFRTNKVENF---NYSGKIVYSAETNEINMWSKLILDDFGKLPIIDKVI--GFDMEWPMN-----RKTAVVQLYSEMHGVFVFQILTL--LPNVLLEIIRNNSIKKVGLNIANDIKKLEKDFDQNLDDVIINGLCDVGNLARKKFNNSERWSLSNLILNLTGQILPKPSAIRCGNWNQFPLSGEQIKYAGLDSYASFYAYSLLMKK 679
            PS    K E      Y G I Y  E+ +I   +  +L    K    D+V+   FDMEWP +      K+AV+Q+  +    +++Q+  +  LP  L+ +I +  ++  G+NI ND +KL +DF +   + +I    D+G    +      RWSL  L   +  + + K   +R   W+  PL   Q+ YA +D Y     Y  L ++
Sbjct:  111 PSPEKEKPEKLPFIKYKGAIKYFTESQDIAASADDVLQWVEKQ--KDEVVPMAFDMEWPFSFQTGPGKSAVIQICVDEKCCYIYQLTNVKKLPAALVALINHPKVRLHGVNIKNDFRKLARDFPEVTAEPLIEKCVDLGLWCNEVCETGGRWSLERLTNFIAKKAMDKSKKVRMSKWHVIPLDENQLMYAAIDVYIGQVIYRELERR 315          
BLAST of Werner syndrome ATP-dependent helicase vs. Ensembl Fly
Match: Exd2 (gene:FBgn0037901 transcript:FBtr0308211)

HSP 1 Score: 51.2174 bits (121), Expect = 2.837e-7
Identity = 43/157 (27.39%), Postives = 69/157 (43.95%), Query Frame = 2
Query:  227 KVIGFDMEW----PMNRKTAVVQLYSEMHGVFVFQILTL--LPNVLLEIIRNNSIKKVGLNIANDIKKLEKDFDQNLDDVI-INGLCDVGNLARKKFNNSERWSLSNLILNLTGQILPKPSAIRCGNWNQFPLSGEQIKYAGLDSYASFYAYSLLMK 676
            KV+GFD EW       R  A++QL S      +F++  +  +P  L E++ ++S+ KVG+    D  KL  D+   +   + +  LC +     +         LS   LN T   L K   + C NW    L  +Q+ YA  D+  +   Y  L +
Sbjct:   78 KVLGFDCEWITVGGSRRPVALLQLSSHRGLCALFRLCHMKQIPQDLRELLEDDSVIKVGVAPQEDAMKLSHDYGVGVASTLDLRFLCVMAGHKPEGLGK-----LSKTHLNYT---LDKHWRLACSNWEAKTLEPKQLDYAANDALMAVAIYQKLCR 226          
BLAST of Werner syndrome ATP-dependent helicase vs. Ensembl Fly
Match: Exd2 (gene:FBgn0037901 transcript:FBtr0082402)

HSP 1 Score: 51.2174 bits (121), Expect = 2.837e-7
Identity = 43/157 (27.39%), Postives = 69/157 (43.95%), Query Frame = 2
Query:  227 KVIGFDMEW----PMNRKTAVVQLYSEMHGVFVFQILTL--LPNVLLEIIRNNSIKKVGLNIANDIKKLEKDFDQNLDDVI-INGLCDVGNLARKKFNNSERWSLSNLILNLTGQILPKPSAIRCGNWNQFPLSGEQIKYAGLDSYASFYAYSLLMK 676
            KV+GFD EW       R  A++QL S      +F++  +  +P  L E++ ++S+ KVG+    D  KL  D+   +   + +  LC +     +         LS   LN T   L K   + C NW    L  +Q+ YA  D+  +   Y  L +
Sbjct:   78 KVLGFDCEWITVGGSRRPVALLQLSSHRGLCALFRLCHMKQIPQDLRELLEDDSVIKVGVAPQEDAMKLSHDYGVGVASTLDLRFLCVMAGHKPEGLGK-----LSKTHLNYT---LDKHWRLACSNWEAKTLEPKQLDYAANDALMAVAIYQKLCR 226          
BLAST of Werner syndrome ATP-dependent helicase vs. Ensembl Zebrafish
Match: BX324002.1 (WRN RecQ like helicase [Source:NCBI gene;Acc:569495])

HSP 1 Score: 97.8265 bits (242), Expect = 7.528e-23
Identity = 60/205 (29.27%), Postives = 103/205 (50.24%), Query Frame = 2
Query:   98 SFRTNKVEN----FNYSGKIVYSAETNEINMWSKLILDDFGKLPIIDKVIGFDMEWP------MNRKTAVVQLYSEMHGVFVFQILTL--LPNVLLEIIRNNSIKKVGLNIANDIKKLEKDFDQNLDDVIINGLCDVGNLARKKFNNSERWSLSNLILNLTGQILPKPSAIRCGNWNQFPLSGEQIKYAGLDSYASFYAYSLLMK 676
            +++ N +E+      + G +VYS E ++ +  S    +D          +GFD+EWP        +K A+VQL +     ++F I ++   P  L   + + +I KVG+ I  D  KL  D+D  L +++     D+ +LA +K    E+WSL  L+ +L  + L K   +RC +W+ F L+ +Q +YA  D+YA    Y  L +
Sbjct:   22 TYKKNVLEDHLPYLEFGGTVVYSQERHDCSFLS----EDLRSALSSGSAVGFDLEWPPSFTKGKTKKVAMVQLCASEDKCYLFHISSMSGFPPGLKMFLEDENIMKVGVGIEGDKWKLLSDYDIKLKNIV-----DLSDLANEKLRCCEKWSLDGLVKHLLKKQLFKDKLVRCSHWDDFSLTEDQKRYAATDAYAGLLIYQKLQE 217          
BLAST of Werner syndrome ATP-dependent helicase vs. Ensembl Zebrafish
Match: wrn (WRN RecQ like helicase [Source:ZFIN;Acc:ZDB-GENE-070702-2])

HSP 1 Score: 97.8265 bits (242), Expect = 7.531e-23
Identity = 60/205 (29.27%), Postives = 103/205 (50.24%), Query Frame = 2
Query:   98 SFRTNKVEN----FNYSGKIVYSAETNEINMWSKLILDDFGKLPIIDKVIGFDMEWP------MNRKTAVVQLYSEMHGVFVFQILTL--LPNVLLEIIRNNSIKKVGLNIANDIKKLEKDFDQNLDDVIINGLCDVGNLARKKFNNSERWSLSNLILNLTGQILPKPSAIRCGNWNQFPLSGEQIKYAGLDSYASFYAYSLLMK 676
            +++ N +E+      + G +VYS E ++ +  S    +D          +GFD+EWP        +K A+VQL +     ++F I ++   P  L   + + +I KVG+ I  D  KL  D+D  L +++     D+ +LA +K    E+WSL  L+ +L  + L K   +RC +W+ F L+ +Q +YA  D+YA    Y  L +
Sbjct:   22 TYKKNVLEDHLPYLEFGGTVVYSQERHDCSFLS----EDLRSALSSGSAVGFDLEWPPSFTKGKTKKVAMVQLCASEDKCYLFHISSMSGFPPGLKMFLEDENIMKVGVGIEGDKWKLLSDYDIKLKNIV-----DLSDLANEKLRCCEKWSLDGLVKHLLKKQLFKDKLVRCSHWDDFSLTEDQKRYAATDAYAGLLIYQKLQE 217          
BLAST of Werner syndrome ATP-dependent helicase vs. Ensembl Zebrafish
Match: BX324002.1 (WRN RecQ like helicase [Source:NCBI gene;Acc:569495])

