B-box type zinc finger protein ncl-1

Overview
NameB-box type zinc finger protein ncl-1
Smed IDSMED30029263
Length (bp)4208
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of B-box type zinc finger protein ncl-1 (SMED30029263) t-SNE clustered cells

Violin plots show distribution of expression levels for B-box type zinc finger protein ncl-1 (SMED30029263) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of B-box type zinc finger protein ncl-1 (SMED30029263) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for B-box type zinc finger protein ncl-1 (SMED30029263) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029263

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30029263h1SMcG0013671 SmedASXL_014656SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Human
Match: TRIM2 (tripartite motif containing 2 [Source:HGNC Symbol;Acc:HGNC:15974])

HSP 1 Score: 110.153 bits (274), Expect = 9.693e-24
Identity = 82/266 (30.83%), Postives = 134/266 (50.38%), Query Frame = 1
Query: 1765 RWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWF----DCSSCMREPSDIAVHG-DEYFICDFKGHCVCVFKQDGTFVQRFGNETIT----NFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNH 2535
            R G+ G  +GE ++  G     + +I++AD+ N  +QIF+ DGQF S+FG+ GR  GQL  P  VA +  +   ++ D  N+   + IF   G F  KI    +    G++V+  GHI+ VD+ +  VF+    G+++  F    +       P   AV+  +E  I DF  H V VF Q+G F+ +FG+        N P G+ V  +G++++ D   +R  I V+   G  +S     +  +    GL +TS+G++V     NH
Sbjct:  475 RVGTKGRNKGEFTNLQGVAASTNGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVA-VHPSGDIIIADYDNK--WVSIFSSDGKFKTKIGSGKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPHFAAVNSNNEIIITDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSR--IQVFDGSGSFLSYINTSADPLYGPQGLALTSDGHVVVADSGNH 735          

HSP 2 Score: 75.485 bits (184), Expect = 5.491e-13
Identity = 42/123 (34.15%), Postives = 68/123 (55.28%), Query Frame = 1
Query: 1756 VKARWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVA--GLAVNNMGHI 2118
            +  R+GS G+G  + + PH   +  + EI++ D  NH +++F ++G+F+ +FG  G   GQ   P  VA + S    +V D GN  SR+Q+F  SG FL  I+     +    GLA+ + GH+
Sbjct:  608 IVTRFGSRGNGDRQFAGPHFAAVNSNNEIIITDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVA-VDSNGNIIVADWGN--SRIQVFDGSGSFLSYINTSADPLYGPQGLALTSDGHV 727          

HSP 3 Score: 52.7582 bits (125), Expect = 5.238e-6
Identity = 74/365 (20.27%), Postives = 137/365 (37.53%), Query Frame = 1
Query:  163 ICSQCKNSFSEPVVLNCLHIFDRGCLSKFECTDSIFPVVTCPKCHMQSGSLSSLKPYITQYAIESKEINVSTIDFNDFKCVLCTSGEDSKYKCVDCAGLLCERCKILHKEVKFLNSHLEVEELTDEDKTNIKLLKKHLADNKPVKCEVHCERKYTNYCIQCGMLACSRCLLSDHADHSTVLLQDFPEKIRFRIGNYIENCIKAEEMNKIAIEKLNNALMEVNNSHDENKTHIEEVCNEWKTAIDDIKTEYLKKNKELHDDLEFRIMN-GINRGEKY-------------LEHIEYALEFTKSYLDKCSNVEFCKIIKVVLNCLTDLSEK----------QIDTDVRTSIPFKENVSSITNVIRTN 1185
            ICS C   +  P VL CLH F   CL  +    S+   ++CP C       +S+ P          E  V+ +  N F                                +  L   L+    ++ ++++I      +A  KP+ C  H       YC  C    C  C   +HA+H TV L+D  E+ +  +              ++ ++ +N  L E++++       I ++ N+  + +DDI + + +  K L+      +M   +N G K+              E I+    FT   L+  +  E   + K +   L +L+++          Q+D  V T    K+++ ++  ++ TN
Sbjct:   22 ICSICLERYKNPKVLPCLHTFCERCLQNYIPAHSL--TLSCPVCRQ-----TSILP----------EKGVAALQNNFF--------------------------------ITNLMDVLQRTPGSNAEESSILETVTAVAAGKPLSCPNHDGNVMEFYCQSCETAMCRECTEGEHAEHPTVPLKDVVEQHKASL--------------QVQLDAVNKRLPEIDSALQFISEIIHQLTNQKASIVDDIHSTFDELQKTLNVRKSVLLMELEVNYGLKHKVLQSQLDTLLQGQESIKSCSNFTAQALNHGTETEVLLVKKQMSEKLNELADQDFPLHPRENDQLDFIVETE-GLKKSIHNLGTILTTN 322          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Human
Match: TRIM2 (tripartite motif containing 2 [Source:HGNC Symbol;Acc:HGNC:15974])

HSP 1 Score: 109.768 bits (273), Expect = 1.627e-23
Identity = 82/266 (30.83%), Postives = 134/266 (50.38%), Query Frame = 1
Query: 1765 RWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWF----DCSSCMREPSDIAVHG-DEYFICDFKGHCVCVFKQDGTFVQRFGNETIT----NFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNH 2535
            R G+ G  +GE ++  G     + +I++AD+ N  +QIF+ DGQF S+FG+ GR  GQL  P  VA +  +   ++ D  N+   + IF   G F  KI    +    G++V+  GHI+ VD+ +  VF+    G+++  F    +       P   AV+  +E  I DF  H V VF Q+G F+ +FG+        N P G+ V  +G++++ D   +R  I V+   G  +S     +  +    GL +TS+G++V     NH
Sbjct:  502 RVGTKGRNKGEFTNLQGVAASTNGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVA-VHPSGDIIIADYDNK--WVSIFSSDGKFKTKIGSGKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPHFAAVNSNNEIIITDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSR--IQVFDGSGSFLSYINTSADPLYGPQGLALTSDGHVVVADSGNH 762          

HSP 2 Score: 75.0998 bits (183), Expect = 8.410e-13
Identity = 42/123 (34.15%), Postives = 68/123 (55.28%), Query Frame = 1
Query: 1756 VKARWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVA--GLAVNNMGHI 2118
            +  R+GS G+G  + + PH   +  + EI++ D  NH +++F ++G+F+ +FG  G   GQ   P  VA + S    +V D GN  SR+Q+F  SG FL  I+     +    GLA+ + GH+
Sbjct:  635 IVTRFGSRGNGDRQFAGPHFAAVNSNNEIIITDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVA-VDSNGNIIVADWGN--SRIQVFDGSGSFLSYINTSADPLYGPQGLALTSDGHV 754          

HSP 3 Score: 53.5286 bits (127), Expect = 3.327e-6
Identity = 74/365 (20.27%), Postives = 137/365 (37.53%), Query Frame = 1
Query:  163 ICSQCKNSFSEPVVLNCLHIFDRGCLSKFECTDSIFPVVTCPKCHMQSGSLSSLKPYITQYAIESKEINVSTIDFNDFKCVLCTSGEDSKYKCVDCAGLLCERCKILHKEVKFLNSHLEVEELTDEDKTNIKLLKKHLADNKPVKCEVHCERKYTNYCIQCGMLACSRCLLSDHADHSTVLLQDFPEKIRFRIGNYIENCIKAEEMNKIAIEKLNNALMEVNNSHDENKTHIEEVCNEWKTAIDDIKTEYLKKNKELHDDLEFRIMN-GINRGEKY-------------LEHIEYALEFTKSYLDKCSNVEFCKIIKVVLNCLTDLSEK----------QIDTDVRTSIPFKENVSSITNVIRTN 1185
            ICS C   +  P VL CLH F   CL  +    S+   ++CP C       +S+ P          E  V+ +  N F                                +  L   L+    ++ ++++I      +A  KP+ C  H       YC  C    C  C   +HA+H TV L+D  E+ +  +              ++ ++ +N  L E++++       I ++ N+  + +DDI + + +  K L+      +M   +N G K+              E I+    FT   L+  +  E   + K +   L +L+++          Q+D  V T    K+++ ++  ++ TN
Sbjct:   49 ICSICLERYKNPKVLPCLHTFCERCLQNYIPAHSL--TLSCPVCRQ-----TSILP----------EKGVAALQNNFF--------------------------------ITNLMDVLQRTPGSNAEESSILETVTAVAAGKPLSCPNHDGNVMEFYCQSCETAMCRECTEGEHAEHPTVPLKDVVEQHKASL--------------QVQLDAVNKRLPEIDSALQFISEIIHQLTNQKASIVDDIHSTFDELQKTLNVRKSVLLMELEVNYGLKHKVLQSQLDTLLQGQESIKSCSNFTAQALNHGTETEVLLVKKQMSEKLNELADQDFPLHPRENDQLDFIVETE-GLKKSIHNLGTILTTN 349          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Human
Match: TRIM3 (tripartite motif containing 3 [Source:HGNC Symbol;Acc:HGNC:10064])

HSP 1 Score: 102.834 bits (255), Expect = 2.045e-21
Identity = 87/266 (32.71%), Postives = 129/266 (48.50%), Query Frame = 1
Query: 1765 RWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWFDCSSCMRE----PSDIAVHG-DEYFICDFKGHCVCVFKQDGTFVQRFGNETIT----NFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNH 2535
            R GS G  +GE ++  G     S  IVVAD+ N  IQ+F+ +GQF  +FGV GR  GQL  P  VA + +    +V D  N    + IF   G F  KI    +    G+AV+  GHI+ VD+ S  VF     G+L+  F            P  +AV+  +E  + DF  H V V+  DG F+ +FG+        N P G+ V  +G++++ D   +R  I V+   G  +S     +  +    GL +TS+G++V     NH
Sbjct:  434 RVGSRGREKGEFTNLQGVSAASSGRIVVADSNNQCIQVFSNEGQFKFRFGVRGRSPGQLQRPTGVA-VDTNGDIIVADYDNR--WVSIFSPEGKFKTKIGAGRLMGPKGVAVDRNGHIIVVDNKSCCVFTFQPNGKLVGRFGGRGATDRHFAGPHFVAVNNKNEIVVTDFHNHSVKVYSADGEFLFKFGSHGEGNGQFNAPTGVAVDSNGNIIVADWGNSR--IQVFDSSGSFLSYINTSAEPLYGPQGLALTSDGHVVVADAGNH 694          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Human
Match: TRIM3 (tripartite motif containing 3 [Source:HGNC Symbol;Acc:HGNC:10064])

HSP 1 Score: 102.449 bits (254), Expect = 2.873e-21
Identity = 87/266 (32.71%), Postives = 129/266 (48.50%), Query Frame = 1
Query: 1765 RWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWFDCSSCMRE----PSDIAVHG-DEYFICDFKGHCVCVFKQDGTFVQRFGNETIT----NFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNH 2535
            R GS G  +GE ++  G     S  IVVAD+ N  IQ+F+ +GQF  +FGV GR  GQL  P  VA + +    +V D  N    + IF   G F  KI    +    G+AV+  GHI+ VD+ S  VF     G+L+  F            P  +AV+  +E  + DF  H V V+  DG F+ +FG+        N P G+ V  +G++++ D   +R  I V+   G  +S     +  +    GL +TS+G++V     NH
Sbjct:  475 RVGSRGREKGEFTNLQGVSAASSGRIVVADSNNQCIQVFSNEGQFKFRFGVRGRSPGQLQRPTGVA-VDTNGDIIVADYDNR--WVSIFSPEGKFKTKIGAGRLMGPKGVAVDRNGHIIVVDNKSCCVFTFQPNGKLVGRFGGRGATDRHFAGPHFVAVNNKNEIVVTDFHNHSVKVYSADGEFLFKFGSHGEGNGQFNAPTGVAVDSNGNIIVADWGNSR--IQVFDSSGSFLSYINTSAEPLYGPQGLALTSDGHVVVADAGNH 735          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Human
Match: TRIM3 (tripartite motif containing 3 [Source:HGNC Symbol;Acc:HGNC:10064])

HSP 1 Score: 102.449 bits (254), Expect = 2.873e-21
Identity = 87/266 (32.71%), Postives = 129/266 (48.50%), Query Frame = 1
Query: 1765 RWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWFDCSSCMRE----PSDIAVHG-DEYFICDFKGHCVCVFKQDGTFVQRFGNETIT----NFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNH 2535
            R GS G  +GE ++  G     S  IVVAD+ N  IQ+F+ +GQF  +FGV GR  GQL  P  VA + +    +V D  N    + IF   G F  KI    +    G+AV+  GHI+ VD+ S  VF     G+L+  F            P  +AV+  +E  + DF  H V V+  DG F+ +FG+        N P G+ V  +G++++ D   +R  I V+   G  +S     +  +    GL +TS+G++V     NH
Sbjct:  475 RVGSRGREKGEFTNLQGVSAASSGRIVVADSNNQCIQVFSNEGQFKFRFGVRGRSPGQLQRPTGVA-VDTNGDIIVADYDNR--WVSIFSPEGKFKTKIGAGRLMGPKGVAVDRNGHIIVVDNKSCCVFTFQPNGKLVGRFGGRGATDRHFAGPHFVAVNNKNEIVVTDFHNHSVKVYSADGEFLFKFGSHGEGNGQFNAPTGVAVDSNGNIIVADWGNSR--IQVFDSSGSFLSYINTSAEPLYGPQGLALTSDGHVVVADAGNH 735          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Celegans
Match: nhl-2 (NHL (Ring finger b-box coiled coil) domain containing [Source:UniProtKB/TrEMBL;Acc:Q19818])

HSP 1 Score: 179.489 bits (454), Expect = 2.295e-45
Identity = 98/270 (36.30%), Postives = 157/270 (58.15%), Query Frame = 1
Query: 1780 GSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQ-RYVVCDRGNE-RSRMQIFGRSGHFLRKISIRY------IDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWFDCSSCMREPSDIAVHGDEYFICDFKGHCVCVFKQDGTFVQRFGNETITNFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNHHVLVMDTLYI 2565
            GS   E+  P GFCL  +++I++ADT NHR+ +      +  + G  G D+GQL FPRKV  +R    RYVV D+G + ++R QIF   G F++++++        I++ A  A  N G ++ VD+      +  +   +  WFD S+ + E SD+A+  +  +I DFK HCV V+  +G F+++ G  + T +P GIDVS  G+VL+ D+HGN  H+ V+S +G+ +  F     ++SR  GL+I   G++VTL K+NH + V   L +
Sbjct:  745 GSTIRELHCPSGFCLSDTDDILIADTNNHRVVVCGPPHPW--KIGRPGTDDGQLCFPRKVIALRGEAVRYVVLDKGGDGKTRAQIFEARGEFVKRLNMMALVPRGGIEVSAAAATPN-GQLLLVDTAGFVYSIDVDAPRVTFWFDASTQLGEASDVAMFDNLIYITDFKHHCVQVYTSEGKFIRKMGEPSQTPYPIGIDVSKAGEVLVADTHGNHLHVVVFSPEGQHIHSFTHNEFRLSRCVGLRIAKSGHIVTLCKHNHTLFVFKPLIL 1011          

HSP 2 Score: 58.151 bits (139), Expect = 4.422e-8
Identity = 76/359 (21.17%), Postives = 136/359 (37.88%), Query Frame = 1
Query:  166 CSQCKNSFSEPVVLNCLHIFDRGCL----------------SKFECTDSIFP----------------VVTCPKCHMQSGSLSSLKPYITQYAI------ESKEINVSTIDFNDFK-CVLCTSGEDSKYKCVDCAGLLCERCKILHKEVKFLNSHLEVEELTDEDKTNIKLLKKHLADNKPVKCEVHCERKYTNY-CIQCGMLACSRCLLSDHADHSTVLLQDFP-EKIRFRIGNYIENCIKAEEMNKIAIEKLNNALMEVNNSHDENKTHIEEVCNEWKTAIDDIKTEYLKKNKELHDDLEFRIMNGINRGEKYLE------HIEYALEFTKSYLDKCSNVEFCKIIKVVLNCLTDLS 1101
            C  C+  F +P VL+CLH     C+                 K   T ++                  V+ CP C  +S   + ++ Y+    +      E KE+ V  +  +  K C  C S +++   C  C+  LCE C   H  +     H  V    D     ++    H  + + V C  H   ++  Y C  C   AC +CL  DH +H  + + +     IR  + + ++   K    +   +  L +   ++N  ++  K  +++   E + +I++         K ++D  E RI    N  E Y +       +  A+ FT+  L K + +E     K V+    +LS
Sbjct:   62 CPYCQQDFRKPRVLDCLHSMCEDCIIAQLDGHLQAKSAAIEEKKRATAAMLDCELETPKVKERPTPPGVIRCPICSQESHVGNDVR-YVHAMLLDFVRLAEMKEVEVEKMVAHHRKPCTACKSEQEAIAFCDQCSSDLCENCTTAHTVMNLFQGHT-VTTFAD-----LRQPGAH-PELRQVMCSTH--NQHMRYLCAACETAACKQCLEVDHLNHKIIDINELVINAIREDVTSTVDRVEKKYNNSVADMNSLPDKSQQLNEQYEIAKYRVDKHYEELRNSIEE------AYQKSVNDLEEARIRQESNIDEMYRKSQVNEARVHDAINFTRRLLTKGNGLELVVSRKKVIQQFGNLS 404          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Celegans
Match: ncl-1 (B-box type zinc finger protein ncl-1 [Source:UniProtKB/Swiss-Prot;Acc:P34611])