HSP 1 Score: 97.8265 bits (242), Expect = 7.563e-23
Identity = 60/205 (29.27%), Postives = 103/205 (50.24%), Query Frame = 2
Query:   98 SFRTNKVEN----FNYSGKIVYSAETNEINMWSKLILDDFGKLPIIDKVIGFDMEWP------MNRKTAVVQLYSEMHGVFVFQILTL--LPNVLLEIIRNNSIKKVGLNIANDIKKLEKDFDQNLDDVIINGLCDVGNLARKKFNNSERWSLSNLILNLTGQILPKPSAIRCGNWNQFPLSGEQIKYAGLDSYASFYAYSLLMK 676
            +++ N +E+      + G +VYS E ++ +  S    +D          +GFD+EWP        +K A+VQL +     ++F I ++   P  L   + + +I KVG+ I  D  KL  D+D  L +++     D+ +LA +K    E+WSL  L+ +L  + L K   +RC +W+ F L+ +Q +YA  D+YA    Y  L +
Sbjct:   22 TYKKNVLEDHLPYLEFGGTVVYSQERHDCSFLS----EDLRSALSSGSAVGFDLEWPPSFTKGKTKKVAMVQLCASEDKCYLFHISSMSGFPPGLKMFLEDENIMKVGVGIEGDKWKLLSDYDIKLKNIV-----DLSDLANEKLRCCEKWSLDGLVKHLLKKQLFKDKLVRCSHWDDFSLTEDQKRYAATDAYAGLLIYQKLQE 217          
BLAST of Werner syndrome ATP-dependent helicase vs. Ensembl Zebrafish
Match: wrn (WRN RecQ like helicase [Source:ZFIN;Acc:ZDB-GENE-070702-2])

HSP 1 Score: 97.8265 bits (242), Expect = 7.565e-23
Identity = 60/205 (29.27%), Postives = 103/205 (50.24%), Query Frame = 2
Query:   98 SFRTNKVEN----FNYSGKIVYSAETNEINMWSKLILDDFGKLPIIDKVIGFDMEWP------MNRKTAVVQLYSEMHGVFVFQILTL--LPNVLLEIIRNNSIKKVGLNIANDIKKLEKDFDQNLDDVIINGLCDVGNLARKKFNNSERWSLSNLILNLTGQILPKPSAIRCGNWNQFPLSGEQIKYAGLDSYASFYAYSLLMK 676
            +++ N +E+      + G +VYS E ++ +  S    +D          +GFD+EWP        +K A+VQL +     ++F I ++   P  L   + + +I KVG+ I  D  KL  D+D  L +++     D+ +LA +K    E+WSL  L+ +L  + L K   +RC +W+ F L+ +Q +YA  D+YA    Y  L +
Sbjct:   22 TYKKNVLEDHLPYLEFGGTVVYSQERHDCSFLS----EDLRSALSSGSAVGFDLEWPPSFTKGKTKKVAMVQLCASEDKCYLFHISSMSGFPPGLKMFLEDENIMKVGVGIEGDKWKLLSDYDIKLKNIV-----DLSDLANEKLRCCEKWSLDGLVKHLLKKQLFKDKLVRCSHWDDFSLTEDQKRYAATDAYAGLLIYQKLQE 217          
BLAST of Werner syndrome ATP-dependent helicase vs. Ensembl Zebrafish
Match: wrn (WRN RecQ like helicase [Source:ZFIN;Acc:ZDB-GENE-070702-2])

HSP 1 Score: 97.8265 bits (242), Expect = 7.565e-23
Identity = 60/205 (29.27%), Postives = 103/205 (50.24%), Query Frame = 2
Query:   98 SFRTNKVEN----FNYSGKIVYSAETNEINMWSKLILDDFGKLPIIDKVIGFDMEWP------MNRKTAVVQLYSEMHGVFVFQILTL--LPNVLLEIIRNNSIKKVGLNIANDIKKLEKDFDQNLDDVIINGLCDVGNLARKKFNNSERWSLSNLILNLTGQILPKPSAIRCGNWNQFPLSGEQIKYAGLDSYASFYAYSLLMK 676
            +++ N +E+      + G +VYS E ++ +  S    +D          +GFD+EWP        +K A+VQL +     ++F I ++   P  L   + + +I KVG+ I  D  KL  D+D  L +++     D+ +LA +K    E+WSL  L+ +L  + L K   +RC +W+ F L+ +Q +YA  D+YA    Y  L +
Sbjct:   22 TYKKNVLEDHLPYLEFGGTVVYSQERHDCSFLS----EDLRSALSSGSAVGFDLEWPPSFTKGKTKKVAMVQLCASEDKCYLFHISSMSGFPPGLKMFLEDENIMKVGVGIEGDKWKLLSDYDIKLKNIV-----DLSDLANEKLRCCEKWSLDGLVKHLLKKQLFKDKLVRCSHWDDFSLTEDQKRYAATDAYAGLLIYQKLQE 217          
BLAST of Werner syndrome ATP-dependent helicase vs. Ensembl Xenopus
Match: cdip1 (cell death-inducing p53 target 1 [Source:Xenbase;Acc:XB-GENE-5752851])

HSP 1 Score: 102.064 bits (253), Expect = 3.495e-24
Identity = 63/190 (33.16%), Postives = 99/190 (52.11%), Query Frame = 2
Query:  125 FNYSGKIVYSAETNEINMWSKLILDDFGKLPIIDKVIGFDMEWP------MNRKTAVVQLYSEMHGVFVFQILTL--LPNVLLEIIRNNSIKKVGLNIANDIKKLEKDFDQNLDDVIINGLCDVGNLARKKFNNSERWSLSNLILNLTGQILPKPSAIRCGNWNQFPLSGEQIKYAGLDSYASFYAYSLL 670
              ++G IVYS E N+ ++ S+ I     +    + V+GFD+EWP         K A++Q+       ++F I  +   P  L  ++ + S+KKVG+ I  D  KL  D++  L      G  ++  +A +K    E+WSL+ L+ +L  + L K S+IRC NW+ FPLS +Q  YA  D+YA    Y  L
Sbjct:   41 LKFNGSIVYSYEGNDCSLLSEDIRSSLQE----EDVLGFDIEWPPIYTKGKTGKVALIQVCVSEKKCYLFHISPMAGFPKGLRRLLEDESVKKVGVGIEGDQWKLMSDYELKL-----KGFIELSEVANQKLRCKEKWSLNGLVKHLFKKQLLKDSSIRCSNWDIFPLSTDQKLYAASDAYAGLLIYQKL 221          
BLAST of Werner syndrome ATP-dependent helicase vs. Ensembl Xenopus
Match: cdip1 (cell death-inducing p53 target 1 [Source:Xenbase;Acc:XB-GENE-5752851])

HSP 1 Score: 99.3673 bits (246), Expect = 2.627e-23
Identity = 61/188 (32.45%), Postives = 98/188 (52.13%), Query Frame = 2
Query:  125 FNYSGKIVYSAETNEINMWSKLILDDFGKLPIIDKVIGFDMEWP------MNRKTAVVQLYSEMHGVFVFQILTL--LPNVLLEIIRNNSIKKVGLNIANDIKKLEKDFDQNLDDVIINGLCDVGNLARKKFNNSERWSLSNLILNLTGQILPKPSAIRCGNWNQFPLSGEQIKYAGLDSYASFYAYS 664
              ++G IVYS E N+ ++ S+ I     +    + V+GFD+EWP         K A++Q+       ++F I  +   P  L  ++ + S+KKVG+ I  D  KL  D++  L      G  ++  +A +K    E+WSL+ L+ +L  + L K S+IRC NW+ FPLS +Q  YA  D+Y     +S
Sbjct:   43 LKFNGSIVYSYEGNDCSLLSEDIRSSLQE----EDVLGFDIEWPPIYTKGKTGKVALIQVCVSEKKCYLFHISPMAGFPKGLRRLLEDESVKKVGVGIEGDQWKLMSDYELKL-----KGFIELSEVANQKLRCKEKWSLNGLVKHLFKKQLLKDSSIRCSNWDIFPLSTDQKLYAASDAYVRCIHFS 221          
BLAST of Werner syndrome ATP-dependent helicase vs. Ensembl Xenopus
Match: cdip1 (cell death-inducing p53 target 1 [Source:Xenbase;Acc:XB-GENE-5752851])