HSP 1 Score: 153.295 bits (386), Expect = 1.793e-37
Identity = 83/261 (31.80%), Postives = 150/261 (57.47%), Query Frame = 1
Query: 1750 MTVKARWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWFDCSSCMREPSDIAVH-GDEYFICDFKGHCVCVFKQDGTFVQRFGNETITNFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKN 2529
            M    ++G  G   G+ + P G  +    +IVVADT NHRIQ+F K+G+F  QFG  G+ +GQL +P +VA+ R+T  +VV +R +   ++Q++ + G FLRK     +    G+ V++ G I+ V+     V +    G +++ F CS  +  P+ +  +  +E  I D + HC+ VF  +G ++++ G E +TN+P G+ ++  G+V++ D+H N F++ V+S DG ++   E   VK ++   + +  +G +V  +K+
Sbjct:  573 MIYHCKFGEFGVMEGQFTEPSGVAVNGQGDIVVADTNNHRIQVFDKEGRFKFQFGECGKRDGQLLYPNRVAVNRTTGDFVVTER-SPTHQIQVYNQYGQFLRKFGANILQHPRGVCVDSKGRIIVVECKVMRVIIFDMFGNILQKFSCSRYLEFPNGVCTNDKNEILISDNRAHCIKVFSYEGQYLRQIGGEGVTNYPIGVGINSLGEVVVADNH-NNFNLTVFSQDGTMIGALES-RVKHAQCFDVALVDDGSVVLASKD 830          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Celegans
Match: ncl-1 (B-box type zinc finger protein ncl-1 [Source:UniProtKB/Swiss-Prot;Acc:P34611])

HSP 1 Score: 152.91 bits (385), Expect = 2.109e-37
Identity = 83/261 (31.80%), Postives = 150/261 (57.47%), Query Frame = 1
Query: 1750 MTVKARWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWFDCSSCMREPSDIAVH-GDEYFICDFKGHCVCVFKQDGTFVQRFGNETITNFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKN 2529
            M    ++G  G   G+ + P G  +    +IVVADT NHRIQ+F K+G+F  QFG  G+ +GQL +P +VA+ R+T  +VV +R +   ++Q++ + G FLRK     +    G+ V++ G I+ V+     V +    G +++ F CS  +  P+ +  +  +E  I D + HC+ VF  +G ++++ G E +TN+P G+ ++  G+V++ D+H N F++ V+S DG ++   E   VK ++   + +  +G +V  +K+
Sbjct:  570 MIYHCKFGEFGVMEGQFTEPSGVAVNGQGDIVVADTNNHRIQVFDKEGRFKFQFGECGKRDGQLLYPNRVAVNRTTGDFVVTER-SPTHQIQVYNQYGQFLRKFGANILQHPRGVCVDSKGRIIVVECKVMRVIIFDMFGNILQKFSCSRYLEFPNGVCTNDKNEILISDNRAHCIKVFSYEGQYLRQIGGEGVTNYPIGVGINSLGEVVVADNH-NNFNLTVFSQDGTMIGALES-RVKHAQCFDVALVDDGSVVLASKD 827          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Celegans
Match: ncl-1 (B-box type zinc finger protein ncl-1 [Source:UniProtKB/Swiss-Prot;Acc:P34611])

HSP 1 Score: 152.525 bits (384), Expect = 3.504e-37
Identity = 83/261 (31.80%), Postives = 150/261 (57.47%), Query Frame = 1
Query: 1750 MTVKARWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWFDCSSCMREPSDIAVH-GDEYFICDFKGHCVCVFKQDGTFVQRFGNETITNFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKN 2529
            M    ++G  G   G+ + P G  +    +IVVADT NHRIQ+F K+G+F  QFG  G+ +GQL +P +VA+ R+T  +VV +R +   ++Q++ + G FLRK     +    G+ V++ G I+ V+     V +    G +++ F CS  +  P+ +  +  +E  I D + HC+ VF  +G ++++ G E +TN+P G+ ++  G+V++ D+H N F++ V+S DG ++   E   VK ++   + +  +G +V  +K+
Sbjct:  632 MIYHCKFGEFGVMEGQFTEPSGVAVNGQGDIVVADTNNHRIQVFDKEGRFKFQFGECGKRDGQLLYPNRVAVNRTTGDFVVTER-SPTHQIQVYNQYGQFLRKFGANILQHPRGVCVDSKGRIIVVECKVMRVIIFDMFGNILQKFSCSRYLEFPNGVCTNDKNEILISDNRAHCIKVFSYEGQYLRQIGGEGVTNYPIGVGINSLGEVVVADNH-NNFNLTVFSQDGTMIGALE-SRVKHAQCFDVALVDDGSVVLASKD 889          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Celegans
Match: ncl-1 (B-box type zinc finger protein ncl-1 [Source:UniProtKB/Swiss-Prot;Acc:P34611])

HSP 1 Score: 152.91 bits (385), Expect = 3.577e-37
Identity = 83/261 (31.80%), Postives = 150/261 (57.47%), Query Frame = 1
Query: 1750 MTVKARWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWFDCSSCMREPSDIAVH-GDEYFICDFKGHCVCVFKQDGTFVQRFGNETITNFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKN 2529
            M    ++G  G   G+ + P G  +    +IVVADT NHRIQ+F K+G+F  QFG  G+ +GQL +P +VA+ R+T  +VV +R +   ++Q++ + G FLRK     +    G+ V++ G I+ V+     V +    G +++ F CS  +  P+ +  +  +E  I D + HC+ VF  +G ++++ G E +TN+P G+ ++  G+V++ D+H N F++ V+S DG ++   E   VK ++   + +  +G +V  +K+
Sbjct:  698 MIYHCKFGEFGVMEGQFTEPSGVAVNGQGDIVVADTNNHRIQVFDKEGRFKFQFGECGKRDGQLLYPNRVAVNRTTGDFVVTER-SPTHQIQVYNQYGQFLRKFGANILQHPRGVCVDSKGRIIVVECKVMRVIIFDMFGNILQKFSCSRYLEFPNGVCTNDKNEILISDNRAHCIKVFSYEGQYLRQIGGEGVTNYPIGVGINSLGEVVVADNH-NNFNLTVFSQDGTMIGALES-RVKHAQCFDVALVDDGSVVLASKD 955          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Fly
Match: mei-P26 (gene:FBgn0026206 transcript:FBtr0333473)

HSP 1 Score: 402.905 bits (1034), Expect = 3.389e-119
Identity = 190/276 (68.84%), Postives = 234/276 (84.78%), Query Frame = 1
Query: 1738 QCAAMTVKARWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWFDCSSCMREPSDIAVHGDEYFICDFKGHCVCVFKQDGTFVQRFGNETITNFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNHHVLVMDTLYI 2565
            +   M ++ ++GSLG+ +G+ +SPHGFCLG  EEI+VADT NHRI++F K G    QFGVAG++EGQLW+PRKVA++ +  ++VVCDRGNERSRMQIF + GHF+RKI+IRYIDIVAGLAV   GHIVAVDSVSP+VFV+SE GEL++WFDCS  MREPSDIA+  +++++CDFKGHCV VF+ DGTF+ R GNE +T FPNGID+S+ GDVLIGDSHGNRFH+A YS +G L SEFECP VKVSR CGLKITSEGY+VTLAKNNHHVLV++TLY+
Sbjct:  913 KATPMQIRCKFGSLGTAKGQFNSPHGFCLGVDEEIIVADTNNHRIEVFDKMGALKFQFGVAGKEEGQLWYPRKVAVMHNNGKFVVCDRGNERSRMQIFSKCGHFMRKIAIRYIDIVAGLAVTAKGHIVAVDSVSPTVFVISEEGELVRWFDCSDYMREPSDIAIRDNDFYVCDFKGHCVAVFQDDGTFLYRIGNEKVTCFPNGIDISNAGDVLIGDSHGNRFHVACYSREGALQSEFECPHVKVSRCCGLKITSEGYVVTLAKNNHHVLVLNTLYV 1188          

HSP 2 Score: 123.25 bits (308), Expect = 7.848e-28
Identity = 90/373 (24.13%), Postives = 157/373 (42.09%), Query Frame = 1
Query:  163 ICSQCKNSFSEPVVLNCLHIFDRGCLSKFECTDSIFPV-----------------------VTCPKCHMQSG-SLSSLKPYITQYAIESKEINVSTIDFNDFKCVLCTSGEDSKYKCVDCAGLLCERCKILHKEVKFLNSH--LEVEELTDEDKTNIKLLKKHLADNKPVKCEVHCERKYTNYCIQCGMLACSRCLLSDH--ADHSTVLLQDFPEKIRFRIGNYIENCIKAEEMNKIAIEKLNNALMEVNNSHDENKTHIEEVCNEWKTAIDDIKTEYLKKNKELHDDLEFRIMNGINRGEKYLEHIEYALEFTKSYLDKCSNVEFCKIIKVVLNCLTDLSEKQIDTDVRTSIPFKENVSSITNVIRTNFGVF 1197
            +C  C      P +L+CLH+F   CL      D++                          + CP C  ++      +K     Y I +  +++S ++     C  C S E++  +C DCA  LC  C   HK ++   +H  + +E+LT       K +   L  +KPV C  H       YC  C +  C+ CLLSDH  +DH         + +R  +   + + +K  +    A   L +AL E+ + HD  +  IE+    +K  ++ IK + L +   LH D E +IM+ +   E  +  +++A +F +  +DK +++EF  +  ++     +L E+    D+   + F           R  FG F
Sbjct:  160 LCKLCSLRLVMPRILSCLHVFCEDCLQAVVSKDTMSASSPNSCSSSSFDGSEHQNRLSAVFIECPVCKQETPLGPKGIKALPCDY-IVTNILDLSNLESEHIVCTSCKSKEEAISRCNDCANFLCNGCDNAHKYMRCFENHHVVRIEDLT-------KNVHDKLIIHKPVFCPQHVSENLKYYCFTCQVPTCNDCLLSDHKGSDHHYETATVAEQAVRADLEETLSDTLKKADYCNDAGSNLGSALTELQSQHDTVRQQIEDAYKCYKRMLESIKDQMLNELGRLHSDRELKIMDLMQSMENTMGKLQHAAQFGQRAVDKANSIEFLLLKPIISAQCLNLMEQTPKCDINYQLQFDSKPEMFEQFAREMFGKF 524          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Fly
Match: mei-P26 (gene:FBgn0026206 transcript:FBtr0071303)

HSP 1 Score: 402.905 bits (1034), Expect = 3.389e-119
Identity = 190/276 (68.84%), Postives = 234/276 (84.78%), Query Frame = 1
Query: 1738 QCAAMTVKARWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWFDCSSCMREPSDIAVHGDEYFICDFKGHCVCVFKQDGTFVQRFGNETITNFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNHHVLVMDTLYI 2565
            +   M ++ ++GSLG+ +G+ +SPHGFCLG  EEI+VADT NHRI++F K G    QFGVAG++EGQLW+PRKVA++ +  ++VVCDRGNERSRMQIF + GHF+RKI+IRYIDIVAGLAV   GHIVAVDSVSP+VFV+SE GEL++WFDCS  MREPSDIA+  +++++CDFKGHCV VF+ DGTF+ R GNE +T FPNGID+S+ GDVLIGDSHGNRFH+A YS +G L SEFECP VKVSR CGLKITSEGY+VTLAKNNHHVLV++TLY+
Sbjct:  913 KATPMQIRCKFGSLGTAKGQFNSPHGFCLGVDEEIIVADTNNHRIEVFDKMGALKFQFGVAGKEEGQLWYPRKVAVMHNNGKFVVCDRGNERSRMQIFSKCGHFMRKIAIRYIDIVAGLAVTAKGHIVAVDSVSPTVFVISEEGELVRWFDCSDYMREPSDIAIRDNDFYVCDFKGHCVAVFQDDGTFLYRIGNEKVTCFPNGIDISNAGDVLIGDSHGNRFHVACYSREGALQSEFECPHVKVSRCCGLKITSEGYVVTLAKNNHHVLVLNTLYV 1188          

HSP 2 Score: 123.25 bits (308), Expect = 7.848e-28
Identity = 90/373 (24.13%), Postives = 157/373 (42.09%), Query Frame = 1
Query:  163 ICSQCKNSFSEPVVLNCLHIFDRGCLSKFECTDSIFPV-----------------------VTCPKCHMQSG-SLSSLKPYITQYAIESKEINVSTIDFNDFKCVLCTSGEDSKYKCVDCAGLLCERCKILHKEVKFLNSH--LEVEELTDEDKTNIKLLKKHLADNKPVKCEVHCERKYTNYCIQCGMLACSRCLLSDH--ADHSTVLLQDFPEKIRFRIGNYIENCIKAEEMNKIAIEKLNNALMEVNNSHDENKTHIEEVCNEWKTAIDDIKTEYLKKNKELHDDLEFRIMNGINRGEKYLEHIEYALEFTKSYLDKCSNVEFCKIIKVVLNCLTDLSEKQIDTDVRTSIPFKENVSSITNVIRTNFGVF 1197
            +C  C      P +L+CLH+F   CL      D++                          + CP C  ++      +K     Y I +  +++S ++     C  C S E++  +C DCA  LC  C   HK ++   +H  + +E+LT       K +   L  +KPV C  H       YC  C +  C+ CLLSDH  +DH         + +R  +   + + +K  +    A   L +AL E+ + HD  +  IE+    +K  ++ IK + L +   LH D E +IM+ +   E  +  +++A +F +  +DK +++EF  +  ++     +L E+    D+   + F           R  FG F
Sbjct:  160 LCKLCSLRLVMPRILSCLHVFCEDCLQAVVSKDTMSASSPNSCSSSSFDGSEHQNRLSAVFIECPVCKQETPLGPKGIKALPCDY-IVTNILDLSNLESEHIVCTSCKSKEEAISRCNDCANFLCNGCDNAHKYMRCFENHHVVRIEDLT-------KNVHDKLIIHKPVFCPQHVSENLKYYCFTCQVPTCNDCLLSDHKGSDHHYETATVAEQAVRADLEETLSDTLKKADYCNDAGSNLGSALTELQSQHDTVRQQIEDAYKCYKRMLESIKDQMLNELGRLHSDRELKIMDLMQSMENTMGKLQHAAQFGQRAVDKANSIEFLLLKPIISAQCLNLMEQTPKCDINYQLQFDSKPEMFEQFAREMFGKF 524          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Fly
Match: mei-P26 (gene:FBgn0026206 transcript:FBtr0333475)

HSP 1 Score: 402.905 bits (1034), Expect = 3.389e-119
Identity = 190/276 (68.84%), Postives = 234/276 (84.78%), Query Frame = 1
Query: 1738 QCAAMTVKARWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWFDCSSCMREPSDIAVHGDEYFICDFKGHCVCVFKQDGTFVQRFGNETITNFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNHHVLVMDTLYI 2565
            +   M ++ ++GSLG+ +G+ +SPHGFCLG  EEI+VADT NHRI++F K G    QFGVAG++EGQLW+PRKVA++ +  ++VVCDRGNERSRMQIF + GHF+RKI+IRYIDIVAGLAV   GHIVAVDSVSP+VFV+SE GEL++WFDCS  MREPSDIA+  +++++CDFKGHCV VF+ DGTF+ R GNE +T FPNGID+S+ GDVLIGDSHGNRFH+A YS +G L SEFECP VKVSR CGLKITSEGY+VTLAKNNHHVLV++TLY+
Sbjct:  913 KATPMQIRCKFGSLGTAKGQFNSPHGFCLGVDEEIIVADTNNHRIEVFDKMGALKFQFGVAGKEEGQLWYPRKVAVMHNNGKFVVCDRGNERSRMQIFSKCGHFMRKIAIRYIDIVAGLAVTAKGHIVAVDSVSPTVFVISEEGELVRWFDCSDYMREPSDIAIRDNDFYVCDFKGHCVAVFQDDGTFLYRIGNEKVTCFPNGIDISNAGDVLIGDSHGNRFHVACYSREGALQSEFECPHVKVSRCCGLKITSEGYVVTLAKNNHHVLVLNTLYV 1188          

HSP 2 Score: 123.25 bits (308), Expect = 7.848e-28
Identity = 90/373 (24.13%), Postives = 157/373 (42.09%), Query Frame = 1
Query:  163 ICSQCKNSFSEPVVLNCLHIFDRGCLSKFECTDSIFPV-----------------------VTCPKCHMQSG-SLSSLKPYITQYAIESKEINVSTIDFNDFKCVLCTSGEDSKYKCVDCAGLLCERCKILHKEVKFLNSH--LEVEELTDEDKTNIKLLKKHLADNKPVKCEVHCERKYTNYCIQCGMLACSRCLLSDH--ADHSTVLLQDFPEKIRFRIGNYIENCIKAEEMNKIAIEKLNNALMEVNNSHDENKTHIEEVCNEWKTAIDDIKTEYLKKNKELHDDLEFRIMNGINRGEKYLEHIEYALEFTKSYLDKCSNVEFCKIIKVVLNCLTDLSEKQIDTDVRTSIPFKENVSSITNVIRTNFGVF 1197
            +C  C      P +L+CLH+F   CL      D++                          + CP C  ++      +K     Y I +  +++S ++     C  C S E++  +C DCA  LC  C   HK ++   +H  + +E+LT       K +   L  +KPV C  H       YC  C +  C+ CLLSDH  +DH         + +R  +   + + +K  +    A   L +AL E+ + HD  +  IE+    +K  ++ IK + L +   LH D E +IM+ +   E  +  +++A +F +  +DK +++EF  +  ++     +L E+    D+   + F           R  FG F
Sbjct:  160 LCKLCSLRLVMPRILSCLHVFCEDCLQAVVSKDTMSASSPNSCSSSSFDGSEHQNRLSAVFIECPVCKQETPLGPKGIKALPCDY-IVTNILDLSNLESEHIVCTSCKSKEEAISRCNDCANFLCNGCDNAHKYMRCFENHHVVRIEDLT-------KNVHDKLIIHKPVFCPQHVSENLKYYCFTCQVPTCNDCLLSDHKGSDHHYETATVAEQAVRADLEETLSDTLKKADYCNDAGSNLGSALTELQSQHDTVRQQIEDAYKCYKRMLESIKDQMLNELGRLHSDRELKIMDLMQSMENTMGKLQHAAQFGQRAVDKANSIEFLLLKPIISAQCLNLMEQTPKCDINYQLQFDSKPEMFEQFAREMFGKF 524          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Fly
Match: mei-P26 (gene:FBgn0026206 transcript:FBtr0333474)