HSP 1 Score: 99.3673 bits (246), Expect = 3.016e-23
Identity = 61/188 (32.45%), Postives = 98/188 (52.13%), Query Frame = 2
Query:  125 FNYSGKIVYSAETNEINMWSKLILDDFGKLPIIDKVIGFDMEWP------MNRKTAVVQLYSEMHGVFVFQILTL--LPNVLLEIIRNNSIKKVGLNIANDIKKLEKDFDQNLDDVIINGLCDVGNLARKKFNNSERWSLSNLILNLTGQILPKPSAIRCGNWNQFPLSGEQIKYAGLDSYASFYAYS 664
              ++G IVYS E N+ ++ S+ I     +    + V+GFD+EWP         K A++Q+       ++F I  +   P  L  ++ + S+KKVG+ I  D  KL  D++  L      G  ++  +A +K    E+WSL+ L+ +L  + L K S+IRC NW+ FPLS +Q  YA  D+Y     +S
Sbjct:   43 LKFNGSIVYSYEGNDCSLLSEDIRSSLQE----EDVLGFDIEWPPIYTKGKTGKVALIQVCVSEKKCYLFHISPMAGFPKGLRRLLEDESVKKVGVGIEGDQWKLMSDYELKL-----KGFIELSEVANQKLRCKEKWSLNGLVKHLFKKQLLKDSSIRCSNWDIFPLSTDQKLYAASDAYVRCIHFS 221          
BLAST of Werner syndrome ATP-dependent helicase vs. Ensembl Xenopus
Match: cdip1 (cell death-inducing p53 target 1 [Source:Xenbase;Acc:XB-GENE-5752851])

HSP 1 Score: 98.9821 bits (245), Expect = 3.604e-23
Identity = 61/188 (32.45%), Postives = 98/188 (52.13%), Query Frame = 2
Query:  125 FNYSGKIVYSAETNEINMWSKLILDDFGKLPIIDKVIGFDMEWP------MNRKTAVVQLYSEMHGVFVFQILTL--LPNVLLEIIRNNSIKKVGLNIANDIKKLEKDFDQNLDDVIINGLCDVGNLARKKFNNSERWSLSNLILNLTGQILPKPSAIRCGNWNQFPLSGEQIKYAGLDSYASFYAYS 664
              ++G IVYS E N+ ++ S+ I     +    + V+GFD+EWP         K A++Q+       ++F I  +   P  L  ++ + S+KKVG+ I  D  KL  D++  L      G  ++  +A +K    E+WSL+ L+ +L  + L K S+IRC NW+ FPLS +Q  YA  D+Y     +S
Sbjct:   43 LKFNGSIVYSYEGNDCSLLSEDIRSSLQE----EDVLGFDIEWPPIYTKGKTGKVALIQVCVSEKKCYLFHISPMAGFPKGLRRLLEDESVKKVGVGIEGDQWKLMSDYELKL-----KGFIELSEVANQKLRCKEKWSLNGLVKHLFKKQLLKDSSIRCSNWDIFPLSTDQKLYAASDAYVRCIHFS 221          
BLAST of Werner syndrome ATP-dependent helicase vs. Ensembl Xenopus
Match: cdip1 (cell death-inducing p53 target 1 [Source:Xenbase;Acc:XB-GENE-5752851])

HSP 1 Score: 98.9821 bits (245), Expect = 3.965e-23
Identity = 60/183 (32.79%), Postives = 97/183 (53.01%), Query Frame = 2
Query:  125 FNYSGKIVYSAETNEINMWSKLILDDFGKLPIIDKVIGFDMEWP------MNRKTAVVQLYSEMHGVFVFQILTL--LPNVLLEIIRNNSIKKVGLNIANDIKKLEKDFDQNLDDVIINGLCDVGNLARKKFNNSERWSLSNLILNLTGQILPKPSAIRCGNWNQFPLSGEQIKYAGLDSYAS 649
              ++G IVYS E N+ ++ S+ I     +    + V+GFD+EWP         K A++Q+       ++F I  +   P  L  ++ + S+KKVG+ I  D  KL  D++  L      G  ++  +A +K    E+WSL+ L+ +L  + L K S+IRC NW+ FPLS +Q  YA  D+Y +
Sbjct:   52 LKFNGSIVYSYEGNDCSLLSEDIRSSLQE----EDVLGFDIEWPPIYTKGKTGKVALIQVCVSEKKCYLFHISPMAGFPKGLRRLLEDESVKKVGVGIEGDQWKLMSDYELKL-----KGFIELSEVANQKLRCKEKWSLNGLVKHLFKKQLLKDSSIRCSNWDIFPLSTDQKLYAASDAYVT 225          
BLAST of Werner syndrome ATP-dependent helicase vs. Ensembl Mouse
Match: Wrn (Werner syndrome RecQ like helicase [Source:MGI Symbol;Acc:MGI:109635])

HSP 1 Score: 108.227 bits (269), Expect = 2.088e-26
Identity = 65/191 (34.03%), Postives = 102/191 (53.40%), Query Frame = 2
Query:  125 FNYSGKIVYSAETNEINMWSKLILDDFGKLPIID-KVIGFDMEWP------MNRKTAVVQLYSEMHGVFVFQI--LTLLPNVLLEIIRNNSIKKVGLNIANDIKKLEKDFDQNLDDVIINGLCDVGNLARKKFNNSERWSLSNLILNLTGQILPKPSAIRCGNWNQFPLSGEQIKYAGLDSYASFYAYSLL 670
              + G IVYS E ++ +  S+ I      + + D  V+GFDMEWP         + AV+QL       ++F I  +++ P  L  ++ N SIKK G+ I  D  KL +DFD  L+  +     ++ ++A +K   +E WSL+ L+ ++ G+ L K  +IRC NW+ FPL+ +Q  YA  D+YA    Y  L
Sbjct:   41 LEFPGSIVYSYEASDCSFLSEDI-----SMRLSDGDVVGFDMEWPPIYKPGKRSRVAVIQLCVSESKCYLFHISSMSVFPQGLKMLLENKSIKKAGVGIEGDQWKLLRDFDVKLESFV-----ELTDVANEKLKCAETWSLNGLVKHVLGKQLLKDKSIRCSNWSNFPLTEDQKLYAATDAYAGLIIYQKL 221          
BLAST of Werner syndrome ATP-dependent helicase vs. Ensembl Mouse
Match: Wrn (Werner syndrome RecQ like helicase [Source:MGI Symbol;Acc:MGI:109635])

HSP 1 Score: 108.227 bits (269), Expect = 2.088e-26
Identity = 65/191 (34.03%), Postives = 102/191 (53.40%), Query Frame = 2
Query:  125 FNYSGKIVYSAETNEINMWSKLILDDFGKLPIID-KVIGFDMEWP------MNRKTAVVQLYSEMHGVFVFQI--LTLLPNVLLEIIRNNSIKKVGLNIANDIKKLEKDFDQNLDDVIINGLCDVGNLARKKFNNSERWSLSNLILNLTGQILPKPSAIRCGNWNQFPLSGEQIKYAGLDSYASFYAYSLL 670
              + G IVYS E ++ +  S+ I      + + D  V+GFDMEWP         + AV+QL       ++F I  +++ P  L  ++ N SIKK G+ I  D  KL +DFD  L+  +     ++ ++A +K   +E WSL+ L+ ++ G+ L K  +IRC NW+ FPL+ +Q  YA  D+YA    Y  L
Sbjct:   41 LEFPGSIVYSYEASDCSFLSEDI-----SMRLSDGDVVGFDMEWPPIYKPGKRSRVAVIQLCVSESKCYLFHISSMSVFPQGLKMLLENKSIKKAGVGIEGDQWKLLRDFDVKLESFV-----ELTDVANEKLKCAETWSLNGLVKHVLGKQLLKDKSIRCSNWSNFPLTEDQKLYAATDAYAGLIIYQKL 221          
BLAST of Werner syndrome ATP-dependent helicase vs. Ensembl Mouse
Match: Exd2 (exonuclease 3'-5' domain containing 2 [Source:MGI Symbol;Acc:MGI:1922485])