HSP 1 Score: 402.905 bits (1034), Expect = 4.222e-119
Identity = 190/276 (68.84%), Postives = 234/276 (84.78%), Query Frame = 1
Query: 1738 QCAAMTVKARWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWFDCSSCMREPSDIAVHGDEYFICDFKGHCVCVFKQDGTFVQRFGNETITNFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNHHVLVMDTLYI 2565
            +   M ++ ++GSLG+ +G+ +SPHGFCLG  EEI+VADT NHRI++F K G    QFGVAG++EGQLW+PRKVA++ +  ++VVCDRGNERSRMQIF + GHF+RKI+IRYIDIVAGLAV   GHIVAVDSVSP+VFV+SE GEL++WFDCS  MREPSDIA+  +++++CDFKGHCV VF+ DGTF+ R GNE +T FPNGID+S+ GDVLIGDSHGNRFH+A YS +G L SEFECP VKVSR CGLKITSEGY+VTLAKNNHHVLV++TLY+
Sbjct:  930 KATPMQIRCKFGSLGTAKGQFNSPHGFCLGVDEEIIVADTNNHRIEVFDKMGALKFQFGVAGKEEGQLWYPRKVAVMHNNGKFVVCDRGNERSRMQIFSKCGHFMRKIAIRYIDIVAGLAVTAKGHIVAVDSVSPTVFVISEEGELVRWFDCSDYMREPSDIAIRDNDFYVCDFKGHCVAVFQDDGTFLYRIGNEKVTCFPNGIDISNAGDVLIGDSHGNRFHVACYSREGALQSEFECPHVKVSRCCGLKITSEGYVVTLAKNNHHVLVLNTLYV 1205          

HSP 2 Score: 123.25 bits (308), Expect = 7.807e-28
Identity = 90/373 (24.13%), Postives = 157/373 (42.09%), Query Frame = 1
Query:  163 ICSQCKNSFSEPVVLNCLHIFDRGCLSKFECTDSIFPV-----------------------VTCPKCHMQSG-SLSSLKPYITQYAIESKEINVSTIDFNDFKCVLCTSGEDSKYKCVDCAGLLCERCKILHKEVKFLNSH--LEVEELTDEDKTNIKLLKKHLADNKPVKCEVHCERKYTNYCIQCGMLACSRCLLSDH--ADHSTVLLQDFPEKIRFRIGNYIENCIKAEEMNKIAIEKLNNALMEVNNSHDENKTHIEEVCNEWKTAIDDIKTEYLKKNKELHDDLEFRIMNGINRGEKYLEHIEYALEFTKSYLDKCSNVEFCKIIKVVLNCLTDLSEKQIDTDVRTSIPFKENVSSITNVIRTNFGVF 1197
            +C  C      P +L+CLH+F   CL      D++                          + CP C  ++      +K     Y I +  +++S ++     C  C S E++  +C DCA  LC  C   HK ++   +H  + +E+LT       K +   L  +KPV C  H       YC  C +  C+ CLLSDH  +DH         + +R  +   + + +K  +    A   L +AL E+ + HD  +  IE+    +K  ++ IK + L +   LH D E +IM+ +   E  +  +++A +F +  +DK +++EF  +  ++     +L E+    D+   + F           R  FG F
Sbjct:  160 LCKLCSLRLVMPRILSCLHVFCEDCLQAVVSKDTMSASSPNSCSSSSFDGSEHQNRLSAVFIECPVCKQETPLGPKGIKALPCDY-IVTNILDLSNLESEHIVCTSCKSKEEAISRCNDCANFLCNGCDNAHKYMRCFENHHVVRIEDLT-------KNVHDKLIIHKPVFCPQHVSENLKYYCFTCQVPTCNDCLLSDHKGSDHHYETATVAEQAVRADLEETLSDTLKKADYCNDAGSNLGSALTELQSQHDTVRQQIEDAYKCYKRMLESIKDQMLNELGRLHSDRELKIMDLMQSMENTMGKLQHAAQFGQRAVDKANSIEFLLLKPIISAQCLNLMEQTPKCDINYQLQFDSKPEMFEQFAREMFGKF 524          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Fly
Match: mei-P26 (gene:FBgn0026206 transcript:FBtr0340341)

HSP 1 Score: 402.905 bits (1034), Expect = 4.222e-119
Identity = 190/276 (68.84%), Postives = 234/276 (84.78%), Query Frame = 1
Query: 1738 QCAAMTVKARWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWFDCSSCMREPSDIAVHGDEYFICDFKGHCVCVFKQDGTFVQRFGNETITNFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNHHVLVMDTLYI 2565
            +   M ++ ++GSLG+ +G+ +SPHGFCLG  EEI+VADT NHRI++F K G    QFGVAG++EGQLW+PRKVA++ +  ++VVCDRGNERSRMQIF + GHF+RKI+IRYIDIVAGLAV   GHIVAVDSVSP+VFV+SE GEL++WFDCS  MREPSDIA+  +++++CDFKGHCV VF+ DGTF+ R GNE +T FPNGID+S+ GDVLIGDSHGNRFH+A YS +G L SEFECP VKVSR CGLKITSEGY+VTLAKNNHHVLV++TLY+
Sbjct:  930 KATPMQIRCKFGSLGTAKGQFNSPHGFCLGVDEEIIVADTNNHRIEVFDKMGALKFQFGVAGKEEGQLWYPRKVAVMHNNGKFVVCDRGNERSRMQIFSKCGHFMRKIAIRYIDIVAGLAVTAKGHIVAVDSVSPTVFVISEEGELVRWFDCSDYMREPSDIAIRDNDFYVCDFKGHCVAVFQDDGTFLYRIGNEKVTCFPNGIDISNAGDVLIGDSHGNRFHVACYSREGALQSEFECPHVKVSRCCGLKITSEGYVVTLAKNNHHVLVLNTLYV 1205          

HSP 2 Score: 123.25 bits (308), Expect = 7.807e-28
Identity = 90/373 (24.13%), Postives = 157/373 (42.09%), Query Frame = 1
Query:  163 ICSQCKNSFSEPVVLNCLHIFDRGCLSKFECTDSIFPV-----------------------VTCPKCHMQSG-SLSSLKPYITQYAIESKEINVSTIDFNDFKCVLCTSGEDSKYKCVDCAGLLCERCKILHKEVKFLNSH--LEVEELTDEDKTNIKLLKKHLADNKPVKCEVHCERKYTNYCIQCGMLACSRCLLSDH--ADHSTVLLQDFPEKIRFRIGNYIENCIKAEEMNKIAIEKLNNALMEVNNSHDENKTHIEEVCNEWKTAIDDIKTEYLKKNKELHDDLEFRIMNGINRGEKYLEHIEYALEFTKSYLDKCSNVEFCKIIKVVLNCLTDLSEKQIDTDVRTSIPFKENVSSITNVIRTNFGVF 1197
            +C  C      P +L+CLH+F   CL      D++                          + CP C  ++      +K     Y I +  +++S ++     C  C S E++  +C DCA  LC  C   HK ++   +H  + +E+LT       K +   L  +KPV C  H       YC  C +  C+ CLLSDH  +DH         + +R  +   + + +K  +    A   L +AL E+ + HD  +  IE+    +K  ++ IK + L +   LH D E +IM+ +   E  +  +++A +F +  +DK +++EF  +  ++     +L E+    D+   + F           R  FG F
Sbjct:  160 LCKLCSLRLVMPRILSCLHVFCEDCLQAVVSKDTMSASSPNSCSSSSFDGSEHQNRLSAVFIECPVCKQETPLGPKGIKALPCDY-IVTNILDLSNLESEHIVCTSCKSKEEAISRCNDCANFLCNGCDNAHKYMRCFENHHVVRIEDLT-------KNVHDKLIIHKPVFCPQHVSENLKYYCFTCQVPTCNDCLLSDHKGSDHHYETATVAEQAVRADLEETLSDTLKKADYCNDAGSNLGSALTELQSQHDTVRQQIEDAYKCYKRMLESIKDQMLNELGRLHSDRELKIMDLMQSMENTMGKLQHAAQFGQRAVDKANSIEFLLLKPIISAQCLNLMEQTPKCDINYQLQFDSKPEMFEQFAREMFGKF 524          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Zebrafish
Match: trim3b (tripartite motif containing 3b [Source:ZFIN;Acc:ZDB-GENE-070112-1132])

HSP 1 Score: 112.849 bits (281), Expect = 9.928e-25
Identity = 86/266 (32.33%), Postives = 132/266 (49.62%), Query Frame = 1
Query: 1765 RWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWFDCSSC----MREPSDIAVHG-DEYFICDFKGHCVCVFKQDGTFVQRFGNETIT----NFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNH 2535
            R G+ G  +GE ++  G     S  ++VAD+ N  IQ+FT DGQF ++FGV GR  GQL  P  VA + +    +V D  N    + IF   G F  KI    +    G+AV+  GHI+AVD+ +  VF+    G+L+  F            P  +AV+  +E  + DF  H V V+  DG F+ +FG+        N P G+ V  +G++++ D   +R  I V+   G  +S     +  +    GL +TS+G++V     NH
Sbjct:  483 RVGTRGREKGEFTNLQGISASISGRVIVADSNNQCIQVFTNDGQFKARFGVRGRSPGQLQRPTGVA-VDTNGDVIVADYDNR--WISIFSPDGKFKNKIGAGRLMGPKGVAVDRNGHIIAVDNKACCVFIFQSNGKLVTKFGARGTSDRQFAGPHFVAVNNKNEIVVTDFHNHSVKVYSADGEFLFKFGSHGEGNGQFNAPTGVAVDVNGNIIVADWGNSR--IQVFDSAGSFLSYINTSADPLYGPQGLALTSDGHVVVADSGNH 743          

HSP 2 Score: 53.5286 bits (127), Expect = 2.225e-6
Identity = 71/315 (22.54%), Postives = 116/315 (36.83%), Query Frame = 1
Query:  163 ICSQCKNSFSEPVVLNCLHIFDRGCLSKFECTDSIFPVVTCPKCHMQSGSLSSLKPYITQYAIESKEINVSTIDFNDFKCVLCTSGEDSKYKCVDCAGLLCERCKILHKEVKFLNSHLEVEELTDEDKTNIKLLKKHLADNKPVKCEVHCERKYTNYCIQCGMLACSRCLLSDHADHSTVLLQDFPEK-----------IRFRIGNYIENCIKAEEMNKIAIEKLNNALMEVNNSHDENKTHIEEVCNEWKTA-IDDIKTEYLKKNKELHDDLEFRIMNGINRGEKYLEHIEYALEFTKSYLDKCSNVEFCKIIK 1071
            +CS C + +  P VL CLH F   CL  +    S+   ++CP C       +S+ P          E  V+ +  N F                     +    ++L ++           E +  +  ++       A  KP+ C  H  +    YC  C    C  C   +H +H TV L+D  E+           IR R+           E++K   E+ N A+ E+N + +E    +E   ++ K A I D++     K K L   L   ++ G        EHI+ +  FT+  L   S  E   + K
Sbjct:   26 VCSICLDHYHNPKVLPCLHTFCERCLQNYIPPQSL--TLSCPVCRQ-----TSILP----------EKGVAALQNNFF---------------------ITNLMEVLQRD----------SECSRPEACSVLESVSAAAAGKPLSCPNHEGKVMEFYCESCETAMCLECTEGEHREHVTVPLRDVLEQHKAVLKNQLDAIRNRLPQLTAAIEMVNEISKQLTERKNEAVNEINMTFEE----LERALHQRKAALITDLENICSTKQKVLQAQLS-SLLQG-------KEHIQSSCSFTEQALSHGSATEVLLVQK 280          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Zebrafish
Match: trim3b (tripartite motif containing 3b [Source:ZFIN;Acc:ZDB-GENE-070112-1132])

HSP 1 Score: 108.227 bits (269), Expect = 2.719e-23
Identity = 89/286 (31.12%), Postives = 135/286 (47.20%), Query Frame = 1
Query: 1765 RWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWFDC-------------SSCMRE-----------PSDIAVHG-DEYFICDFKGHCVCVFKQDGTFVQRFGNETIT----NFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNH 2535
            R G+ G  +GE ++  G     S  ++VAD+ N  IQ+FT DGQF ++FGV GR  GQL  P  VA + +    +V D  N    + IF   G F  KI    +    G+AV+  GHI+AVD+ +  VF+    G+L+  F               S C  E           P  +AV+  +E  + DF  H V V+  DG F+ +FG+        N P G+ V  +G++++ D   +R  I V+   G  +S     +  +    GL +TS+G++V     NH
Sbjct:  483 RVGTRGREKGEFTNLQGISASISGRVIVADSNNQCIQVFTNDGQFKARFGVRGRSPGQLQRPTGVA-VDTNGDVIVADYDNR--WISIFSPDGKFKNKIGAGRLMGPKGVAVDRNGHIIAVDNKACCVFIFQSNGKLVTKFGARGTSDRQFAEKSGSKCALEQKFSKSGPGFSPHFVAVNNKNEIVVTDFHNHSVKVYSADGEFLFKFGSHGEGNGQFNAPTGVAVDVNGNIIVADWGNSR--IQVFDSAGSFLSYINTSADPLYGPQGLALTSDGHVVVADSGNH 763          

HSP 2 Score: 53.5286 bits (127), Expect = 2.118e-6
Identity = 71/315 (22.54%), Postives = 116/315 (36.83%), Query Frame = 1
Query:  163 ICSQCKNSFSEPVVLNCLHIFDRGCLSKFECTDSIFPVVTCPKCHMQSGSLSSLKPYITQYAIESKEINVSTIDFNDFKCVLCTSGEDSKYKCVDCAGLLCERCKILHKEVKFLNSHLEVEELTDEDKTNIKLLKKHLADNKPVKCEVHCERKYTNYCIQCGMLACSRCLLSDHADHSTVLLQDFPEK-----------IRFRIGNYIENCIKAEEMNKIAIEKLNNALMEVNNSHDENKTHIEEVCNEWKTA-IDDIKTEYLKKNKELHDDLEFRIMNGINRGEKYLEHIEYALEFTKSYLDKCSNVEFCKIIK 1071
            +CS C + +  P VL CLH F   CL  +    S+   ++CP C       +S+ P          E  V+ +  N F                     +    ++L ++           E +  +  ++       A  KP+ C  H  +    YC  C    C  C   +H +H TV L+D  E+           IR R+           E++K   E+ N A+ E+N + +E    +E   ++ K A I D++     K K L   L   ++ G        EHI+ +  FT+  L   S  E   + K
Sbjct:   26 VCSICLDHYHNPKVLPCLHTFCERCLQNYIPPQSL--TLSCPVCRQ-----TSILP----------EKGVAALQNNFF---------------------ITNLMEVLQRD----------SECSRPEACSVLESVSAAAAGKPLSCPNHEGKVMEFYCESCETAMCLECTEGEHREHVTVPLRDVLEQHKAVLKNQLDAIRNRLPQLTAAIEMVNEISKQLTERKNEAVNEINMTFEE----LERALHQRKAALITDLENICSTKQKVLQAQLS-SLLQG-------KEHIQSSCSFTEQALSHGSATEVLLVQK 280          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Zebrafish
Match: trim2a (tripartite motif containing 2a [Source:ZFIN;Acc:ZDB-GENE-050327-99])

HSP 1 Score: 100.908 bits (250), Expect = 4.586e-21
Identity = 81/266 (30.45%), Postives = 131/266 (49.25%), Query Frame = 1
Query: 1765 RWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWF----DCSSCMREPSDIAV-HGDEYFICDFKGHCVCVFKQDGTFVQRFGNETIT----NFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNH 2535
            R G+ G  +GE ++  G       ++++AD+ N  +QIF+ DGQF S+FG+ GR  GQL  P  VA +  +   ++ D  N+   + IF   G F  KI    +    G++V+  GHI+ VD+ S  VF+    G+L+  F    +       P   AV   +E  + DF  H V VF  +G F+ +FG+        N P G+ V  +G++++ D   +R  I V+   G  +S     +  +    GL +TS+G++V     NH
Sbjct:  475 RIGTKGRNKGEFTNLQGVAASSVGKVLIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVA-VHPSGDIIIADYDNK--WVSIFSSDGKFKSKIGSGKLMGPKGVSVDRNGHIIVVDNKSCCVFIFQPNGKLVSKFGNRGNSDKQFAGPHFAAVNQNNEVIVTDFHNHSVKVFSPEGEFILKFGSNGEGNGQFNAPTGVAVDANGNIIVADWGNSR--IQVFDSSGSFLSYINTSADPLYGPQGLALTSDGHVVVADSGNH 735          

HSP 2 Score: 65.4698 bits (158), Expect = 4.541e-10
Identity = 38/121 (31.40%), Postives = 67/121 (55.37%), Query Frame = 1
Query: 1762 ARWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVA--GLAVNNMGHI 2118
            +++G+ G+   + + PH   +  + E++V D  NH +++F+ +G+F+ +FG  G   GQ   P  VA + +    +V D GN  SR+Q+F  SG FL  I+     +    GLA+ + GH+
Sbjct:  610 SKFGNRGNSDKQFAGPHFAAVNQNNEVIVTDFHNHSVKVFSPEGEFILKFGSNGEGNGQFNAPTGVA-VDANGNIIVADWGN--SRIQVFDSSGSFLSYINTSADPLYGPQGLALTSDGHV 727          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Zebrafish
Match: trim3a (tripartite motif containing 3a [Source:ZFIN;Acc:ZDB-GENE-080522-4])

HSP 1 Score: 98.2117 bits (243), Expect = 3.988e-20
Identity = 86/286 (30.07%), Postives = 132/286 (46.15%), Query Frame = 1
Query: 1765 RWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELI----------KWFDCSSCMREPSD--------------IAVHG-DEYFICDFKGHCVCVFKQDGTFVQRFGNETIT----NFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNH 2535
            R G+ G  RGE S+  G     S  IVVAD+ N  IQ+F+ DGQF  +FGV GR  GQL  P  VA+  +    +V D  N    + IF   G F  KI    +    G+AV+  GHI+  D+ +  VF+    G+L+          + F   S    P++              +A++  +E  + DF  H V V+  DG F+ +FG+        N P G+ V  +G++++ D   +R  I V+   G  +S     +  +    GL +TS+G++      NH
Sbjct:  485 RVGTRGRERGEFSNLQGISTTSSGRIVVADSNNQCIQVFSNDGQFKLKFGVRGRSPGQLQRPTGVAVDMNGD-IIVADYDNR--WLSIFSPDGKFKNKIGAGRLMGPKGVAVDKNGHIITADNKACCVFIFQSNGKLVTKFGAKGTSERQFADKSAPNTPTEPKQSKSGPAFSPHFVAINNKNEIVVTDFHNHSVKVYNADGEFLFKFGSHGEGNGQFNAPTGVAVDGNGNIIVADWGNSR--IQVFDSSGSFLSYINTTADPLYGPQGLALTSDGHVAVADSGNH 765          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Zebrafish
Match: trim2b (tripartite motif containing 2b [Source:ZFIN;Acc:ZDB-GENE-090312-70])

HSP 1 Score: 95.1301 bits (235), Expect = 2.819e-19
Identity = 80/266 (30.08%), Postives = 130/266 (48.87%), Query Frame = 1
Query: 1765 RWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWF----DCSSCMREPSDIAV-HGDEYFICDFKGHCVCVFKQDGTFVQRFGNETIT----NFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNH 2535
            R G+ G  +GE ++  G        I++AD+ N  +QIF+  G+F S+FGV GR  GQL  P  VA +      ++ D  N+   + IF   G +  K+    +    G++V+  GH++ VD+ + +VF+    G+LI  F    +       P   AV + +E  I DF  H V VF  DG F+ +FG+        N P G+ V  +G++++ D   +R  I V+   G  +S     +  +    GL +TS+G++V     NH
Sbjct:  400 RIGTKGRNKGEFTNLQGVAACSEGRILIADSNNQCVQIFSNTGEFQSRFGVRGRSPGQLQRPTGVA-VHPNGDIIIADYDNK--WVSIFSSEGKYKAKLGSGRLMGPKGVSVDQNGHVIVVDNKACTVFIFQPSGKLITKFGSRGNGDRQFAGPHFAAVNNNNEIIITDFHNHSVKVFNADGEFLLKFGSNGEGNGQFNAPTGVAVDVNGNIIVADWGNSR--IQVFDGSGSFLSYINTAADPLYGPQGLALTSDGHVVVADSGNH 660          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Xenopus
Match: actr6 (ARP6 actin related protein 6 homolog [Source:Xenbase;Acc:XB-GENE-5860964])

HSP 1 Score: 105.531 bits (262), Expect = 2.251e-22
Identity = 82/266 (30.83%), Postives = 134/266 (50.38%), Query Frame = 1
Query: 1765 RWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWF----DCSSCMREPSDIAVHG-DEYFICDFKGHCVCVFKQDGTFVQRFGNETIT----NFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNH 2535
            R G+ G  +GE ++  G     + +I++AD+ N  +QIF+ DGQF S+FG+ GR  GQL  P  VA +  +   ++ D  N+   + IF   G F  KI    +    G++V+  GHI+ VD+ +  VF+    G+++  F    +       P   AV+  +E  + DF  H V VF QDG F+ +FG+        N P G+ V  +G++++ D   +R  I V+   G  +S     +  +    GL +TS+G++V     NH
Sbjct:  424 RVGTKGRNKGEFTNLQGVAASTNGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVA-VHPSGDIIIADYDNK--WVSIFSADGKFKTKIGSGKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDKQFAGPHFAAVNSNNEIIVTDFHNHSVKVFNQDGEFILKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSR--IQVFDGSGSFLSYINTSADPLYGPQGLSLTSDGHVVVADSGNH 684          

HSP 2 Score: 72.7886 bits (177), Expect = 3.420e-12
Identity = 43/123 (34.96%), Postives = 68/123 (55.28%), Query Frame = 1
Query: 1756 VKARWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVA--GLAVNNMGHI 2118
            +  R+GS G+G  + + PH   +  + EI+V D  NH +++F +DG+F+ +FG  G   GQ   P  VA + S    +V D GN  SR+Q+F  SG FL  I+     +    GL++ + GH+
Sbjct:  557 IVTRFGSRGNGDKQFAGPHFAAVNSNNEIIVTDFHNHSVKVFNQDGEFILKFGSNGEGNGQFNAPTGVA-VDSNGNIIVADWGN--SRIQVFDGSGSFLSYINTSADPLYGPQGLSLTSDGHV 676          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Xenopus
Match: actr6 (ARP6 actin related protein 6 homolog [Source:Xenbase;Acc:XB-GENE-5860964])

HSP 1 Score: 105.145 bits (261), Expect = 3.135e-22
Identity = 82/273 (30.04%), Postives = 137/273 (50.18%), Query Frame = 1
Query: 1756 VKARWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWFDC--------SSCMREPSDIAVHG-DEYFICDFKGHCVCVFKQDGTFVQRFGNETIT----NFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNH 2535
            V++  G+ G  +GE ++  G     + +I++AD+ N  +QIF+ DGQF S+FG+ GR  GQL  P  VA +  +   ++ D  N+   + IF   G F  KI    +    G++V+  GHI+ VD+ +  VF+    G+++  F          +  +  P   AV+  +E  + DF  H V VF QDG F+ +FG+        N P G+ V  +G++++ D   +R  I V+   G  +S     +  +    GL +TS+G++V     NH
Sbjct:  484 VRSLTGTKGRNKGEFTNLQGVAASTNGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVA-VHPSGDIIIADYDNK--WVSIFSADGKFKTKIGSGKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDKQFAGTLDGPHFAAVNSNNEIIVTDFHNHSVKVFNQDGEFILKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSR--IQVFDGSGSFLSYINTSADPLYGPQGLSLTSDGHVVVADSGNH 751          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Xenopus
Match: actr6 (ARP6 actin related protein 6 homolog [Source:Xenbase;Acc:XB-GENE-5860964])

HSP 1 Score: 104.76 bits (260), Expect = 3.774e-22
Identity = 82/266 (30.83%), Postives = 134/266 (50.38%), Query Frame = 1
Query: 1765 RWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWF----DCSSCMREPSDIAVHG-DEYFICDFKGHCVCVFKQDGTFVQRFGNETIT----NFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNH 2535
            R G+ G  +GE ++  G     + +I++AD+ N  +QIF+ DGQF S+FG+ GR  GQL  P  VA +  +   ++ D  N+   + IF   G F  KI    +    G++V+  GHI+ VD+ +  VF+    G+++  F    +       P   AV+  +E  + DF  H V VF QDG F+ +FG+        N P G+ V  +G++++ D   +R  I V+   G  +S     +  +    GL +TS+G++V     NH
Sbjct:  376 RVGTKGRNKGEFTNLQGVAASTNGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVA-VHPSGDIIIADYDNK--WVSIFSADGKFKTKIGSGKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDKQFAGPHFAAVNSNNEIIVTDFHNHSVKVFNQDGEFILKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSR--IQVFDGSGSFLSYINTSADPLYGPQGLSLTSDGHVVVADSGNH 636          

HSP 2 Score: 72.0182 bits (175), Expect = 4.779e-12
Identity = 43/123 (34.96%), Postives = 68/123 (55.28%), Query Frame = 1
Query: 1756 VKARWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVA--GLAVNNMGHI 2118
            +  R+GS G+G  + + PH   +  + EI+V D  NH +++F +DG+F+ +FG  G   GQ   P  VA + S    +V D GN  SR+Q+F  SG FL  I+     +    GL++ + GH+
Sbjct:  509 IVTRFGSRGNGDKQFAGPHFAAVNSNNEIIVTDFHNHSVKVFNQDGEFILKFGSNGEGNGQFNAPTGVA-VDSNGNIIVADWGN--SRIQVFDGSGSFLSYINTSADPLYGPQGLSLTSDGHV 628          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Xenopus
Match: actr6 (ARP6 actin related protein 6 homolog [Source:Xenbase;Acc:XB-GENE-5860964])

HSP 1 Score: 104.76 bits (260), Expect = 4.357e-22
Identity = 82/266 (30.83%), Postives = 134/266 (50.38%), Query Frame = 1
Query: 1765 RWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWF----DCSSCMREPSDIAVHG-DEYFICDFKGHCVCVFKQDGTFVQRFGNETIT----NFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNH 2535
            R G+ G  +GE ++  G     + +I++AD+ N  +QIF+ DGQF S+FG+ GR  GQL  P  VA +  +   ++ D  N+   + IF   G F  KI    +    G++V+  GHI+ VD+ +  VF+    G+++  F    +       P   AV+  +E  + DF  H V VF QDG F+ +FG+        N P G+ V  +G++++ D   +R  I V+   G  +S     +  +    GL +TS+G++V     NH
Sbjct:  488 RVGTKGRNKGEFTNLQGVAASTNGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVA-VHPSGDIIIADYDNK--WVSIFSADGKFKTKIGSGKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDKQFAGPHFAAVNSNNEIIVTDFHNHSVKVFNQDGEFILKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSR--IQVFDGSGSFLSYINTSADPLYGPQGLSLTSDGHVVVADSGNH 748          

HSP 2 Score: 72.4034 bits (176), Expect = 4.748e-12
Identity = 43/123 (34.96%), Postives = 68/123 (55.28%), Query Frame = 1
Query: 1756 VKARWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVA--GLAVNNMGHI 2118
            +  R+GS G+G  + + PH   +  + EI+V D  NH +++F +DG+F+ +FG  G   GQ   P  VA + S    +V D GN  SR+Q+F  SG FL  I+     +    GL++ + GH+
Sbjct:  621 IVTRFGSRGNGDKQFAGPHFAAVNSNNEIIVTDFHNHSVKVFNQDGEFILKFGSNGEGNGQFNAPTGVA-VDSNGNIIVADWGN--SRIQVFDGSGSFLSYINTSADPLYGPQGLSLTSDGHV 740          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Xenopus
Match: surf4.1 (surfeit 4, gene 1 [Source:Xenbase;Acc:XB-GENE-5807555])

HSP 1 Score: 95.1301 bits (235), Expect = 2.500e-19
Identity = 75/228 (32.89%), Postives = 113/228 (49.56%), Query Frame = 1
Query: 1765 RWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWFDCS--------SCMREPSDIAVHG-DEYFICDFKGHCVCVFKQDGTFVQRFGNETIT----NFPNGIDVSDHGDVLIGDSHGNRFHI 2409
            R GS G  +GE S+  G     +  IVVAD+ N  IQ+FT DGQF  +FGV GR  GQL  P  VA+  +    +V D  N    + IF   G F  KI +  +    G+AV+  GH++ VD+ S  +F+    G+L+  F             +  P  +AV+  +E  + DF  H V V+  DG F+ +FG+        N P G+ V  +G++++ D   +R  +
Sbjct:  288 RVGSRGRDKGEFSNLQGISASCNNRIVVADSNNQCIQVFTNDGQFKLRFGVRGRSPGQLQRPTGVAVDMNGD-IIVADYDNR--WVSIFSPEGKFKNKIGVGRLMGPKGVAVDRNGHLIVVDNKSCCIFIFQSNGKLVGRFGARGPGDKQQPGALDGPHFVAVNNKNEIVVTDFHNHSVKVYSADGEFLYKFGSHGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQV 512          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Mouse
Match: Trim2 (tripartite motif-containing 2 [Source:MGI Symbol;Acc:MGI:1933163])

HSP 1 Score: 111.694 bits (278), Expect = 2.621e-24
Identity = 83/266 (31.20%), Postives = 134/266 (50.38%), Query Frame = 1
Query: 1765 RWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWF----DCSSCMREPSDIAVHG-DEYFICDFKGHCVCVFKQDGTFVQRFGNETIT----NFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNH 2535
            R G+ G  +GE ++  G     S +I++AD+ N  +QIF+ DGQF S+FG+ GR  GQL  P  VA +  +   ++ D  N+   + IF   G F  KI    +    G++V+  GHI+ VD+ +  VF+    G+++  F    +       P   AV+  +E  I DF  H V VF Q+G F+ +FG+        N P G+ V  +G++++ D   +R  I V+   G  +S     +  +    GL +TS+G++V     NH
Sbjct:  475 RVGTKGRNKGEFTNLQGVAASTSGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVA-VHPSGDIIIADYDNK--WVSIFSNDGKFKTKIGSGKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPHFAAVNSNNEIIITDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSR--IQVFDGSGSFLSYINTSADPLYGPQGLALTSDGHVVVADSGNH 735          

HSP 2 Score: 75.485 bits (184), Expect = 4.071e-13
Identity = 42/123 (34.15%), Postives = 68/123 (55.28%), Query Frame = 1
Query: 1756 VKARWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVA--GLAVNNMGHI 2118
            +  R+GS G+G  + + PH   +  + EI++ D  NH +++F ++G+F+ +FG  G   GQ   P  VA + S    +V D GN  SR+Q+F  SG FL  I+     +    GLA+ + GH+
Sbjct:  608 IVTRFGSRGNGDRQFAGPHFAAVNSNNEIIITDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVA-VDSNGNIIVADWGN--SRIQVFDGSGSFLSYINTSADPLYGPQGLALTSDGHV 727          

HSP 3 Score: 53.9138 bits (128), Expect = 1.424e-6
Identity = 75/365 (20.55%), Postives = 138/365 (37.81%), Query Frame = 1
Query:  163 ICSQCKNSFSEPVVLNCLHIFDRGCLSKFECTDSIFPVVTCPKCHMQSGSLSSLKPYITQYAIESKEINVSTIDFNDFKCVLCTSGEDSKYKCVDCAGLLCERCKILHKEVKFLNSHLEVEELTDEDKTNIKLLKKHLADNKPVKCEVHCERKYTNYCIQCGMLACSRCLLSDHADHSTVLLQDFPEKIRFRIGNYIENCIKAEEMNKIAIEKLNNALMEVNNSHDENKTHIEEVCNEWKTAIDDIKTEYLKKNKELHDDLEFRIMN-GINRGEKY-------------LEHIEYALEFTKSYLDKCSNVEFCKIIKVVLNCLTDLSEK----------QIDTDVRTSIPFKENVSSITNVIRTN 1185
            ICS C   +  P VL CLH F   CL  +    S+   ++CP C       +S+ P     A+++     + +D    +    ++GEDS                              +E +T             +A  KP+ C  H       YC  C    C  C   +HA+H TV L+D  E+ +  +              ++ ++ +N  L E++++       I ++ N+  + +DDI + + +  K L+      +M   +N G K+              E I+    FT   L+  +  E   + K +   L +L+++          Q+D  V T    K+++ ++  ++ TN
Sbjct:   22 ICSICLERYKNPKVLPCLHTFCERCLQNYIPAHSL--TLSCPVCRQ-----TSILPEKGVAALQNNFFITNLMDV--LQRTPGSNGEDSSI----------------------------LETVT------------AVAAGKPLSCPNHDGNVMEFYCQSCETAMCRECTEGEHAEHPTVPLKDVVEQHKASL--------------QVQLDAVNKRLPEIDSALQFISEIIHQLTNQKASIVDDIHSTFDELQKTLNVRKSVLLMELEVNYGLKHKVLQSQLDTLLQGQESIKSCSNFTAQALNHGTETEVLLVKKQMSEKLNELADQDFPLHPRENDQLDFIVETE-GLKKSIHNLGTILTTN 322          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Mouse
Match: Trim2 (tripartite motif-containing 2 [Source:MGI Symbol;Acc:MGI:1933163])

HSP 1 Score: 111.694 bits (278), Expect = 2.621e-24
Identity = 83/266 (31.20%), Postives = 134/266 (50.38%), Query Frame = 1
Query: 1765 RWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWF----DCSSCMREPSDIAVHG-DEYFICDFKGHCVCVFKQDGTFVQRFGNETIT----NFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNH 2535
            R G+ G  +GE ++  G     S +I++AD+ N  +QIF+ DGQF S+FG+ GR  GQL  P  VA +  +   ++ D  N+   + IF   G F  KI    +    G++V+  GHI+ VD+ +  VF+    G+++  F    +       P   AV+  +E  I DF  H V VF Q+G F+ +FG+        N P G+ V  +G++++ D   +R  I V+   G  +S     +  +    GL +TS+G++V     NH
Sbjct:  475 RVGTKGRNKGEFTNLQGVAASTSGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVA-VHPSGDIIIADYDNK--WVSIFSNDGKFKTKIGSGKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPHFAAVNSNNEIIITDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSR--IQVFDGSGSFLSYINTSADPLYGPQGLALTSDGHVVVADSGNH 735          

HSP 2 Score: 75.485 bits (184), Expect = 4.071e-13
Identity = 42/123 (34.15%), Postives = 68/123 (55.28%), Query Frame = 1
Query: 1756 VKARWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVA--GLAVNNMGHI 2118
            +  R+GS G+G  + + PH   +  + EI++ D  NH +++F ++G+F+ +FG  G   GQ   P  VA + S    +V D GN  SR+Q+F  SG FL  I+     +    GLA+ + GH+
Sbjct:  608 IVTRFGSRGNGDRQFAGPHFAAVNSNNEIIITDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVA-VDSNGNIIVADWGN--SRIQVFDGSGSFLSYINTSADPLYGPQGLALTSDGHV 727          

HSP 3 Score: 53.9138 bits (128), Expect = 1.424e-6
Identity = 75/365 (20.55%), Postives = 138/365 (37.81%), Query Frame = 1
Query:  163 ICSQCKNSFSEPVVLNCLHIFDRGCLSKFECTDSIFPVVTCPKCHMQSGSLSSLKPYITQYAIESKEINVSTIDFNDFKCVLCTSGEDSKYKCVDCAGLLCERCKILHKEVKFLNSHLEVEELTDEDKTNIKLLKKHLADNKPVKCEVHCERKYTNYCIQCGMLACSRCLLSDHADHSTVLLQDFPEKIRFRIGNYIENCIKAEEMNKIAIEKLNNALMEVNNSHDENKTHIEEVCNEWKTAIDDIKTEYLKKNKELHDDLEFRIMN-GINRGEKY-------------LEHIEYALEFTKSYLDKCSNVEFCKIIKVVLNCLTDLSEK----------QIDTDVRTSIPFKENVSSITNVIRTN 1185
            ICS C   +  P VL CLH F   CL  +    S+   ++CP C       +S+ P     A+++     + +D    +    ++GEDS                              +E +T             +A  KP+ C  H       YC  C    C  C   +HA+H TV L+D  E+ +  +              ++ ++ +N  L E++++       I ++ N+  + +DDI + + +  K L+      +M   +N G K+              E I+    FT   L+  +  E   + K +   L +L+++          Q+D  V T    K+++ ++  ++ TN
Sbjct:   22 ICSICLERYKNPKVLPCLHTFCERCLQNYIPAHSL--TLSCPVCRQ-----TSILPEKGVAALQNNFFITNLMDV--LQRTPGSNGEDSSI----------------------------LETVT------------AVAAGKPLSCPNHDGNVMEFYCQSCETAMCRECTEGEHAEHPTVPLKDVVEQHKASL--------------QVQLDAVNKRLPEIDSALQFISEIIHQLTNQKASIVDDIHSTFDELQKTLNVRKSVLLMELEVNYGLKHKVLQSQLDTLLQGQESIKSCSNFTAQALNHGTETEVLLVKKQMSEKLNELADQDFPLHPRENDQLDFIVETE-GLKKSIHNLGTILTTN 322          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Mouse
Match: Trim2 (tripartite motif-containing 2 [Source:MGI Symbol;Acc:MGI:1933163])