HSP 1 Score: 58.151 bits (139), Expect = 2.314e-9
Identity = 53/189 (28.04%), Postives = 87/189 (46.03%), Query Frame = 2
Query:  143 IVYSAETNEINMWSKLILDDFGKLPIIDKVIGFDMEW----PMNRKTAVVQLYSEMHGVFVFQILTL------LPNVLLEIIRNNSIKKVGLNIANDIKKLEKDFDQNLDDVIINGLCDVGNLARKKFNN--SERWSLSNLILNLTGQILPKPSAIRCGNWNQFPLSGEQIKYAGLDSYASFYAYSLLM 673
            +   AE N+I  + K  L+DF        V+G D EW          +++Q+ S      + ++  L      LP  LL+I+ + +I KVG+  + D  KL +D+      +I+ G  D+  LA K+ NN      SL +L   +    L K   +RC NW+   L+ +Q+ YA  D+  S   +  L+
Sbjct:  111 VSQEAEWNQIQPFLKRELEDF-------PVLGIDCEWVNLEGKASPLSLLQMASPSGFCALVRLPRLIYGGRTLPRTLLDILADGAILKVGVGCSEDANKLLQDYG-----LIVRGCLDLRYLAMKQGNNILCNGLSLKSLAETILNFPLDKSLLLRCSNWDAENLTEDQVTYAARDAQISVALFLHLL 287          
BLAST of Werner syndrome ATP-dependent helicase vs. UniProt/SwissProt
Match: sp|Q14191|WRN_HUMAN (Werner syndrome ATP-dependent helicase OS=Homo sapiens OX=9606 GN=WRN PE=1 SV=2)

HSP 1 Score: 108.997 bits (271), Expect = 6.431e-26
Identity = 65/188 (34.57%), Postives = 107/188 (56.91%), Query Frame = 2
Query:  125 FNYSGKIVYSAETNEINMWSKLILDDFGKLPIID-KVIGFDMEWP--MNR----KTAVVQLYSEMHGVFVFQI--LTLLPNVLLEIIRNNSIKKVGLNIANDIKKLEKDFDQNLDDVIINGLCDVGNLARKKFNNSERWSLSNLILNLTGQILPKPSAIRCGNWNQFPLSGEQIKYAGLDSYASFYAY 661
              ++G IVYS + ++ +  S+ I      + + D  V+GFDMEWP   NR    K A++QL       ++F +  +++ P  L  ++ N ++KK G+ I  D  KL +DFD  L + +     ++ ++A KK   +E WSL++L+ +L G+ L K  +IRC NW++FPL+ +Q  YA  D+YA F  Y
Sbjct:   47 LEFTGSIVYSYDASDCSFLSEDI-----SMSLSDGDVVGFDMEWPPLYNRGKLGKVALIQLCVSESKCYLFHVSSMSVFPQGLKMLLENKAVKKAGVGIEGDQWKLLRDFDIKLKNFV-----ELTDVANKKLKCTETWSLNSLVKHLLGKQLLKDKSIRCSNWSKFPLTEDQKLYAATDAYAGFIIY 224          
BLAST of Werner syndrome ATP-dependent helicase vs. UniProt/SwissProt
Match: sp|O09053|WRN_MOUSE (Werner syndrome ATP-dependent helicase homolog OS=Mus musculus OX=10090 GN=Wrn PE=1 SV=3)