HSP 1 Score: 111.694 bits (278), Expect = 2.621e-24
Identity = 83/266 (31.20%), Postives = 134/266 (50.38%), Query Frame = 1
Query: 1765 RWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWF----DCSSCMREPSDIAVHG-DEYFICDFKGHCVCVFKQDGTFVQRFGNETIT----NFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNH 2535
            R G+ G  +GE ++  G     S +I++AD+ N  +QIF+ DGQF S+FG+ GR  GQL  P  VA +  +   ++ D  N+   + IF   G F  KI    +    G++V+  GHI+ VD+ +  VF+    G+++  F    +       P   AV+  +E  I DF  H V VF Q+G F+ +FG+        N P G+ V  +G++++ D   +R  I V+   G  +S     +  +    GL +TS+G++V     NH
Sbjct:  475 RVGTKGRNKGEFTNLQGVAASTSGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVA-VHPSGDIIIADYDNK--WVSIFSNDGKFKTKIGSGKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPHFAAVNSNNEIIITDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSR--IQVFDGSGSFLSYINTSADPLYGPQGLALTSDGHVVVADSGNH 735          

HSP 2 Score: 75.485 bits (184), Expect = 4.071e-13
Identity = 42/123 (34.15%), Postives = 68/123 (55.28%), Query Frame = 1
Query: 1756 VKARWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVA--GLAVNNMGHI 2118
            +  R+GS G+G  + + PH   +  + EI++ D  NH +++F ++G+F+ +FG  G   GQ   P  VA + S    +V D GN  SR+Q+F  SG FL  I+     +    GLA+ + GH+
Sbjct:  608 IVTRFGSRGNGDRQFAGPHFAAVNSNNEIIITDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVA-VDSNGNIIVADWGN--SRIQVFDGSGSFLSYINTSADPLYGPQGLALTSDGHV 727          

HSP 3 Score: 53.9138 bits (128), Expect = 1.424e-6
Identity = 75/365 (20.55%), Postives = 138/365 (37.81%), Query Frame = 1
Query:  163 ICSQCKNSFSEPVVLNCLHIFDRGCLSKFECTDSIFPVVTCPKCHMQSGSLSSLKPYITQYAIESKEINVSTIDFNDFKCVLCTSGEDSKYKCVDCAGLLCERCKILHKEVKFLNSHLEVEELTDEDKTNIKLLKKHLADNKPVKCEVHCERKYTNYCIQCGMLACSRCLLSDHADHSTVLLQDFPEKIRFRIGNYIENCIKAEEMNKIAIEKLNNALMEVNNSHDENKTHIEEVCNEWKTAIDDIKTEYLKKNKELHDDLEFRIMN-GINRGEKY-------------LEHIEYALEFTKSYLDKCSNVEFCKIIKVVLNCLTDLSEK----------QIDTDVRTSIPFKENVSSITNVIRTN 1185
            ICS C   +  P VL CLH F   CL  +    S+   ++CP C       +S+ P     A+++     + +D    +    ++GEDS                              +E +T             +A  KP+ C  H       YC  C    C  C   +HA+H TV L+D  E+ +  +              ++ ++ +N  L E++++       I ++ N+  + +DDI + + +  K L+      +M   +N G K+              E I+    FT   L+  +  E   + K +   L +L+++          Q+D  V T    K+++ ++  ++ TN
Sbjct:   22 ICSICLERYKNPKVLPCLHTFCERCLQNYIPAHSL--TLSCPVCRQ-----TSILPEKGVAALQNNFFITNLMDV--LQRTPGSNGEDSSI----------------------------LETVT------------AVAAGKPLSCPNHDGNVMEFYCQSCETAMCRECTEGEHAEHPTVPLKDVVEQHKASL--------------QVQLDAVNKRLPEIDSALQFISEIIHQLTNQKASIVDDIHSTFDELQKTLNVRKSVLLMELEVNYGLKHKVLQSQLDTLLQGQESIKSCSNFTAQALNHGTETEVLLVKKQMSEKLNELADQDFPLHPRENDQLDFIVETE-GLKKSIHNLGTILTTN 322          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Mouse
Match: Trim2 (tripartite motif-containing 2 [Source:MGI Symbol;Acc:MGI:1933163])

HSP 1 Score: 111.694 bits (278), Expect = 2.621e-24
Identity = 83/266 (31.20%), Postives = 134/266 (50.38%), Query Frame = 1
Query: 1765 RWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWF----DCSSCMREPSDIAVHG-DEYFICDFKGHCVCVFKQDGTFVQRFGNETIT----NFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNH 2535
            R G+ G  +GE ++  G     S +I++AD+ N  +QIF+ DGQF S+FG+ GR  GQL  P  VA +  +   ++ D  N+   + IF   G F  KI    +    G++V+  GHI+ VD+ +  VF+    G+++  F    +       P   AV+  +E  I DF  H V VF Q+G F+ +FG+        N P G+ V  +G++++ D   +R  I V+   G  +S     +  +    GL +TS+G++V     NH
Sbjct:  475 RVGTKGRNKGEFTNLQGVAASTSGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVA-VHPSGDIIIADYDNK--WVSIFSNDGKFKTKIGSGKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPHFAAVNSNNEIIITDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSR--IQVFDGSGSFLSYINTSADPLYGPQGLALTSDGHVVVADSGNH 735          

HSP 2 Score: 75.485 bits (184), Expect = 4.071e-13
Identity = 42/123 (34.15%), Postives = 68/123 (55.28%), Query Frame = 1
Query: 1756 VKARWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVA--GLAVNNMGHI 2118
            +  R+GS G+G  + + PH   +  + EI++ D  NH +++F ++G+F+ +FG  G   GQ   P  VA + S    +V D GN  SR+Q+F  SG FL  I+     +    GLA+ + GH+
Sbjct:  608 IVTRFGSRGNGDRQFAGPHFAAVNSNNEIIITDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVA-VDSNGNIIVADWGN--SRIQVFDGSGSFLSYINTSADPLYGPQGLALTSDGHV 727          

HSP 3 Score: 53.9138 bits (128), Expect = 1.424e-6
Identity = 75/365 (20.55%), Postives = 138/365 (37.81%), Query Frame = 1
Query:  163 ICSQCKNSFSEPVVLNCLHIFDRGCLSKFECTDSIFPVVTCPKCHMQSGSLSSLKPYITQYAIESKEINVSTIDFNDFKCVLCTSGEDSKYKCVDCAGLLCERCKILHKEVKFLNSHLEVEELTDEDKTNIKLLKKHLADNKPVKCEVHCERKYTNYCIQCGMLACSRCLLSDHADHSTVLLQDFPEKIRFRIGNYIENCIKAEEMNKIAIEKLNNALMEVNNSHDENKTHIEEVCNEWKTAIDDIKTEYLKKNKELHDDLEFRIMN-GINRGEKY-------------LEHIEYALEFTKSYLDKCSNVEFCKIIKVVLNCLTDLSEK----------QIDTDVRTSIPFKENVSSITNVIRTN 1185
            ICS C   +  P VL CLH F   CL  +    S+   ++CP C       +S+ P     A+++     + +D    +    ++GEDS                              +E +T             +A  KP+ C  H       YC  C    C  C   +HA+H TV L+D  E+ +  +              ++ ++ +N  L E++++       I ++ N+  + +DDI + + +  K L+      +M   +N G K+              E I+    FT   L+  +  E   + K +   L +L+++          Q+D  V T    K+++ ++  ++ TN
Sbjct:   22 ICSICLERYKNPKVLPCLHTFCERCLQNYIPAHSL--TLSCPVCRQ-----TSILPEKGVAALQNNFFITNLMDV--LQRTPGSNGEDSSI----------------------------LETVT------------AVAAGKPLSCPNHDGNVMEFYCQSCETAMCRECTEGEHAEHPTVPLKDVVEQHKASL--------------QVQLDAVNKRLPEIDSALQFISEIIHQLTNQKASIVDDIHSTFDELQKTLNVRKSVLLMELEVNYGLKHKVLQSQLDTLLQGQESIKSCSNFTAQALNHGTETEVLLVKKQMSEKLNELADQDFPLHPRENDQLDFIVETE-GLKKSIHNLGTILTTN 322          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Mouse
Match: Trim2 (tripartite motif-containing 2 [Source:MGI Symbol;Acc:MGI:1933163])

HSP 1 Score: 111.309 bits (277), Expect = 3.642e-24
Identity = 83/266 (31.20%), Postives = 134/266 (50.38%), Query Frame = 1
Query: 1765 RWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWF----DCSSCMREPSDIAVHG-DEYFICDFKGHCVCVFKQDGTFVQRFGNETIT----NFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNH 2535
            R G+ G  +GE ++  G     S +I++AD+ N  +QIF+ DGQF S+FG+ GR  GQL  P  VA +  +   ++ D  N+   + IF   G F  KI    +    G++V+  GHI+ VD+ +  VF+    G+++  F    +       P   AV+  +E  I DF  H V VF Q+G F+ +FG+        N P G+ V  +G++++ D   +R  I V+   G  +S     +  +    GL +TS+G++V     NH
Sbjct:  501 RVGTKGRNKGEFTNLQGVAASTSGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVA-VHPSGDIIIADYDNK--WVSIFSNDGKFKTKIGSGKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPHFAAVNSNNEIIITDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSR--IQVFDGSGSFLSYINTSADPLYGPQGLALTSDGHVVVADSGNH 761          

HSP 2 Score: 75.0998 bits (183), Expect = 5.818e-13
Identity = 42/123 (34.15%), Postives = 68/123 (55.28%), Query Frame = 1
Query: 1756 VKARWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVA--GLAVNNMGHI 2118
            +  R+GS G+G  + + PH   +  + EI++ D  NH +++F ++G+F+ +FG  G   GQ   P  VA + S    +V D GN  SR+Q+F  SG FL  I+     +    GLA+ + GH+
Sbjct:  634 IVTRFGSRGNGDRQFAGPHFAAVNSNNEIIITDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVA-VDSNGNIIVADWGN--SRIQVFDGSGSFLSYINTSADPLYGPQGLALTSDGHV 753          

HSP 3 Score: 54.6842 bits (130), Expect = 9.434e-7
Identity = 75/365 (20.55%), Postives = 138/365 (37.81%), Query Frame = 1
Query:  163 ICSQCKNSFSEPVVLNCLHIFDRGCLSKFECTDSIFPVVTCPKCHMQSGSLSSLKPYITQYAIESKEINVSTIDFNDFKCVLCTSGEDSKYKCVDCAGLLCERCKILHKEVKFLNSHLEVEELTDEDKTNIKLLKKHLADNKPVKCEVHCERKYTNYCIQCGMLACSRCLLSDHADHSTVLLQDFPEKIRFRIGNYIENCIKAEEMNKIAIEKLNNALMEVNNSHDENKTHIEEVCNEWKTAIDDIKTEYLKKNKELHDDLEFRIMN-GINRGEKY-------------LEHIEYALEFTKSYLDKCSNVEFCKIIKVVLNCLTDLSEK----------QIDTDVRTSIPFKENVSSITNVIRTN 1185
            ICS C   +  P VL CLH F   CL  +    S+   ++CP C       +S+ P     A+++     + +D    +    ++GEDS                              +E +T             +A  KP+ C  H       YC  C    C  C   +HA+H TV L+D  E+ +  +              ++ ++ +N  L E++++       I ++ N+  + +DDI + + +  K L+      +M   +N G K+              E I+    FT   L+  +  E   + K +   L +L+++          Q+D  V T    K+++ ++  ++ TN
Sbjct:   48 ICSICLERYKNPKVLPCLHTFCERCLQNYIPAHSL--TLSCPVCRQ-----TSILPEKGVAALQNNFFITNLMDV--LQRTPGSNGEDSSI----------------------------LETVT------------AVAAGKPLSCPNHDGNVMEFYCQSCETAMCRECTEGEHAEHPTVPLKDVVEQHKASL--------------QVQLDAVNKRLPEIDSALQFISEIIHQLTNQKASIVDDIHSTFDELQKTLNVRKSVLLMELEVNYGLKHKVLQSQLDTLLQGQESIKSCSNFTAQALNHGTETEVLLVKKQMSEKLNELADQDFPLHPRENDQLDFIVETE-GLKKSIHNLGTILTTN 348          
BLAST of B-box type zinc finger protein ncl-1 vs. UniProt/SwissProt
Match: sp|Q8MQJ9|BRAT_DROME (Brain tumor protein OS=Drosophila melanogaster OX=7227 GN=brat PE=1 SV=2)

HSP 1 Score: 161.384 bits (407), Expect = 1.240e-38
Identity = 86/261 (32.95%), Postives = 153/261 (58.62%), Query Frame = 1
Query: 1750 MTVKARWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWFDCSSCMREPSDIAVH-GDEYFICDFKGHCVCVFKQDGTFVQRFGNETITNFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKN 2529
            M    ++G  G   G+ + P G  +    +I+VADT NHRIQIF K+G+F  QFG  G+ + QL +P +VA++R++   +V +R +   ++QI+ + G F+RK     +    G+ V+N G I+ V+     V +  + G ++  F CS  +  P+ + V+   E FI D + HCV VF  +G ++++ G E ITN+P G+ ++ +G++LI D+H N F++ +++ DG+L+S  E   VK ++   + +  +G +V  +K+
Sbjct:  764 MIYHCKFGEFGVMEGQFTEPSGVAVNAQNDIIVADTNNHRIQIFDKEGRFKFQFGECGKRDSQLLYPNRVAVVRNSGDIIVTER-SPTHQIQIYNQYGQFVRKFGATILQHPRGVTVDNKGRIIVVECKVMRVIIFDQNGNVLHKFGCSKHLEFPNGVVVNDKQEIFISDNRAHCVKVFNYEGQYLRQIGGEGITNYPIGVGINSNGEILIADNH-NNFNLTIFTQDGQLISALES-KVKHAQCFDVALMDDGSVVLASKD 1021          
BLAST of B-box type zinc finger protein ncl-1 vs. UniProt/SwissProt
Match: sp|P34611|NCL1_CAEEL (B-box type zinc finger protein ncl-1 OS=Caenorhabditis elegans OX=6239 GN=ncl-1 PE=2 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 2.683e-36
Identity = 83/261 (31.80%), Postives = 150/261 (57.47%), Query Frame = 1
Query: 1750 MTVKARWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWFDCSSCMREPSDIAVH-GDEYFICDFKGHCVCVFKQDGTFVQRFGNETITNFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKN 2529
            M    ++G  G   G+ + P G  +    +IVVADT NHRIQ+F K+G+F  QFG  G+ +GQL +P +VA+ R+T  +VV +R +   ++Q++ + G FLRK     +    G+ V++ G I+ V+     V +    G +++ F CS  +  P+ +  +  +E  I D + HC+ VF  +G ++++ G E +TN+P G+ ++  G+V++ D+H N F++ V+S DG ++   E   VK ++   + +  +G +V  +K+
Sbjct:  570 MIYHCKFGEFGVMEGQFTEPSGVAVNGQGDIVVADTNNHRIQVFDKEGRFKFQFGECGKRDGQLLYPNRVAVNRTTGDFVVTER-SPTHQIQVYNQYGQFLRKFGANILQHPRGVCVDSKGRIIVVECKVMRVIIFDMFGNILQKFSCSRYLEFPNGVCTNDKNEILISDNRAHCIKVFSYEGQYLRQIGGEGVTNYPIGVGINSLGEVVVADNH-NNFNLTVFSQDGTMIGALES-RVKHAQCFDVALVDDGSVVLASKD 827          
BLAST of B-box type zinc finger protein ncl-1 vs. UniProt/SwissProt
Match: sp|D3ZQG6|TRIM2_RAT (Tripartite motif-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Trim2 PE=1 SV=2)

HSP 1 Score: 104.375 bits (259), Expect = 3.143e-21
Identity = 83/266 (31.20%), Postives = 134/266 (50.38%), Query Frame = 1
Query: 1765 RWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWF----DCSSCMREPSDIAVH-GDEYFICDFKGHCVCVFKQDGTFVQRFGNETIT----NFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNH 2535
            R G+ G  +GE ++  G     S +I++AD+ N  +QIF+ DGQF S+FG+ GR  GQL  P  VA +  +   ++ D  N+   + IF   G F  KI    +    G++V+  GHI+ VD+ +  VF+    G+++  F    +       P   AV+  +E  I DF  H V VF Q+G F+ +FG+        N P G+ V  +G++++ D   +R  I V+   G  +S     +  +    GL +TS+G++V     NH
Sbjct:  475 RVGTKGRNKGEFTNLQGVAASTSGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVA-VHPSGDIIIADYDNK--WVSIFSNDGKFKTKIGSGKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPHFAAVNSSNEIIITDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSR--IQVFDGSGSFLSYINTSADPLYGPQGLALTSDGHVVVADSGNH 735          

HSP 2 Score: 72.4034 bits (176), Expect = 2.188e-11
Identity = 43/123 (34.96%), Postives = 68/123 (55.28%), Query Frame = 1
Query: 1756 VKARWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVA--GLAVNNMGHI 2118
            +  R+GS G+G  + + PH   +  S EI++ D  NH +++F ++G+F+ +FG  G   GQ   P  VA + S    +V D GN  SR+Q+F  SG FL  I+     +    GLA+ + GH+
Sbjct:  608 IVTRFGSRGNGDRQFAGPHFAAVNSSNEIIITDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVA-VDSNGNIIVADWGN--SRIQVFDGSGSFLSYINTSADPLYGPQGLALTSDGHV 727          
BLAST of B-box type zinc finger protein ncl-1 vs. UniProt/SwissProt
Match: sp|Q9ESN6|TRIM2_MOUSE (Tripartite motif-containing protein 2 OS=Mus musculus OX=10090 GN=Trim2 PE=1 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 3.426e-21
Identity = 83/266 (31.20%), Postives = 134/266 (50.38%), Query Frame = 1
Query: 1765 RWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWF----DCSSCMREPSDIAVHG-DEYFICDFKGHCVCVFKQDGTFVQRFGNETIT----NFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNH 2535
            R G+ G  +GE ++  G     S +I++AD+ N  +QIF+ DGQF S+FG+ GR  GQL  P  VA +  +   ++ D  N+   + IF   G F  KI    +    G++V+  GHI+ VD+ +  VF+    G+++  F    +       P   AV+  +E  I DF  H V VF Q+G F+ +FG+        N P G+ V  +G++++ D   +R  I V+   G  +S     +  +    GL +TS+G++V     NH
Sbjct:  475 RVGTKGRNKGEFTNLQGVAASTSGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVA-VHPSGDIIIADYDNK--WVSIFSNDGKFKTKIGSGKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPHFAAVNSNNEIIITDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSR--IQVFDGSGSFLSYINTSADPLYGPQGLALTSDGHVVVADSGNH 735          

HSP 2 Score: 71.2478 bits (173), Expect = 5.685e-11
Identity = 42/123 (34.15%), Postives = 68/123 (55.28%), Query Frame = 1
Query: 1756 VKARWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVA--GLAVNNMGHI 2118
            +  R+GS G+G  + + PH   +  + EI++ D  NH +++F ++G+F+ +FG  G   GQ   P  VA + S    +V D GN  SR+Q+F  SG FL  I+     +    GLA+ + GH+
Sbjct:  608 IVTRFGSRGNGDRQFAGPHFAAVNSNNEIIITDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVA-VDSNGNIIVADWGN--SRIQVFDGSGSFLSYINTSADPLYGPQGLALTSDGHV 727          
BLAST of B-box type zinc finger protein ncl-1 vs. UniProt/SwissProt
Match: sp|F7H9X2|TRIM2_CALJA (Tripartite motif-containing protein 2 OS=Callithrix jacchus OX=9483 GN=TRIM2 PE=3 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 3.798e-21
Identity = 83/266 (31.20%), Postives = 134/266 (50.38%), Query Frame = 1
Query: 1765 RWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWF----DCSSCMREPSDIAVHG-DEYFICDFKGHCVCVFKQDGTFVQRFGNETIT----NFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNH 2535
            R G+ G  +GE ++  G     S +I++AD+ N  +QIF+ DGQF S+FG+ GR  GQL  P  VA +  +   ++ D  N+   + IF   G F  KI    +    G++V+  GHI+ VD+ +  VF+    G+++  F    +       P   AV+  +E  I DF  H V VF Q+G F+ +FG+        N P G+ V  +G++++ D   +R  I V+   G  +S     +  +    GL +TS+G++V     NH
Sbjct:  475 RVGTKGRNKGEFTNLQGVAASTSGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVA-VHPSGDIIIADYDNK--WVSIFSSDGKFKTKIGSGKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPHFAAVNSNNEIIITDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSR--IQVFDGSGSFLSYINTSADPLYGPQGLALTSDGHVVVADSGNH 735          

HSP 2 Score: 71.2478 bits (173), Expect = 5.734e-11
Identity = 42/123 (34.15%), Postives = 68/123 (55.28%), Query Frame = 1
Query: 1756 VKARWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVA--GLAVNNMGHI 2118
            +  R+GS G+G  + + PH   +  + EI++ D  NH +++F ++G+F+ +FG  G   GQ   P  VA + S    +V D GN  SR+Q+F  SG FL  I+     +    GLA+ + GH+
Sbjct:  608 IVTRFGSRGNGDRQFAGPHFAAVNSNNEIIITDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVA-VDSNGNIIVADWGN--SRIQVFDGSGSFLSYINTSADPLYGPQGLALTSDGHV 727          
BLAST of B-box type zinc finger protein ncl-1 vs. TrEMBL
Match: A0A3P7M2I1 (Uncharacterized protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS8362 PE=4 SV=1)

HSP 1 Score: 690.649 bits (1781), Expect = 0.000e+0
Identity = 380/843 (45.08%), Postives = 527/843 (62.51%), Query Frame = 1
Query:  106 FTLEYAEGGSLENKQELPTICSQCKNSFSEPVVLNCLHIFDRGCLSKFECTDSIFPVVTCPKCHMQSGSLSSLKPYITQYAIESKEINVSTIDFNDFKCVLCTSGEDSKYKCVDCAGLLCERCKILHKEVKFLNSHLEVEELTDEDKTNIKLLKKHLADNKPVKCEVHCERKYTNYCIQC--------GMLACSRCLLSDHADHSTVLLQDFPEKIRFRIGNYIENCIKAEEMNKIAIEKLNNALMEVNNSHDENKTHIEEVCNEWKTAIDDIKTEYLKKNKELHDDLEFRIMNGINRGEKYLEHIEYALEFTKSYLDKCSNVEFCKIIKVVLNCLTDLSEKQIDTDVRTSIPFKENVSSITNVIRTNFGVF-----------LNNEKANDKSSSVSSMIEFSG-DLNNCFNSLTINDIAAHDHFKQQSILQT--TDQYKPPNLIIQSNNACSISNGNLNFDVNPISPTNAYPXXXXXXXXXXXXXXXXXXXXXXFPYQGQFENRAQFDDNGVPIMPLMPNTTQTSPVPTFPPIDTFNGSSSNGYMRPGSTGYXXXXXXXXXXXXXQCAAMTVKARWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWFDCSSCMREPSDIAVHGDEYFICDFKGHCVCVFKQDGTFVQRFGNETITNFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNHHVLVMDTLYIS 2568
            F+ + ++  +LE    LPT C  C+N+   PV+LNCLHIFDR CL  +E  D +   + CP+C   SG L SL+P+     +E KE + +       KC  CT G +++Y+C+ CAG LC+RC+ +HK +K  + H EV +LT+ +K NIK L K + + KPV C  H    Y+ +C+QC         +  C  C  +DH  H  + L   P+ +   +   +  C + ++  +   + L++AL +++ S D NK HIEE+CN WK A+D +K E+L+KN+ELHDDLE R+ + IN+  K ++HI++  EF  SYL KCS ++  +++KVVL C+  L       D+ + I F E  SSI +VI  NFG F            ++   +D +  +  +  F G DL+  F +L +    +HDHF  Q  L    +D +         N A +    + N D + I P  A P+  +S      +      D     +  Q      F + G+ + P+  +  + SP    P +D    S  +    P S  YN +       R  +CA+M++ A+WGSLG   G ++SPHGFCLGF EEIVVADT NHRIQIF+K G F+S FGV+GR +G LW+PRKVAIIR +QRYVVCDRGNERSRMQ+F RSGHF+R+I I+YIDIVAGLA+N  GHIVA+DSVSPS FV+SE GELI+WFDCS+ M+EPSD+A+HG EY+ICDFK HCV VF++DGT+++R G ETIT+FPNGIDVSDHGDVL+GDSHGNRFHIAV++  G L+SEF C   KVSR+C LKIT+EGY+VTLA+++++VLV+DTLYIS
Sbjct:   16 FSGDLSKDEALEGSPGLPTTCGVCQNTLKNPVILNCLHIFDRDCLINYENNDGLADYIKCPRCEKTSGGLKSLEPFNIS-VLEKKEDSDTNESETVIKCSTCTEGREAQYRCIHCAGTLCDRCRDIHKVMKLFSFH-EVLDLTESEKKNIKELTKTMQNAKPVPCTEHAGDVYSLFCMQCHVSNSKTSQVPMCRGCYETDHKGHVKLSLTAVPKHLESLLSEGMRECHEKQDTFREVTDSLHSALSDLSASRDHNKNHIEELCNTWKAAVDAVKEEFLQKNRELHDDLEMRVWSRINQIRKTVDHIDFVSEFCSSYLQKCSTLQMSRLVKVVLGCIEQLKSTNFRPDIPSKILFNEPQSSINSVIYNNFGSFDLPTTEAAHLLSDSSPVSDHAGRLLRLNTFPGEDLSETFKNLAVKTSHSHDHFASQHQLPVGLSDTH------TGQNRAITTGLMSENGDTSAIVPHRAGPISLASNVSAWGDLPMGTFDQAFNSHVTQMN--PVFLNQGLTVGPVSQDGLR-SPSICPPGMDLDPNSLLSRSKLPVS--YNASLYEYSRIRSARCASMSLLAKWGSLGCELGRLNSPHGFCLGFDEEIVVADTYNHRIQIFSKLGDFISFFGVSGRVDGLLWYPRKVAIIRQSQRYVVCDRGNERSRMQLFSRSGHFVRRIQIKYIDIVAGLAINQHGHIVAIDSVSPSAFVLSEEGELIRWFDCSNYMKEPSDVAIHGREYYICDFKAHCVIVFQEDGTYIRRIGGETITDFPNGIDVSDHGDVLVGDSHGNRFHIAVFNRTGDLLSEFVCNQTKVSRSCCLKITTEGYVVTLARSSNNVLVLDTLYIS 845          
BLAST of B-box type zinc finger protein ncl-1 vs. TrEMBL
Match: A0A183SGJ7 (B-box type zinc finger protein ncl-1 OS=Schistocephalus solidus OX=70667 PE=4 SV=1)

HSP 1 Score: 676.781 bits (1745), Expect = 0.000e+0
Identity = 377/842 (44.77%), Postives = 526/842 (62.47%), Query Frame = 1
Query:  106 FTLEYAEGGSLENKQELPTICSQCKNSFSEPVVLNCLHIFDRGCLSKFECTDSIFPVVTCPKCHMQSGSLSSLKPYITQYAIESKEINVSTIDFNDFKCVLCTSGEDSKYKCVDCAGLLCERCKILHKEVKFLNSHLEVEELTDEDKTNIKLLKKHLADNKPVKCEVHCERKYTNYCIQCGMLACSRCLLSDHADHSTVLLQDFPEKIRFRIGNYIENCIKAEEMNKIAIEKLNNALMEVNNSHDENKTHIEEVCNEWKTAIDDIKT-----EYLKKNKELHDDLEFRIMNGINRGEKYLEHIEYALEFTKSYLDKCSNVEFCKIIKVVLNCLTDLSEKQIDTDVRTSIPFKENVSSITNVIRTNFGVF-----------LNNEKANDKSSSVSSMIEF-SGDLNNCFNSLTINDIAAHDHFKQQSILQTTDQYKPPNLI-IQSNNACSISNGNL--NFDVNPISPTNAYPXXXXXXXXXXXXXXXXXXXXXXFPYQGQF-ENRAQFDDNGVPIMPLMPNTTQTSPVPTFPPIDTFNGSSSNGYMRPGSTGYXXXXXXXXXXXXXQCAAMTVKARWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWFDCSSCMREPSDIAVHGDEYFICDFKGHCVCVFKQDGTFVQRFGNETITNFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNHHVLVMDTLYIS 2568
            F+ ++++  +LE    LPT C  C+N   +PV+LNCLHIFDR CL  +E  D +   + CP+C   SG L SL+P+     +E +E + +       KC  CT G +++Y+C+ CAG LC+RC+ +HK +K  + H EV +LT+ +K NIK L K + + KPV C  H    Y+ +C+QC +  C  C  +DH  H  + L   P+ +   +   +  C + ++  +   + L++AL +++ S D NK HIEE+CN WK A+D +K      E+L+KN+ELHDDLE R+ + IN+  K ++HI++  EF  SYL KCS ++  +++KVVL C+  L       D+ + I F E   SI  VI  NFG F            ++   +D +  +  +  F + DL+  F +L +    +HD F        T    P  L    +  + +I+ G +  N D + I P    P+  +S      +      D VS  +     +    F + G+ I  +  +  + SP    P +D    S  +    P S  YN +       R  +CA+MT+ A+WGSLG   G ++SPHGFCLGF EEIVVADT NHRIQIF+K G F+S FGV+GR +G LW+PRKVAIIR +QRYVVCDRGNERSRMQ+F RSGHF+R+I I+YIDIVAGLA+N  GHIVA+DSVSPS FV+SE GELI+WFDCS+ M+EPSD+A+HG EY+ICDFK HCV VF++DGT+++R G ETIT+FPNGIDVSDHGDVL+GDSHGNRFHIAV++  G L+SEF C   KVSR+C LKIT+EGY+VTLA+++++VLV+DTLYIS
Sbjct:    9 FSGDFSKDEALEGSSGLPTTCGVCQNPLEDPVILNCLHIFDRDCLINYENNDGLADYIKCPRCEKTSGGLKSLEPFNIS-VLEKREDSDTNESETVIKCSTCTEGREAQYRCIHCAGTLCDRCRDIHKVMKLFSFH-EVLDLTENEKKNIKELTKTMQNAKPVPCTEHAGDVYSLFCMQCHVPMCRGCYEADHKGHVKLSLTAVPKHLESLLSGGMRECREKQDAFREVTDSLHSALSDLSTSRDHNKNHIEELCNTWKAAVDSVKIDFFQEEFLQKNRELHDDLEMRVWSRINQIRKTVDHIDFVSEFCSSYLQKCSILQMSRLVKVVLGCIEQLKSTSFRPDIPSKILFNEPEHSINAVIYNNFGSFDLPTAETARLLSDSPPVSDHTGRLLRLNTFPADDLSETFKNLAVKTNNSHDPF-------ITHNQLPLGLSETHTGQSRTIATGLVSENGDTSAIVPHRPGPISLASNVSAWGDLPMGTFDQVSAAFNSHVTQMNPVFLNQGLAIGSVSQDGLR-SPSICPPGMDLDPNSLLSRSKLPVS--YNASLYEYSRIRSARCASMTLLAKWGSLGCELGRLNSPHGFCLGFDEEIVVADTYNHRIQIFSKLGDFISFFGVSGRVDGLLWYPRKVAIIRQSQRYVVCDRGNERSRMQLFSRSGHFVRRIQIKYIDIVAGLAINQHGHIVAIDSVSPSAFVLSEEGELIRWFDCSNYMKEPSDVAIHGREYYICDFKAHCVIVFQEDGTYIRRIGGETITDFPNGIDVSDHGDVLVGDSHGNRFHIAVFNRTGDLLSEFVCNQTKVSRSCCLKITTEGYVVTLARSSNNVLVLDTLYIS 838          
BLAST of B-box type zinc finger protein ncl-1 vs. TrEMBL
Match: A0A3P7BWW3 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS3345 PE=4 SV=1)

HSP 1 Score: 676.396 bits (1744), Expect = 0.000e+0
Identity = 377/842 (44.77%), Postives = 526/842 (62.47%), Query Frame = 1
Query:  106 FTLEYAEGGSLENKQELPTICSQCKNSFSEPVVLNCLHIFDRGCLSKFECTDSIFPVVTCPKCHMQSGSLSSLKPYITQYAIESKEINVSTIDFNDFKCVLCTSGEDSKYKCVDCAGLLCERCKILHKEVKFLNSHLEVEELTDEDKTNIKLLKKHLADNKPVKCEVHCERKYTNYCIQCGMLACSRCLLSDHADHSTVLLQDFPEKIRFRIGNYIENCIKAEEMNKIAIEKLNNALMEVNNSHDENKTHIEEVCNEWKTAIDDIKT-----EYLKKNKELHDDLEFRIMNGINRGEKYLEHIEYALEFTKSYLDKCSNVEFCKIIKVVLNCLTDLSEKQIDTDVRTSIPFKENVSSITNVIRTNFGVF-----------LNNEKANDKSSSVSSMIEF-SGDLNNCFNSLTINDIAAHDHFKQQSILQTTDQYKPPNLI-IQSNNACSISNGNL--NFDVNPISPTNAYPXXXXXXXXXXXXXXXXXXXXXXFPYQGQF-ENRAQFDDNGVPIMPLMPNTTQTSPVPTFPPIDTFNGSSSNGYMRPGSTGYXXXXXXXXXXXXXQCAAMTVKARWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWFDCSSCMREPSDIAVHGDEYFICDFKGHCVCVFKQDGTFVQRFGNETITNFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNHHVLVMDTLYIS 2568
            F+ ++++  +LE    LPT C  C+N   +PV+LNCLHIFDR CL  +E  D +   + CP+C   SG L SL+P+     +E +E + +       KC  CT G +++Y+C+ CAG LC+RC+ +HK +K  + H EV +LT+ +K NIK L K + + KPV C  H    Y+ +C+QC +  C  C  +DH  H  + L   P+ +   +   +  C + ++  +   + L++AL +++ S D NK HIEE+CN WK A+D +K      E+L+KN+ELHDDLE R+ + IN+  K ++HI++  EF  SYL KCS ++  +++KVVL C+  L       D+ + I F E   SI  VI  NFG F            ++   +D +  +  +  F + DL+  F +L +    +HD F        T    P  L    +  + +I+ G +  N D + I P    P+  +S      +      D VS  +     +    F + G+ I  +  +  + SP    P +D    S  +    P S  YN +       R  +CA+MT+ A+WGSLG   G ++SPHGFCLGF EEIVVADT NHRIQIF+K G F+S FGV+GR +G LW+PRKVAIIR +QRYVVCDRGNERSRMQ+F RSGHF+R+I I+YIDIVAGLA+N  GHIVA+DSVSPS FV+SE GELI+WFDCS+ M+EPSD+A+HG EY+ICDFK HCV VF++DGT+++R G ETIT+FPNGIDVSDHGDVL+GDSHGNRFHIAV++  G L+SEF C   KVSR+C LKIT+EGY+VTLA+++++VLV+DTLYIS
Sbjct:    9 FSGDFSKDEALEGSSGLPTTCGVCQNPLEDPVILNCLHIFDRDCLINYENNDGLADYIKCPRCEKTSGGLKSLEPFNIS-VLEKREDSDTNESETVIKCSTCTEGREAQYRCIHCAGTLCDRCRDIHKVMKLFSFH-EVLDLTENEKKNIKELTKTMQNAKPVPCTEHAGDVYSLFCMQCHVPMCRGCYEADHKGHVKLSLTAVPKHLESLLSGGMRECREKQDAFREVTDSLHSALSDLSTSRDHNKNHIEELCNTWKAAVDSVKIDFFQEEFLQKNRELHDDLEMRVWSRINQIRKTVDHIDFVSEFCSSYLQKCSILQMSRLVKVVLGCIEQLKSTSFRPDIPSKILFNEPEHSINAVIYNNFGSFDLPTAETARLLSDSPPVSDHTGRLLRLNTFPADDLSETFKNLAVKTNNSHDPF-------ITHNQLPLGLSETHTGQSRTIATGLVSENGDTSAIVPHRPGPISLASNVSAWGDLPMGTFDQVSAAFNSHVTQMNPVFLNQGLAIGSVSQDGLR-SPSICPPGMDLDPNSLLSRSKLPVS--YNASLYEYSRIRSARCASMTLLAKWGSLGCELGRLNSPHGFCLGFDEEIVVADTYNHRIQIFSKLGDFISFFGVSGRVDGLLWYPRKVAIIRQSQRYVVCDRGNERSRMQLFSRSGHFVRRIQIKYIDIVAGLAINQHGHIVAIDSVSPSAFVLSEEGELIRWFDCSNYMKEPSDVAIHGREYYICDFKAHCVIVFQEDGTYIRRIGGETITDFPNGIDVSDHGDVLVGDSHGNRFHIAVFNRTGDLLSEFVCNQTKVSRSCCLKITTEGYVVTLARSSNNVLVLDTLYIS 838          
BLAST of B-box type zinc finger protein ncl-1 vs. TrEMBL
Match: A0A448WE93 (Uncharacterized protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS3022 PE=4 SV=1)