HSP 1 Score: 108.227 bits (269), Expect = 1.461e-25
Identity = 65/191 (34.03%), Postives = 102/191 (53.40%), Query Frame = 2
Query:  125 FNYSGKIVYSAETNEINMWSKLILDDFGKLPIID-KVIGFDMEWP------MNRKTAVVQLYSEMHGVFVFQI--LTLLPNVLLEIIRNNSIKKVGLNIANDIKKLEKDFDQNLDDVIINGLCDVGNLARKKFNNSERWSLSNLILNLTGQILPKPSAIRCGNWNQFPLSGEQIKYAGLDSYASFYAYSLL 670
              + G IVYS E ++ +  S+ I      + + D  V+GFDMEWP         + AV+QL       ++F I  +++ P  L  ++ N SIKK G+ I  D  KL +DFD  L+  +     ++ ++A +K   +E WSL+ L+ ++ G+ L K  +IRC NW+ FPL+ +Q  YA  D+YA    Y  L
Sbjct:   41 LEFPGSIVYSYEASDCSFLSEDI-----SMRLSDGDVVGFDMEWPPIYKPGKRSRVAVIQLCVSESKCYLFHISSMSVFPQGLKMLLENKSIKKAGVGIEGDQWKLLRDFDVKLESFV-----ELTDVANEKLKCAETWSLNGLVKHVLGKQLLKDKSIRCSNWSNFPLTEDQKLYAATDAYAGLIIYQKL 221          
BLAST of Werner syndrome ATP-dependent helicase vs. UniProt/SwissProt
Match: sp|Q84LH3|WEX_ARATH (Werner Syndrome-like exonuclease OS=Arabidopsis thaliana OX=3702 GN=WEX PE=1 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 5.331e-21
Identity = 64/207 (30.92%), Postives = 108/207 (52.17%), Query Frame = 2
Query:   89 KFPSFRTNKVENF---NYSGKIVYSAETNEINMWSKLILD--DFGKLPIIDKVIGFDMEW-PMNRK------TAVVQLYSEMHGVFVFQIL-TLLPNVLLEIIRNNSIKKVGLNIANDIKKLEKDFDQNLDDVIINGLCDVGNLARKKFNNSERWSLSNLILNLTGQILPKPSAIRCGNWNQFPLSGEQIKYAGLDSYASFYAYSLL 670
            +FP  R  +  NF    + G+I+YS    E++  +  ++   D  +       +G D+EW P  RK       A VQ+  + +   V  I  + +P  L  +I ++++ KVG+ I  D  KL  D+  ++ DV      D+ +LA +K    ++W L++L   L  + L KP+ IR GNW  +PLS +Q++YA  D+YAS++ Y +L
Sbjct:   78 RFPLSRC-RARNFPAMRFGGRILYSKTATEVDKRAMQLIKVLDTKRDESGIAFVGLDIEWRPSFRKGVLPGKVATVQICVDSNYCDVMHIFHSGIPQSLQHLIEDSTLVKVGIGIDGDSVKLFHDYGVSIKDVE-----DLSDLANQKIGGDKKWGLASLTETLVCKELLKPNRIRLGNWEFYPLSKQQLQYAATDAYASWHLYKVL 278          
BLAST of Werner syndrome ATP-dependent helicase vs. UniProt/SwissProt
Match: sp|O93530|WRN_XENLA (Werner syndrome ATP-dependent helicase homolog OS=Xenopus laevis OX=8355 GN=wrn PE=2 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 1.421e-20
Identity = 57/188 (30.32%), Postives = 96/188 (51.06%), Query Frame = 2
Query:  131 YSGKIVYSAETNEINMWSKLILDDFGKLPIIDKVIGFDMEWP------MNRKTAVVQLYSEMHGVFVFQILTL--LPNVLLEIIRNNSIKKVGLNIANDIKKLEKDFDQNLDDVIINGLCDVGNLARKKFNNSERWSLSNLILNLTGQILPKPSAIRCGNWNQFPLSGEQIKYAGLDSYASFYAYSLL 670
            ++G IVYS E+N+ ++ S    +D     + + V+GFD+EWP         K A++Q+       ++F I  +   P  L  ++ + S++KVG+ I  D  KL  D++  L      G  ++  +A +K    E+W+ + LI +L  + L K  + RC NW+ F L+ +Q  YA  D+YA    Y  L
Sbjct:   43 FNGSIVYSYESNDCSLLS----EDIRSSLLEEDVLGFDIEWPPVYTKGKTGKVALIQVCVSEKKCYLFHISPMAGFPKGLKRLLEDESVRKVGVGIEGDQWKLMSDYELKL-----KGFIELSEMANQKLRCKEKWTFNGLIKHLFKEQLYKRKSYRCSNWDIFLLTEDQKLYAATDAYAGLLIYKKL 221          
BLAST of Werner syndrome ATP-dependent helicase vs. UniProt/SwissProt
Match: sp|B3NZ68|WRNXO_DROER (Werner Syndrome-like exonuclease OS=Drosophila erecta OX=7220 GN=WRNexo PE=3 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.100e-18
Identity = 60/207 (28.99%), Postives = 98/207 (47.34%), Query Frame = 2
Query:   95 PSFRTNKVENF---NYSGKIVYSAETNEINMWSKLILDDFGKLPIIDKVI--GFDMEWPMN-----RKTAVVQLYSEMHGVFVFQILTL--LPNVLLEIIRNNSIKKVGLNIANDIKKLEKDFDQNLDDVIINGLCDVGNLARKKFNNSERWSLSNLILNLTGQILPKPSAIRCGNWNQFPLSGEQIKYAGLDSYASFYAYSLLMKK 679
            PS    K E      Y G I Y  E+ +I   +  +L    K    D+V+   FDMEWP +      K+AV+Q+  +    +++Q+  L  LP VL+ +I ++ ++  G+NI ND +KL +DF +   + +I    D+G    +      RWSL  L   +  + + K   +R   W+  PL   Q+ YA +D Y     Y  L ++
Sbjct:  111 PSPEKEKPEKLPFIKYKGAIKYYTESQDIAASADDVLQWVEKQK--DEVVPMAFDMEWPFSFQTGPGKSAVIQICVDEKCCYIYQLTNLKKLPAVLVALINHSKVRLHGVNIKNDFRKLARDFPEVSAEPLIEKCVDLGVWCNEVCETGGRWSLERLTNFIAKKAMDKSKKVRMSKWHVIPLDENQLMYAAIDVYIGQVIYRELERR 315          
BLAST of Werner syndrome ATP-dependent helicase vs. TrEMBL
Match: V4A380 (3'-5' exonuclease domain-containing protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_106399 PE=4 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 4.956e-30
Identity = 64/156 (41.03%), Postives = 93/156 (59.62%), Query Frame = 2
Query:  230 VIGFDMEWPMNR-------KTAVVQLYSEMHGVFVFQILTL--LPNVLLEIIRNNSIKKVGLNIANDIKKLEKDFDQNLDDVIINGLCDVGNLARKKFNNSERWSLSNLILNLTGQILPKPSAIRCGNWNQFPLSGEQIKYAGLDSYASFYAYSLL 670
            V+GFD+EWP+         K A+VQ+       ++F    +   P +L  +I + SIKKVGLNI ND  KL+KD+D N   +I + + ++ +LA KK  ++E WSL  L+ N+    L K   +RCG+W +FPL+  Q KYA LDSYAS   Y++L
Sbjct:    1 VVGFDLEWPVTYEMGNPSGKVALVQISVSEKTCYLFHTSAMKEFPQILKTLIEDKSIKKVGLNIENDFWKLDKDWDVNAMSIIPHSMIELRHLANKKLKSNENWSLDGLVRNVLRCKLNKDVRLRCGDWAKFPLTAVQQKYAALDSYASLKLYNVL 156          
BLAST of Werner syndrome ATP-dependent helicase vs. TrEMBL
Match: A0A0V0GER1 (Putative deddy 3'-5' exonuclease protein (Fragment) OS=Triatoma dimidiata OX=72491 PE=4 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 2.147e-28
Identity = 66/191 (34.55%), Postives = 109/191 (57.07%), Query Frame = 2
Query:  131 YSGKIVYSAETNEINMWSKLIL---DDFGKLPIIDKVIGFDMEWPMNR----KTAVVQLYSEMHGVFVFQI--LTLLPNVLLEIIRNNSIKKVGLNIANDIKKLEKDFDQNLDDVIINGLCDVGNLARKKFNNSERWSLSNLILNLTGQILPKPSAIRCGNWNQFPLSGEQIKYAGLDSYASFYAYSLLMK 676
            + GKI Y+    E   + + +L   +  G+L     V+G+D EWP+ +    K A++Q+    +  ++F I  +T LP VL+ ++++ ++K  GLNI NDI+KL KDF  ++  ++ N   ++ +LA +  + SERWSL  ++LN  G +L K   +R  +WN   LS +Q+ YA  D+YAS   Y  L K
Sbjct:    3 FKGKIHYTTNFTECAFFCEQLLSVANSSGEL-----VLGYDQEWPLTKSGWGKVALIQICPNENECYIFHISGMTSLPKVLIHLLKHRNVKLTGLNIKNDIRKLGKDFKIDVFSIVNNNTIELSSLANRILHCSERWSLQRIVLNQFGLVLNKDPKVRISSWNNKDLSEDQLMYAATDAYASLLCYQHLDK 188          
BLAST of Werner syndrome ATP-dependent helicase vs. TrEMBL
Match: A0A3S1BIU7 (3'-5' exonuclease domain-containing protein OS=Elysia chlorotica OX=188477 GN=EGW08_010444 PE=4 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 1.553e-27
Identity = 67/195 (34.36%), Postives = 105/195 (53.85%), Query Frame = 2
Query:  125 FNYSGKIVYSAETNEINMWSKLILDDFGK-LPIIDKVIGFDMEWPMN------RKTAVVQLYSEMHGVFVFQI--LTLLPNVLLEIIRNNSIKKVGLNIANDIKKLEKDFDQNLDDVI-INGLCDVGNLARKKFNNSERWSLSNLILNLTGQILPKPSAIRCGNWNQFPLSGEQIKYAGLDSYASFYAYSLLMKK 679
              + G I YS   ++     + IL   G+ LP +  VIGFD EWP+       +KTAV+Q+       ++F +  ++ +P  L  +I +  +  VG+NI +D+ KLE+D+D  +   I    + D+  LA  K  +SERWSL  L  N+  + L K   +RCGNW+ +PLS +Q  YA  D++AS   Y+ L  +
Sbjct:   70 LKFEGSITYSYHESDCACICQDILSRLGRDLPPV-TVIGFDTEWPVTYNKGLPKKTAVIQMCLSKKECYLFHVSCMSTIPKPLQSVILDKRVILVGVNIESDLWKLERDYDLKVKPAIDQETVVDLSKLANVKLKSSERWSLDGLCRNVLRKRLDKDRDLRCGNWDDYPLSKDQKMYASNDAFASLELYTCLASR 263          
BLAST of Werner syndrome ATP-dependent helicase vs. TrEMBL
Match: A0A2C9KGP0 (3'-5' exonuclease domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106057603 PE=4 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 3.554e-27
Identity = 71/194 (36.60%), Postives = 102/194 (52.58%), Query Frame = 2
Query:  125 FNYSGKIVYSAETNEINMWSKLILDDFGKLPIIDK-VIGFDMEWPMN------RKTAVVQLYSEMHGVFVFQI--LTLLPNVLLEIIRNNSIKKVGLNIANDIKKLEKDFDQNLDDVIING-LCDVGNLARKKFNNSERWSLSNLILNLTGQILPKPSAIRCGNWNQFPLSGEQIKYAGLDSYASFYAYSLLMK 676
              + G +VY+A   +     + I+   G   + +K VIGFDMEWP+        KTA++Q+       ++F +  ++  P  L  +I +  +  VGLNIA+D+ KL +DFD  +   +  G + DVG LAR+    SERW L  L  N+ G  L K   IRCGNW+  PLS EQ  YA  D+ AS   Y  L +
Sbjct:   76 LRFCGSLVYTAYLTDCACLCQDIVSGLG---LCEKAVIGFDMEWPVTYQKNSEDKTALIQMCLSDKTCYLFHVGAMSSFPKPLENLILDQRVILVGLNIASDLWKLARDFDVRVKISLDRGSVVDVGTLARQILKTSERWDLDGLCRNVLGHRLDKDHKIRCGNWSDVPLSEEQKLYAANDALASLLIYKKLQE 266          
BLAST of Werner syndrome ATP-dependent helicase vs. TrEMBL
Match: A0A1S3K8F7 (Werner syndrome ATP-dependent helicase homolog isoform X1 OS=Lingula unguis OX=7574 GN=LOC106179740 PE=4 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 8.726e-27
Identity = 62/198 (31.31%), Postives = 109/198 (55.05%), Query Frame = 2
Query:  110 NKVENFNYSGKIVYSAETNEINMWSKLILDDFGKLPIIDKVIGFDMEWPMN------RKTAVVQLYSEMHGVFVFQILTL--LPNVLLEIIRNNSIKKVGLNIANDIKKLEKDFDQNLDDVIINGLCDVGNLARKKFNNSERWSLSNLILNLTGQILPKPSAIRCGNWNQFPLSGEQIKYAGLDSYASFYAYSLLMKK 679
            + +    ++G I+YS   ++ ++  + I+    +    +  +GFD+EWP+        +TA+VQ+ +     ++F +  +  LP  L E++ ++ IKKVG+ I +D+ KLE+DFD  + ++I     D+  +A +  N+S+ WSL  L   L  Q L K  ++R  +W QFPLS  Q  YA  D+YAS   Y  L+++
Sbjct:   42 DSLPELRFTGGIIYSHRKDDCSLLCQDIICSL-ETQQHNAAVGFDIEWPVTYQRGREDRTALVQICTPEKCCYLFHVSCMGELPKGLKELLSHSKIKKVGVGIDSDLWKLERDFDIRVKEIIDGSTIDLSVMANRVVNSSQTWSLDGLTRYLLRQKLCKDPSVRKSDWRQFPLSSRQQMYAATDAYASLILYEKLLEQ 238          
BLAST of Werner syndrome ATP-dependent helicase vs. Ensembl Cavefish
Match: wrn (WRN RecQ like helicase [Source:NCBI gene;Acc:103034404])