HSP 1 Score: 669.463 bits (1726), Expect = 0.000e+0
Identity = 366/827 (44.26%), Postives = 513/827 (62.03%), Query Frame = 1
Query:  124 EGGSLENKQELPTICSQCKNSFSEPVVLNCLHIFDRGCLSKFECTDSIFPVVTCPKCHMQSGSLSSLKPYITQYAIESKEINVSTIDFNDFKCVLCTSGEDSKYKCVDCAGLLCERCKILHKEVKFLNSHLEVEELTDEDKTNIKLLKKHLADNKPVKCEVHCERKYTNYCIQCGMLACSRCLLSDHADHSTVLLQDFPEKIRFRIGNYIENCIKAEEMNKIAIEKLNNALMEVNNSHDENKTHIEEVCNEWKTAIDDIKTEYLKKNKELHDDLEFRIMNGINRGEKYLEHIEYALEFTKSYLDKCSNVEFCKIIKVVLNCLTDLSEKQIDTDVRTSIPFKENVSSITNVIRTNFGVFLNNEKANDKSSSVSSMIEFSGDLNNCFNSLTINDIAAHDHFKQQSILQTTDQYKPPNLIIQSNNACSISNGNLNFDVNPISPTNAYPXXXXXXXXXXXXXXXXXXXXXXFPYQGQFENRAQFDDNGVPIMPLMPNTTQTSPVPTFPPIDTFNGSSSNGY-------------MRPGSTGYXXXXXXXXXXXXXQCAAMTVKARWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWFDCSSCMREPSDIAVHGDEYFICDFKGHCVCVFKQDGTFVQRFGNETITNFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNHHVLVMDTLYI 2565
            +G  LE    LPT CS C+ SF +PV+LNCLHIFDR CL KFE  D I   + CPKC   SG L +L+ Y T   +       ++I      C +CT G ++ YKC+ CAG LCERC+ +HK +K  ++H EV +LT+E++ + K+L +++ ++KPV C  H +  Y+ +C+QC +  C  CL SDH +H T  +      +   + + I  C K +       + L+N+L E+++S D  K  +E +CN WKTAID ++ +YL++N+++HDD+E +I   +N   K ++HI++A EF+ SYL KCSN+E  ++ KVVL C   LS+     D+ + + F E    I+++IR NFG F +    N  S               C           H ++  QS    +++ K  NL + ++ A    N N   D   ISPT ++    ++  L   +    L    +            +D+    +  + P+ +  +P      +   N + SN                +P  + ++         R  +C+ M +  +WGS GS  G++++PHGFCLGF EEIVVADT NHRIQIFTK G F+  FGV+GR +G LW+PRKVAIIR +QRYVVCDRG+ERSRMQ+F RSGHF+R+I IRYIDIVAGLA+N  GHIVA+DSVSPSVFVVSE G+LI+WFDCS+ MREPSD+A+HG EY+ICDFK HCV VF++DGTF++R G ET+T++PNGIDVSDHGDVL+GDSHGNRFHIAV+S  G+L+SEF C   K+SR+C LKIT+EGY+VTLA++++ VLVMDTLYI
Sbjct:    7 KGDDLEESGGLPTKCSICEKSFRDPVILNCLHIFDRECLGKFEKNDGIVSFIKCPKCENTSGGLKTLESYDTSIIVTGVRAGENSIGTKSVLCSVCTEGGEALYKCIQCAGPLCERCRDIHKVMKVFSTH-EVLDLTNEERCDPKVLYRNMKNSKPVICPCHDDVPYSLFCMQCHVPLCIECLESDHRNHITAPIDTVAHHLDPLLSSIIAICKKKQSSLHDVSQALHNSLSELSSSRDNTKNQVENLCNAWKTAIDAVREDYLRRNRDIHDDIEMKIWCRVNHISKNIDHIDFATEFSNSYLRKCSNLEMSRLAKVVLACFNSLSKINFSPDIPSRVLFTEPSICISDIIRMNFGTFSHPNLDNGNS-------HIENGAAGCL---------PHSNY-LQSTNDVSEELKCLNLKLDNDFAHEFHNLNTRVDGINISPTGSHHSGRAAVALGNGSIDPLLTRPDALAL---VSGPTTWDELSSGLSSIDPSASGLTPDFLSSTLLANNFTQSNHMAGTLHSLDGDALSQKPKVSTHSSALYEYSRMRTARCSQMNLITKWGSQGSELGKLNAPHGFCLGFDEEIVVADTYNHRIQIFTKRGDFVCCFGVSGRSDGLLWYPRKVAIIRQSQRYVVCDRGSERSRMQLFSRSGHFVRRIPIRYIDIVAGLAINQHGHIVAIDSVSPSVFVVSEEGDLIRWFDCSNHMREPSDVAIHGREYYICDFKAHCVIVFQEDGTFIRRIGGETLTDYPNGIDVSDHGDVLVGDSHGNRFHIAVFSRTGELLSEFVCNQTKISRSCCLKITTEGYVVTLARSSNTVLVMDTLYI 812          
BLAST of B-box type zinc finger protein ncl-1 vs. TrEMBL
Match: A0A3Q0KG24 (Putative trim56 protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 667.922 bits (1722), Expect = 0.000e+0
Identity = 375/858 (43.71%), Postives = 532/858 (62.00%), Query Frame = 1
Query:  106 FTLEYAEGGSLENKQELPTICSQCKNSFSEPVVLNCLHIFDRGCLSKFECTDSIFPVVTCPKCHMQSGSLSSLKPYITQYAIESKEINVS-TIDFNDFKCVLCTSGEDSKYKCVDCAGLLCERCKILHKEVKFLNSHLEVEELTDEDKTNIKLLKKHLADNKPVKCEVHCERKYTNYCIQCGMLACSRCLLSDHADHSTVLLQDFPEKIRFRIGNYIENCIKAEEMNKIAIEKLNNALMEVNNSHDENKTHIEEVCNEWKTAIDDIKTEYLKKNKELHDDLEFRIMNGINRGEKYLEHIEYALEFTKSYLDKCSNVEFCKIIKVVLNCLTDLSEKQIDTDVRTSIPFKENVSSITNVIRTNFGVF-LNNEKANDKSSSVSSMIE-------------FSGDLNNCFNSLTINDIAAHDHFKQQSILQTTDQYKPPNLIIQSNNAC------SISNGNLNFDVNPISPTNAYPXXXXXXXXXXXXXXXXXXXXXXFPYQGQFENRAQFDDNGVPIMPLMP-----NTTQTSPVPTFPPIDTFN----GS--------SSNGYMRPGSTGYXXXXXXXXXXXXXQCAAMTVKARWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWFDCSSCMREPSDIAVHGDEYFICDFKGHCVCVFKQDGTFVQRFGNETITNFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNHHVLVMDTLYI 2565
            F+ ++++  +LE    LPT+C  C+  F+ PV+L+CLHIFDR C+  FE  DS+ P   CP+C   SGS+ +L+ Y    A    E + S  ++    KC +CT G D+ Y+C+ CAG LCERC+ +HK +K  ++H E+ +LT+E+K N ++L++++ + KPV C +H E  +T++C+QC +  C  C   +H  H T+LL   P  I   + + +E C   ++  + +IE +++ L E+++S D NK+ I + C +W T+I+ IK +++ KN+E+HD+LE +I + IN   K ++H+++A +F K YL KCSN+E CK+ K VL C   LS++Q+  D      F   +S+  +VI  +FG F   N    D     +S++E               GD+ N    LT+      D      +  +   + PP  ++Q +  C      ++ NGN+N  ++  S + A                                + + + D  V +  L P     N TQ  P+ + P I T N    GS        SS    +     YN         R  +C+ M +  +WGSLG   G ++SPHGFCLGF EEIVVADT NHRIQIFTK G F+S FGV+GR +G +W+PRKVAIIR +QRYVVCDRGNERSRMQ+F RSGHF+R+I IRYIDIVAGLA+N  GHIVA+DSVSPSVFVVSE G+LI+WFDCS+ MREPSD+A+HG EY+ICDFK HCV VF++DG+F++R G E+IT+FPNGIDVSDHGDVL+GDSHGNRFHIAV+S  G+L+SEF C   KVSR+C LKIT+EGY+VTLA+++++VLV++TLYI
Sbjct:   16 FSDDFSKISTLEEAGGLPTLCGICEKPFTNPVILSCLHIFDRECVRNFEKNDSMVPYTKCPRCDTLSGSVRTLEAYDLSVAQTRSEGDGSHKVNGAAVKCSVCTDGNDALYRCLHCAGTLCERCRDIHKVMKVFSNH-EILDLTEEEKGNAEILQRNMLNTKPVICTIHPESTFTSFCLQCHIPLCETCFECEHKGHITILLGLVPTHIDSLLSDMVECCRLRQKDFRDSIEMMHSLLSELSSSRDANKSLINKTCKQWITSIERIKDQFIHKNREIHDELEMKIWSRINTMSKTVDHVDFACDFVKVYLKKCSNIEICKLFKNVLACFDKLSKQQVVNDPSAKAVFSPGLSAY-DVIHQHFGTFSFTNGLEQDLQQVSNSLLEGFPAPNPHIAVLSSVGDITNDLKQLTLKVDGHMDPDPLSGLDHSVTVHLPPVSLVQQDGTCENINPSAVGNGNINNYISRSSNSGA-----------------------------SGRHNSNWCDLNVTLPNLEPSDFLCNVTQVDPIFSNPFITTDNLRAPGSNVSTLDVDSSLILKQKLPVSYNATLYEYSRMRAARCSQMNLLTKWGSLGCELGRLNSPHGFCLGFEEEIVVADTYNHRIQIFTKRGDFVSFFGVSGRVDGLMWYPRKVAIIRQSQRYVVCDRGNERSRMQLFSRSGHFVRRIPIRYIDIVAGLAINQHGHIVAIDSVSPSVFVVSEEGDLIRWFDCSNHMREPSDVAIHGREYYICDFKAHCVIVFQEDGSFIRRIGGESITDFPNGIDVSDHGDVLVGDSHGNRFHIAVFSRSGELLSEFVCNQTKVSRSCCLKITTEGYVVTLARSSNNVLVLNTLYI 842          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Cavefish
Match: trim3a (tripartite motif containing 3a [Source:ZFIN;Acc:ZDB-GENE-080522-4])

HSP 1 Score: 101.679 bits (252), Expect = 2.109e-21
Identity = 85/266 (31.95%), Postives = 128/266 (48.12%), Query Frame = 1
Query: 1765 RWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWFDCSSCMRE----PSDIAVHG-DEYFICDFKGHCVCVFKQDGTFVQRFGNETIT----NFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNH 2535
            R G+ G  RGE S+  G     +  IVVAD+ N  IQ+F+ DGQF  +FGV GR  GQL  P  V +  +    +V D  N    + IF   G F  KI    +    G+AV+  GHI+A D+ +  VF+    G+L+  F            P  +AV+  +E  + DF  H V V+  DG F+ +FG+        N P G+ V  +G++++ D   +R  I V+   G  +S     +  +    GL +TS+G++      NH
Sbjct:  446 RVGTRGRERGEFSNLQGISTSSNGRIVVADSNNQCIQVFSNDGQFKLRFGVRGRSPGQLQRPTGVTVDMNGD-IIVADYDNR--WITIFSSDGKFKSKIGAGRLMGPKGVAVDKNGHIIAADNKACCVFIFQSNGKLVTKFGAKGTSDRQFSGPHFVAVNNKNEIVVTDFHNHSVKVYNADGEFLFKFGSHGEGNGQFNAPTGVAVDGNGNIIVADWGNSR--IQVFDSSGSFLSYINTTADPLYGPQGLALTSDGHVAVADSGNH 706          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Cavefish
Match: trim2a (tripartite motif containing 2 [Source:NCBI gene;Acc:103036279])

HSP 1 Score: 99.3673 bits (246), Expect = 1.115e-20
Identity = 82/266 (30.83%), Postives = 130/266 (48.87%), Query Frame = 1
Query: 1765 RWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWF----DCSSCMREPSDIAV-HGDEYFICDFKGHCVCVFKQDGTFVQRFGNETIT----NFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNH 2535
            R G+ G  +GE ++  G       ++++AD+ N  +QIF+ DGQF S+FGV GR  GQL  P  VA +  T   ++ D  N+   + IF   G F  KI    +    G+ V+  GHI+ VD+ +  VF+    G+L+  F    +       P   AV   +E  + DF  H V VF  +G F+ +FG+        N P G+ V  +G++++ D   +R  I V+   G  +S     +  +    GL +TS+G++V     NH
Sbjct:  478 RIGTKGRNKGEFTNLQGVAASNVGKVLIADSNNQCVQIFSNDGQFKSRFGVRGRSPGQLQRPTGVA-VHPTGDIIIADYDNK--WVSIFSNDGKFKTKIGSGKLMGPKGVTVDRNGHIIVVDNKACCVFIFQPNGKLVTKFGNRGNGDKQFAGPHFAAVNQNNEIIVTDFHNHSVKVFNPEGEFLLKFGSNGEGNGQFNAPTGVAVDVNGNIIVADWGNSR--IQVFDGSGSFLSYINTSADPLYGPQGLALTSDGHVVVADSGNH 738          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Cavefish
Match: trim2a (tripartite motif containing 2 [Source:NCBI gene;Acc:103036279])

HSP 1 Score: 99.3673 bits (246), Expect = 1.115e-20
Identity = 82/266 (30.83%), Postives = 130/266 (48.87%), Query Frame = 1
Query: 1765 RWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWF----DCSSCMREPSDIAV-HGDEYFICDFKGHCVCVFKQDGTFVQRFGNETIT----NFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNH 2535
            R G+ G  +GE ++  G       ++++AD+ N  +QIF+ DGQF S+FGV GR  GQL  P  VA +  T   ++ D  N+   + IF   G F  KI    +    G+ V+  GHI+ VD+ +  VF+    G+L+  F    +       P   AV   +E  + DF  H V VF  +G F+ +FG+        N P G+ V  +G++++ D   +R  I V+   G  +S     +  +    GL +TS+G++V     NH
Sbjct:  478 RIGTKGRNKGEFTNLQGVAASNVGKVLIADSNNQCVQIFSNDGQFKSRFGVRGRSPGQLQRPTGVA-VHPTGDIIIADYDNK--WVSIFSNDGKFKTKIGSGKLMGPKGVTVDRNGHIIVVDNKACCVFIFQPNGKLVTKFGNRGNGDKQFAGPHFAAVNQNNEIIVTDFHNHSVKVFNPEGEFLLKFGSNGEGNGQFNAPTGVAVDVNGNIIVADWGNSR--IQVFDGSGSFLSYINTSADPLYGPQGLALTSDGHVVVADSGNH 738          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Cavefish
Match: trim2a (tripartite motif containing 2 [Source:NCBI gene;Acc:103036279])

HSP 1 Score: 99.3673 bits (246), Expect = 1.115e-20
Identity = 82/266 (30.83%), Postives = 130/266 (48.87%), Query Frame = 1
Query: 1765 RWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWF----DCSSCMREPSDIAV-HGDEYFICDFKGHCVCVFKQDGTFVQRFGNETIT----NFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNH 2535
            R G+ G  +GE ++  G       ++++AD+ N  +QIF+ DGQF S+FGV GR  GQL  P  VA +  T   ++ D  N+   + IF   G F  KI    +    G+ V+  GHI+ VD+ +  VF+    G+L+  F    +       P   AV   +E  + DF  H V VF  +G F+ +FG+        N P G+ V  +G++++ D   +R  I V+   G  +S     +  +    GL +TS+G++V     NH
Sbjct:  478 RIGTKGRNKGEFTNLQGVAASNVGKVLIADSNNQCVQIFSNDGQFKSRFGVRGRSPGQLQRPTGVA-VHPTGDIIIADYDNK--WVSIFSNDGKFKTKIGSGKLMGPKGVTVDRNGHIIVVDNKACCVFIFQPNGKLVTKFGNRGNGDKQFAGPHFAAVNQNNEIIVTDFHNHSVKVFNPEGEFLLKFGSNGEGNGQFNAPTGVAVDVNGNIIVADWGNSR--IQVFDGSGSFLSYINTSADPLYGPQGLALTSDGHVVVADSGNH 738          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Cavefish
Match: trim3a (tripartite motif containing 3a [Source:ZFIN;Acc:ZDB-GENE-080522-4])