HSP 1 Score: 97.8265 bits (242), Expect = 5.399e-23
Identity = 59/205 (28.78%), Postives = 106/205 (51.71%), Query Frame = 2
Query:   98 SFRTNKVEN----FNYSGKIVYSAETNEINMWSKLILDDFGKLPIIDKVIGFDMEWP------MNRKTAVVQLYSEMHGVFVFQI--LTLLPNVLLEIIRNNSIKKVGLNIANDIKKLEKDFDQNLDDVIINGLCDVGNLARKKFNNSERWSLSNLILNLTGQILPKPSAIRCGNWNQFPLSGEQIKYAGLDSYASFYAYSLLMK 676
            +++ N +E+      + G ++YS E N+ +  S    +D          +GFD+EWP       ++K A+VQL +     ++F +  +T  P+ L   + + +IKKVG+ +  D+ +L  D+D  L + +     ++ +LA +K    E+WSL  L+ +L  + L K   +RC +W+ F L+ EQ +YA  D+YA    +  L K
Sbjct:   25 AYKKNILEDDLPFLEFGGVLMYSKEKNDCSFLS----EDLRSSLAPGSAVGFDLEWPPSFTKGKSKKVALVQLCASEEKCYLFHLSSMTGFPSGLKMFLEDENIKKVGVGVEGDMWRLMSDYDIKLKNFV-----ELSDLANEKLKCVEKWSLDGLVKHLFKKRLYKDKDVRCSHWDDFELTEEQKRYAATDAYAGLIIHQKLEK 220          
BLAST of Werner syndrome ATP-dependent helicase vs. Ensembl Nematostella
Match: EDO43578 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY54])

HSP 1 Score: 106.686 bits (265), Expect = 1.294e-28
Identity = 68/204 (33.33%), Postives = 104/204 (50.98%), Query Frame = 2
Query:   83 ATKFPSFRTNKVENFNYSGKIVYSAETNEINMWSKLILDDFGKLPIIDKVIGFDMEWPM-------NRKTAVVQLYSEMHGVFVFQILTLL-----PNVL-LEIIRNNSIKKVGLNIANDIKKLEKDFDQNLDDVIINGLCDVGNLARKKFNNSERWSLSNLILNLTGQILPKPSAIRCGNWNQFPLSGEQIKYAGLDSYASFY 655
            A  F  F  +K+    Y G + YS   +E N     ++    K      V+GFDMEW +       +RKT+++QL S     ++FQ+ ++      P+ L   I+ + +I KVG+ I +D+ K+ +++D     V   G+ D+  LA  K  + E WSLS L ++L  Q L K  AIRC N    PL+ EQ  YA +D+Y S Y
Sbjct:    1 ACFFEVFSDSKLPLLQYRGMMSYSTHKDECNFICDQLISSDNK-----PVMGFDMEWRVAFASGGGSRKTSLIQLCSSESTCYLFQLSSMALLLKKPSQLNYTILEDETIVKVGVGINSDVDKISREYD-----VYPRGIVDLSALANTKLKSHENWSLSGLTMHLFKQQLNKDPAIRCSNCEAIPLTREQQLYAAMDAYVSTY 194          
BLAST of Werner syndrome ATP-dependent helicase vs. Ensembl Nematostella
Match: EDO33961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQP2])

HSP 1 Score: 65.855 bits (159), Expect = 7.053e-14
Identity = 47/136 (34.56%), Postives = 66/136 (48.53%), Query Frame = 2
Query:  266 KTAVVQLYSEMHGVFVFQI----LTLLPNVLLEIIRNNSIKKVGLNIANDIKKLEKDFDQNLDDVIINGLCDVGNLARKKFNNSERWSLSNLILNLTGQILPKPSAIRCGNWNQFPLSGEQIKYAGLDSYASFYAY 661
            KTA +QL    H   V  +    L LLP  LL ++ N  I KVG  I+ D  KL +D      +++ NG  D+   A+    N +   L  L   + G  L KP  I   NW  FPL+ +Q+ YA LD++ SF  +
Sbjct:    1 KTATLQLAVN-HSCLVLHLFHMRLDLLPRSLLNVLGNIRILKVGSGISGDAVKLLRD-----TNILCNGRSDIQVYAKVLALNQDGTGLKKLAKTILGIELDKPKNISLSNWELFPLTYKQVSYAALDAWVSFKLF 130          
BLAST of Werner syndrome ATP-dependent helicase vs. Ensembl Nematostella
Match: EDO33962 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQP3])

HSP 1 Score: 68.9366 bits (167), Expect = 1.049e-13
Identity = 60/194 (30.93%), Postives = 88/194 (45.36%), Query Frame = 2
Query:  140 KIVYSAETNEINMWSKLILDDFGKLPIIDKVIGFDMEW-PM---------NRKTAVVQLYSEMHGVFVFQI----LTLLPNVLLEIIRNNSIKKVGLNIANDIKKLEKDFDQNLDDVIINGLCDVGNLARKKFNNSERWSLSNLILNLTGQILPKPSAIRCGNWNQFPLSGEQIKYAGLDSYASFYAYSLLMKK 679
            ++VY+   N+ ++W   I  +     +    IG D+EW P            KTA +QL +  H   V  +    L LLP  LL ++ N  I KVG  I+ D  KL +D      +++ NG  D    A+    N +   L  L   + G  L KP  I   NW  FPL+ EQ  YA LD++ SF  +  L ++
Sbjct:   63 EVVYTKCPNDADLW---IHKNINSSTL---AIGMDIEWRPQFIPKKLGGKENKTATLQL-AVNHSCLVLHLFHMRLDLLPRSLLNVLGNIRILKVGSGISGDAVKLLRD-----TEILCNGRSDTQVYAKVLALNQDGTGLKKLAKTILGIELDKPKYISLSNWELFPLTYEQASYAALDAWVSFKLFVELKQR 244          
BLAST of Werner syndrome ATP-dependent helicase vs. Ensembl Nematostella
Match: EDO46953 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNM5])

HSP 1 Score: 52.7582 bits (125), Expect = 3.448e-8
Identity = 38/157 (24.20%), Postives = 75/157 (47.77%), Query Frame = 2
Query:  227 KVIGFDMEWPMNRK------TAVVQLYSEMHGVFVFQILTL---LPNVLLEIIRNNSIKKVGLNIANDIKKLEKDFDQNLDDVIINGLCDVGNLARKKFNNSERWSLSNLILNLTGQILPKPSAIRCGNWNQFPLSGEQIKYAGLDSYASFYAYSLL 670
            K +G D EW +N+K       A++Q+ + ++  F+ ++  +   +P  L  ++ + ++ K G+ I +D KKL   F      + ++G  D+ +L  ++     + SL  L     G  + K   ++C NW    LS  Q+ YA  D+  + + +  L
Sbjct:    2 KFVGLDCEW-VNKKGVLSHPVALLQIATPLNDCFLIRLCKMSGAVPPTLKGLLEDRAVLKFGVGIMDDAKKLSDTFG-----LAVSGCVDLRHLVLRQ----GKLSLGALAQRFLGVRMDKSWHVQCSNWEVEHLSDRQVAYAANDAIVAVHVFMAL 148          
BLAST of Werner syndrome ATP-dependent helicase vs. Planmine SMEST
Match: SMESG000065456.1 (SMESG000065456.1)

HSP 1 Score: 403.29 bits (1035), Expect = 5.741e-145
Identity = 197/200 (98.50%), Postives = 199/200 (99.50%), Query Frame = 2
Query:   80 MATKFPSFRTNKVENFNYSGKIVYSAETNEINMWSKLILDDFGKLPIIDKVIGFDMEWPMNRKTAVVQLYSEMHGVFVFQILTLLPNVLLEIIRNNSIKKVGLNIANDIKKLEKDFDQNLDDVIINGLCDVGNLARKKFNNSERWSLSNLILNLTGQILPKPSAIRCGNWNQFPLSGEQIKYAGLDSYASFYAYSLLMKK 679
            MATKFPSFRTNKVENFNYSGKIVYSAET+EINMWSKLILDDFGKLPIIDKVIGFDMEWPMNRKTAVVQLYSEMHGVFVFQILTLLPNVLLEIIRNNSIKKVGLNIANDIKKLEKDFDQNLDD IINGLCDVGNLARKKFNNSERWSLSNLILNLTGQILPKPSAIRCGNWN+FPLSGEQIKYAGLDSYASFYAYSLLMKK
Sbjct:    1 MATKFPSFRTNKVENFNYSGKIVYSAETSEINMWSKLILDDFGKLPIIDKVIGFDMEWPMNRKTAVVQLYSEMHGVFVFQILTLLPNVLLEIIRNNSIKKVGLNIANDIKKLEKDFDQNLDDAIINGLCDVGNLARKKFNNSERWSLSNLILNLTGQILPKPSAIRCGNWNRFPLSGEQIKYAGLDSYASFYAYSLLMKK 200          
BLAST of Werner syndrome ATP-dependent helicase vs. Planmine SMEST
Match: SMESG000047271.1 (SMESG000047271.1)

HSP 1 Score: 399.053 bits (1024), Expect = 2.788e-143
Identity = 196/200 (98.00%), Postives = 198/200 (99.00%), Query Frame = 2
Query:   80 MATKFPSFRTNKVENFNYSGKIVYSAETNEINMWSKLILDDFGKLPIIDKVIGFDMEWPMNRKTAVVQLYSEMHGVFVFQILTLLPNVLLEIIRNNSIKKVGLNIANDIKKLEKDFDQNLDDVIINGLCDVGNLARKKFNNSERWSLSNLILNLTGQILPKPSAIRCGNWNQFPLSGEQIKYAGLDSYASFYAYSLLMKK 679
            MATKFPSFRTNK ENFNYSGKIVYSAET+EINMWSKLILDDFGKLPIIDKVIGFDMEWPMNRKTAVVQLYSEMHGVFVFQILTLLPNVLLEIIRNNSIKKVGLNIANDIKKLEKDF QNLDDVIINGLCDVGNLARKKFNNSERWSLSNLILNLTGQILPKPSAIRCGNWN+FPLSGEQIKYAGLDSYASFYAYSLLMKK
Sbjct:    1 MATKFPSFRTNKDENFNYSGKIVYSAETSEINMWSKLILDDFGKLPIIDKVIGFDMEWPMNRKTAVVQLYSEMHGVFVFQILTLLPNVLLEIIRNNSIKKVGLNIANDIKKLEKDFGQNLDDVIINGLCDVGNLARKKFNNSERWSLSNLILNLTGQILPKPSAIRCGNWNRFPLSGEQIKYAGLDSYASFYAYSLLMKK 200          
BLAST of Werner syndrome ATP-dependent helicase vs. Planmine SMEST
Match: SMESG000035104.1 (SMESG000035104.1)

HSP 1 Score: 60.077 bits (144), Expect = 2.675e-10
Identity = 45/150 (30.00%), Postives = 76/150 (50.67%), Query Frame = 2
Query:  224 DKVI--GFDMEWPMNRKTAVVQLYSEMHGVFVFQIL---TLLPNVLLEIIRNNSIKKVGLNIANDIKKLEKDFDQNLDDVIINGLCDVGNLA-RKKFNNSERWSLSNLILNLTGQILP------KPSAIRCGNWNQFPLSGEQIKYAGLD 637
            DK I  GFD EW  N+  +++Q+       F+ ++L     LPN  L  +++++  K G+ I  D KKLE  ++     + + G  D+ +LA R K N  ++  L +  L+  G   P      K   ++C +W Q  L+ +Q++YA LD
Sbjct:   76 DKFIAAGFDCEWSPNKNVSLIQIAFPDGSCFLLRVLNSVEYLPNEFLIWMKDSTKLKFGIGILEDCKKLESQWN-----ISVRGSVDLRHLAVRIKPNGLDKMGLKSFALHWLGLNYPYDDESRKTLLVQCSDWEQEILTSKQLEYASLD 220          
The following BLAST results are available for this feature:
BLAST of Werner syndrome ATP-dependent helicase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WRN1.339e-2634.57WRN RecQ like helicase [Source:HGNC Symbol;Acc:HGN... [more]
EXD28.071e-825.13exonuclease 3'-5' domain containing 2 [Source:HGNC... [more]
EXD28.071e-825.13exonuclease 3'-5' domain containing 2 [Source:HGNC... [more]
EXD26.863e-730.17exonuclease 3'-5' domain containing 2 [Source:HGNC... [more]
EXD26.863e-730.17exonuclease 3'-5' domain containing 2 [Source:HGNC... [more]
back to top
BLAST of Werner syndrome ATP-dependent helicase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Werner syndrome ATP-dependent helicase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WRNexo2.318e-1828.02gene:FBgn0038608 transcript:FBtr0083586[more]
WRNexo2.364e-1828.02gene:FBgn0038608 transcript:FBtr0339976[more]
WRNexo2.431e-1828.02gene:FBgn0038608 transcript:FBtr0302307[more]
Exd22.837e-727.39gene:FBgn0037901 transcript:FBtr0308211[more]
Exd22.837e-727.39gene:FBgn0037901 transcript:FBtr0082402[more]
back to top
BLAST of Werner syndrome ATP-dependent helicase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BX324002.17.528e-2329.27WRN RecQ like helicase [Source:NCBI gene;Acc:56949... [more]
wrn7.531e-2329.27WRN RecQ like helicase [Source:ZFIN;Acc:ZDB-GENE-0... [more]
BX324002.17.563e-2329.27WRN RecQ like helicase [Source:NCBI gene;Acc:56949... [more]
wrn7.565e-2329.27WRN RecQ like helicase [Source:ZFIN;Acc:ZDB-GENE-0... [more]
wrn7.565e-2329.27WRN RecQ like helicase [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of Werner syndrome ATP-dependent helicase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdip13.495e-2433.16cell death-inducing p53 target 1 [Source:Xenbase;A... [more]
cdip12.627e-2332.45cell death-inducing p53 target 1 [Source:Xenbase;A... [more]
cdip13.016e-2332.45cell death-inducing p53 target 1 [Source:Xenbase;A... [more]
cdip13.604e-2332.45cell death-inducing p53 target 1 [Source:Xenbase;A... [more]
cdip13.965e-2332.79cell death-inducing p53 target 1 [Source:Xenbase;A... [more]
back to top
BLAST of Werner syndrome ATP-dependent helicase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Wrn2.088e-2634.03Werner syndrome RecQ like helicase [Source:MGI Sym... [more]
Wrn2.088e-2634.03Werner syndrome RecQ like helicase [Source:MGI Sym... [more]
Exd22.314e-928.04exonuclease 3'-5' domain containing 2 [Source:MGI ... [more]
back to top
BLAST of Werner syndrome ATP-dependent helicase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q14191|WRN_HUMAN6.431e-2634.57Werner syndrome ATP-dependent helicase OS=Homo sap... [more]
sp|O09053|WRN_MOUSE1.461e-2534.03Werner syndrome ATP-dependent helicase homolog OS=... [more]
sp|Q84LH3|WEX_ARATH5.331e-2130.92Werner Syndrome-like exonuclease OS=Arabidopsis th... [more]
sp|O93530|WRN_XENLA1.421e-2030.32Werner syndrome ATP-dependent helicase homolog OS=... [more]
sp|B3NZ68|WRNXO_DROER1.100e-1828.99Werner Syndrome-like exonuclease OS=Drosophila ere... [more]
back to top
BLAST of Werner syndrome ATP-dependent helicase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4A3804.956e-3041.033'-5' exonuclease domain-containing protein (Fragm... [more]
A0A0V0GER12.147e-2834.55Putative deddy 3'-5' exonuclease protein (Fragment... [more]
A0A3S1BIU71.553e-2734.363'-5' exonuclease domain-containing protein OS=Ely... [more]
A0A2C9KGP03.554e-2736.603'-5' exonuclease domain-containing protein OS=Bio... [more]
A0A1S3K8F78.726e-2731.31Werner syndrome ATP-dependent helicase homolog iso... [more]
back to top
BLAST of Werner syndrome ATP-dependent helicase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
wrn5.399e-2328.78WRN RecQ like helicase [Source:NCBI gene;Acc:10303... [more]
back to top
BLAST of Werner syndrome ATP-dependent helicase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Werner syndrome ATP-dependent helicase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Werner syndrome ATP-dependent helicase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO435781.294e-2833.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339617.053e-1434.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339621.049e-1330.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO469533.448e-824.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Werner syndrome ATP-dependent helicase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Werner syndrome ATP-dependent helicase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000065456.15.741e-14598.50SMESG000065456.1[more]
SMESG000047271.12.788e-14398.00SMESG000047271.1[more]
SMESG000035104.12.675e-1030.00SMESG000035104.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029264 ID=SMED30029264|Name=Werner syndrome ATP-dependent helicase|organism=Schmidtea mediterranea sexual|type=transcript|length=708bp
ATTTGTTTTAATATTTATATTATTCAGATAAAAAGATTGTCAAGATTAAG
CTTATCTTTATGAAAAAATTGTTTTACAAATGGCAACGAAATTCCCTTCT
TTTAGAACAAACAAAGTCGAAAATTTTAATTACAGTGGTAAAATAGTGTA
TAGTGCGGAAACAAATGAAATTAATATGTGGTCAAAACTAATACTAGATG
ATTTTGGTAAATTACCAATCATTGATAAAGTTATTGGCTTTGATATGGAA
TGGCCGATGAATAGAAAAACTGCAGTTGTTCAATTATATTCTGAAATGCA
TGGTGTGTTTGTATTTCAAATATTAACTTTATTACCAAATGTTCTATTGG
AGATAATTAGGAATAATTCTATTAAAAAAGTTGGTTTGAATATCGCTAAT
GACATTAAGAAGTTAGAGAAGGATTTCGATCAAAATTTAGATGATGTTAT
TATTAATGGTTTGTGTGACGTAGGAAATTTAGCGAGAAAGAAATTCAACA
ATTCCGAGAGATGGAGTTTATCTAATTTAATTCTCAATCTAACTGGGCAG
ATTCTTCCTAAACCAAGTGCTATTCGTTGTGGGAATTGGAATCAATTTCC
ATTATCAGGTGAACAGATTAAATATGCAGGATTGGATTCATACGCATCTT
TTTATGCATATTCACTTTTGATGAAGAAATAAATTGTTCTTTTTTATATA
AAAAAAAA
back to top

protein sequence of SMED30029264-orf-1

>SMED30029264-orf-1 ID=SMED30029264-orf-1|Name=SMED30029264-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=201bp
MATKFPSFRTNKVENFNYSGKIVYSAETNEINMWSKLILDDFGKLPIIDK
VIGFDMEWPMNRKTAVVQLYSEMHGVFVFQILTLLPNVLLEIIRNNSIKK
VGLNIANDIKKLEKDFDQNLDDVIINGLCDVGNLARKKFNNSERWSLSNL
ILNLTGQILPKPSAIRCGNWNQFPLSGEQIKYAGLDSYASFYAYSLLMKK
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0003824catalytic activity
GO:0004386helicase activity
GO:0005524ATP binding
GO:00431383'-5' DNA helicase activity
GO:0003676nucleic acid binding
GO:00084083'-5' exonuclease activity
GO:0004527exonuclease activity
Vocabulary: biological process
TermDefinition
GO:0006260DNA replication
GO:0006281DNA repair
GO:0006310DNA recombination
GO:0032508DNA duplex unwinding
GO:0044237cellular metabolic process
GO:0006139nucleobase-containing compound metabolic process
GO:0090305nucleic acid phosphodiester bond hydrolysis
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR036397RNaseH_sf
IPR0025623'-5'_exonuclease_dom
IPR012337RNaseH-like_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR0025623'-5' exonuclease domainSMARTSM0047435exoneu6coord: 22..200
e-value: 0.0057
score: 25.9
IPR0025623'-5' exonuclease domainPFAMPF01612DNA_pol_A_exo1coord: 50..199
e-value: 2.8E-14
score: 53.2
IPR036397Ribonuclease H superfamilyGENE3DG3DSA:3.30.420.10coord: 5..199
e-value: 4.9E-42
score: 145.4
NoneNo IPR availablePANTHERPTHR13620:SF45WERNER SYNDROME-LIKE EXONUCLEASEcoord: 12..197
NoneNo IPR availablePANTHERPTHR136203-5 EXONUCLEASEcoord: 12..197
NoneNo IPR availableCDDcd06141WRN_exocoord: 50..199
e-value: 1.49168E-44
score: 143.873
IPR012337Ribonuclease H-like superfamilySUPERFAMILYSSF53098Ribonuclease H-likecoord: 50..200