HSP 1 Score: 95.9005 bits (237), Expect = 1.381e-19
Identity = 87/286 (30.42%), Postives = 132/286 (46.15%), Query Frame = 1
Query: 1765 RWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWFDCS-SCMREPSD-----------------------IAVHG-DEYFICDFKGHCVCVFKQDGTFVQRFGNETIT----NFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNH 2535
            R G+ G  RGE S+  G     +  IVVAD+ N  IQ+F+ DGQF  +FGV GR  GQL  P  V +  +    +V D  N    + IF   G F  KI    +    G+AV+  GHI+A D+ +  VF+    G+L+  F    +  R+ SD                       +AV+  +E  + DF  H V V+  DG F+ +FG+        N P G+ V  +G++++ D   +R  I V+   G  +S     +  +    GL +TS+G++      NH
Sbjct:  435 RVGTRGRERGEFSNLQGISTSSNGRIVVADSNNQCIQVFSNDGQFKLRFGVRGRSPGQLQRPTGVTVDMNGD-IIVADYDNR--WITIFSSDGKFKSKIGAGRLMGPKGVAVDKNGHIIAADNKACCVFIFQSNGKLVTKFGAKGTSDRQFSDKSAPNTPVEQKLSKSGPAFSPHFVAVNNKNEIVVTDFHNHSVKVYNADGEFLFKFGSHGEGNGQFNAPTGVAVDGNGNIIVADWGNSR--IQVFDSSGSFLSYINTTADPLYGPQGLALTSDGHVAVADSGNH 715          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Sea Lamprey
Match: trim2b (tripartite motif containing 2b [Source:ZFIN;Acc:ZDB-GENE-090312-70])

HSP 1 Score: 103.605 bits (257), Expect = 1.846e-24
Identity = 80/264 (30.30%), Postives = 127/264 (48.11%), Query Frame = 1
Query: 1771 GSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWF----DCSSCMREPSDIAVHG-DEYFICDFKGHCVCVFKQDGTFVQRFGNETIT----NFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNH 2535
            G+ G  +GE ++  G     +  IV+AD+ N  +Q+FT DG F S+FGV GR  GQL  P  VA +      +V D  N+   + IFG  G F  K+    +    G+AV+  GHI+ VD+ +  V      G+L+  F    +       P  +AV+  ++  + DF  H V VF  DG F+ +FG+        N P G+ V   G++++ D   +R  I V+   G  +S     +  +    GL +T +G+++     NH
Sbjct:    5 GTKGRNKGEFTNLQGVATSGNSRIVIADSNNQCVQVFTNDGTFKSRFGVRGRSPGQLQRPTGVA-VHPNGDVIVADYDNK--WVSIFGTDGKFKSKLGAGKLLGPKGVAVDRNGHIIVVDNKACCVTAFQPSGKLVTRFGSRGNGDKQFAGPHFVAVNSNNDIIVTDFHNHSVKVFNSDGEFLLKFGSNGEGNGQFNAPTGVAVDALGNIIVADWGNSR--IQVFDSSGSFLSYINTSADPLYGPQGLALTCDGHVIVADSGNH 263          

HSP 2 Score: 70.8626 bits (172), Expect = 2.048e-13
Identity = 43/120 (35.83%), Postives = 65/120 (54.17%), Query Frame = 1
Query: 1765 RWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVA--GLAVNNMGHI 2118
            R+GS G+G  + + PH   +  + +I+V D  NH +++F  DG+FL +FG  G   GQ   P  VA + +    +V D GN  SR+Q+F  SG FL  I+     +    GLA+   GH+
Sbjct:  139 RFGSRGNGDKQFAGPHFVAVNSNNDIIVTDFHNHSVKVFNSDGEFLLKFGSNGEGNGQFNAPTGVA-VDALGNIIVADWGN--SRIQVFDSSGSFLSYINTSADPLYGPQGLALTCDGHV 255          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009943.1 (pep scaffold:Pmarinus_7.0:GL488567:275:4344:1 gene:ENSPMAG00000008992.1 transcript:ENSPMAT00000009943.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.7146 bits (182), Expect = 8.368e-14
Identity = 68/262 (25.95%), Postives = 104/262 (39.69%), Query Frame = 1
Query: 1765 RWGSLGSGRGEMSSPHGFCL--GFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWFDCSSCMREPSDIAVHGD-EYFICDFKGHCVCVFKQDGTFVQRFGNETITN----FPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPS---VKVSRACGLKITSEGYLVTL 2520
            ++G+ GS  G+   P G     G    IVV+D  NHR+QIF+ +G+ LS FG  G + GQ  +P  VA+       +V D  N   R+Q+F   G F+ K                                    G L K FD       P  +A   +    + DF  H + V + D    +  G           P G+ V   G + + DS  +R  + V+  DG  + +F  P     ++ R  G+ +T EG +V +
Sbjct:  331 KFGAHGSHPGQFDRPAGVAWDPGRGGRIVVSDKDNHRVQIFSGEGRVLSTFGERGSESGQFCYPWDVAVSPGDGLILVSDTRNH--RVQLFSPDGAFVNKYGFE--------------------------------GALWKHFD------SPRGVAFDAEGRLLVTDFNNHRLLVVRPDCRSARFLGGSGSGPGQFLRPQGVAVDPEGRIAVADSRNHR--VQVFEPDGAFLCQFGAPGGGPGQMDRPSGVAVTPEGLIVVV 550          

HSP 2 Score: 58.9214 bits (141), Expect = 7.099e-9
Identity = 34/79 (43.04%), Postives = 42/79 (53.16%), Query Frame = 1
Query: 1771 GSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGN 2007
            G  GSG G+   P G  +     I VAD++NHR+Q+F  DG FL QFG  G   GQ+  P  VA+       VV D GN
Sbjct:  477 GGSGSGPGQFLRPQGVAVDPEGRIAVADSRNHRVQVFEPDGAFLCQFGAPGGGPGQMDRPSGVAVT-PEGLIVVVDFGN 554          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005035.1 (pep scaffold:Pmarinus_7.0:GL476697:205350:209715:-1 gene:ENSPMAG00000004581.1 transcript:ENSPMAT00000005035.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.3142 bits (155), Expect = 4.037e-11
Identity = 70/283 (24.73%), Postives = 121/283 (42.76%), Query Frame = 1
Query: 1759 KARWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIR-----YIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWFDCSSC----MREPSDIAVHGD-EYFICDFKGHCVCVFKQDGTFVQRFGNETI-------TNFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLK--ITSEGYLVTLAKNNHHVLVM 2550
            + R+G  G+  G  + P G  +     ++VAD+ NHR+Q+F   G+F+   G  G  +GQ      V +       +V DR N   R+QIF R+G FLR           +    G+A ++ G +   D  +  V V S  G  ++ F         +  P  +AV       + D   H V +F + G ++ + G+ +          +P G+ V   G++++ DS  NR  + V+  DG  +  F     +  +  GL+      G +V   + NH + + 
Sbjct:    4 RLRFGCKGTEEGRFTWPRGLAVTPEGHLIVADSSNHRLQVFDWSGRFIRAIGSHGSGDGQFDCLSGVTVNAQLGLILVADRYNH--RVQIFDRTGRFLRAFGREGAGRGQLSYPWGVACDSSGLVYVCDKDNHRVQVFSPDGVFVRGFGGPGSGEGRLDHPHYLAVTPQGRVAVSDCGNHRVQIFDRYGRYISKLGDSSGSGSGPGQMRYPRGVAVDRSGNIVVADSGNNR--VKVFRPDGTFLHAFGSWGSEDGQMKGLEGLALHAGDIVVCDRENHRIQIF 282          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004722.1 (pep scaffold:Pmarinus_7.0:GL477448:190469:194693:-1 gene:ENSPMAG00000004305.1 transcript:ENSPMAT00000004722.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.9138 bits (128), Expect = 1.154e-8
Identity = 38/141 (26.95%), Postives = 56/141 (39.72%), Query Frame = 1
Query:  274 VVTCPKCHMQSGSLSSLKPYITQYAIESKEINVSTIDFNDFKCVLCTSGEDSKYKCVDCAGLLCERCKILHKEVKFLNSH-LEVEELTDEDKTNIKLLKKHLADNKPVKCEVHCERKYTNYCIQCGMLACSRCLLSDHADH 693
            +V CP CH        +  Y   +  +  E    T + +   C  C  G D++  CV+C   LC  C   H+ VKF   H +  ++   +D   +  L       +PV C VH       +C  C  L C  C L  H +H
Sbjct:    1 IVRCPICHQGCQPKDIVDNY---FVTDGSEGVAGTENSSQQPCTSCDDGADAEGFCVECLEWLCRTCIEAHQRVKFTKDHAIRRKDDAQDDAAGMATL-------RPVYCPVHRREPLKLFCETCDRLTCRDCQLLGHKEH 131          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Nematostella
Match: EDO29851 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2G3])

HSP 1 Score: 87.0409 bits (214), Expect = 2.403e-17
Identity = 76/279 (27.24%), Postives = 125/279 (44.80%), Query Frame = 1
Query: 1768 WGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIR-----YIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWFDCS-----SCMREPSDIA-VHGDEYFICDFKGHCVCVFKQDGTFVQRFGNE--TITNF--PNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPS---VKVSRACGLKITSEGYLVTLAKNNHHVLVM 2550
            +GS G   G++  P G C   +  I+VAD  N+RIQIF   G F+ +FG AG   GQ   P  V       R +V D+ N   R+Q+F   G FL K   +            +AVN+ G+I+  D+ +  V + +  G+ +  +         C   P  +A  H     + DF  H + V   D    Q  G E   +T F  P G+ V   G++++ DS  +R  I ++  +G  + +F        ++ R  G+ ++ +G +V +   N+ + V 
Sbjct:  309 FGSEGESGGQLCRPWGVCCDRNGSIIVADRSNNRIQIFDNYGNFVHKFGSAGSRNGQFDRPAGVTCDHERDRIIVADKDNH--RVQVFSLDGTFLLKFGEKGSKNGQFSYPWDVAVNSEGNILVSDTRNHRVQLFTCDGQFLNKYGFEQGIHWKCFDSPRGVAFAHDGRMIVTDFNNHRLLVISGDCKSAQWLGTEGSGLTQFVRPQGVCVDQEGNIVVADSRNHR--IQIFQPNGNFLCKFGSHGGALGQLDRPSGICVSPDGLIVVVDFGNNRIQVF 583          

HSP 2 Score: 53.5286 bits (127), Expect = 5.757e-7
Identity = 60/230 (26.09%), Postives = 98/230 (42.61%), Query Frame = 1
Query: 1753 TVKARWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLW----FPRKVAIIRSTQRYVVCDRGNERSRMQIFG--RSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWFDCSS-CMREPSDIAVHGDEYFICDFKGHCVCVFKQDGTFVQRFGNE----TITNFPNGIDVSDHGDVLIGDSHGNRFHI 2409
            T   ++G  GS  G+ S P    +     I+V+DT+NHR+Q+FT DGQFL+++G    ++G  W     PR VA      R +V D  N R  + I G  +S  +L                                   +EG  L ++      C+ +  +I V        D + H + +F+ +G F+ +FG+        + P+GI VS  G +++ D   NR  +
Sbjct:  399 TFLLKFGEKGSKNGQFSYPWDVAVNSEGNILVSDTRNHRVQLFTCDGQFLNKYGF---EQGIHWKCFDSPRGVAFAHDG-RMIVTDFNNHRL-LVISGDCKSAQWL----------------------------------GTEGSGLTQFVRPQGVCVDQEGNIVV-------ADSRNHRIQIFQPNGNFLCKFGSHGGALGQLDRPSGICVSPDGLIVVVDFGNNRIQV 582          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Nematostella
Match: EDO47715 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLM1])

HSP 1 Score: 87.0409 bits (214), Expect = 3.035e-17
Identity = 74/281 (26.33%), Postives = 126/281 (44.84%), Query Frame = 1
Query: 1768 WGSLGSGRGEMSSPHGFCLGFSEE-IVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIR-------YIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWFDCSSCMRE----PSDIAV-HGDEYFICDFKGHCVCVFKQDGTFVQRFGNETITN----FPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMS---EFECPSVKVSRACGLKITSEGYLVTLAKNNHHVLVM 2550
            +GS G+G GE S P    +    E  +V D  NHR+Q+F  +G F+ +FG  G D+GQ   P+ +A + +    VV D  N   R+QIF   G FLRK            ++   G+A    G I+  +  +  + +    GE I+ F      +     P  + V   D+  + D     + VF  +G  +  FG E   N     P G+   D  ++L+ D H +R  + +++ +G  ++   +F          CG+ +T++G +V +   NH + + 
Sbjct:  475 FGSEGAGGGEFSIPWAVAIDEENECFIVTDCNNHRVQVFDFNGVFMFKFGCEGIDKGQFKNPKGIARL-TNGHIVVADFNNH--RVQIFNEDGRFLRKFGFYGTGGEPGSMNHPCGVACTPGGLILISEQDNHRIQMFDVNGEPIRMFGSQGFTKGQFIYPHHLCVTQRDKVVVADCVNDRIQVFNIEGECLFSFGKEGTQNGLFDGPEGVTCDDEDNILVSDYHNHR--VQIFNAEGGFVAAFGQFGDEEGNFRNPCGIAVTNDGNVVVVDSGNHRIQIF 750          

HSP 2 Score: 86.6557 bits (213), Expect = 4.310e-17
Identity = 71/322 (22.05%), Postives = 137/322 (42.55%), Query Frame = 1
Query:  166 CSQCKNSFSEPVVLNCLHIFDRGCLSKFECTDSIFPVVTCPKCHMQSGSLSSLKPYITQYAIESKEINVSTIDFNDFKCVLCTSGED---SKYKCVDCAGLLCERCKILHKEVKFLNSH--LEVEELTDEDKTNIKLLKKHLADNKPVKCEVHCERKYTNYCIQCGMLACSRCLLSDHADHSTVLLQDFPEKIRFRIGNYIENCIKAEEMNKIAIEKLNNALMEVNNSHDENKTHIEEVCNEWKTAIDDIKTEYLKKNKELHDDLEFRIMNGINRGEKYLEHIEYALEFTKSYLDKCSNVEFCKIIKVVLNCLTDLSEKQID 1116
            C  C  ++  P VL CLH F + CL       S   ++ CP C  +          ++     +  ++  ++  ++ K + CT+ ED   +  +C++C   LCE+C   HK  K    H  L + EL  + +   KL       ++P+ C VH       +C  C    C  CL+ DH +H    L+D  +K R  +G  + +  K     K AI+K+ +    ++   +E +  +          I + + E L +   +H      +    +  +  L ++  +++FT++ L   +  E   + K +   L DL++ +++
Sbjct:   16 CPICLETYRTPKVLPCLHTFCQHCLKGM--IQSGENIIVCPTCRCEVCVPKEGVSALSTNFFINNMLDFLSVALSNSKPIFCTNCEDRNTASSRCIECMEFLCEQCVAAHKRTKLTKEHEILALNELQGQPEVQDKL-------HRPLVCSVHDNEVLKYFCETCDEPVCRECLIIDHREHRYGYLKDVDKKHRSEVGVLVMSTKKKLARLKEAIDKVTDTRKRLDCKAEEIRQEVMRHTQRCIEVIQEREQELLTQVNNIHRMKSKTLEIQSDDLDMMLGNLNSSIDFTENALRHGNEAEVMLVRKQMTARLKDLNQTKLE 328          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Nematostella
Match: EDO34308 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPQ3])

HSP 1 Score: 86.2705 bits (212), Expect = 4.679e-17
Identity = 67/230 (29.13%), Postives = 106/230 (46.09%), Query Frame = 1
Query: 1765 RWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIR-----YIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWF----DCSSCMREPSDIAVHG--DEYFICDFKGHCVCVFKQDGTFVQRFGNETITN----FPNGIDVSDHGDVLIGDSHGNRFHI 2409
            ++G  GS + E  SP G  +     I VAD+ NHR+Q+    G+F++ FG  G   G+   P  V  I +  R ++CD GN  +R+Q+  R+G F+ K         Y     GLAV     IV  D  +  V + S  G+ +  F    D       P  + V+   D+ F+ D K H + VF  +G +++ FG++         P G+ +   G ++I D   +R  I
Sbjct:  479 KFGQYGSKKREFKSPFGVAIDNEGRIYVADSYNHRVQVLGTRGEFITSFGSHGERRGEFNCPTDVD-IDNRGRVIICDNGN--NRVQVLNRNGGFIGKFGREGTGNGYFKSPWGLAVTANNEIVVADMENNRVQMFSPEGKFMMKFGSPGDRPGQFNAPGYLLVNNEDDQIFVSDSKNHRIQVFDMNGVYIRSFGSQGAGKGQFMHPRGLAMDIAGHLIIADMGNHRLQI 705          

HSP 2 Score: 71.2478 bits (173), Expect = 2.051e-12
Identity = 31/82 (37.80%), Postives = 48/82 (58.54%), Query Frame = 1
Query: 1768 WGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNER 2013
            +GS G+G+G+   P G  +  +  +++AD  NHR+QI    G+F+ + G  G  +GQL FP  VAI+ ++   VV D  N R
Sbjct:  669 FGSQGAGKGQFMHPRGLAMDIAGHLIIADMGNHRLQILNSAGEFVKEIGSEGSGDGQLSFPESVAIMPNSGYIVVSDLSNNR 750          

HSP 3 Score: 67.3958 bits (163), Expect = 3.056e-11
Identity = 54/221 (24.43%), Postives = 90/221 (40.72%), Query Frame = 1
Query: 1762 ARWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWFDCSSCMREPSDIAVHGDEYFICDFKGHCVCVFKQDGTFVQRFGNETITN----FPNGIDV-SDHGDVLIGDSHGNRFHI 2409
             ++G  G+G G   SP G  +  + EIVVAD +N+R+Q+F+ +G+F+ +FG  G   GQ   P  + +     +  V D  N   R+Q+F  +G ++R    +      G       H   +                              DIA H     I D   H + +    G FV+  G+E   +    FP  + +  + G +++ D   NR H+
Sbjct:  572 GKFGREGTGNGYFKSPWGLAVTANNEIVVADMENNRVQMFSPEGKFMMKFGSPGDRPGQFNAPGYLLVNNEDDQIFVSDSKNH--RIQVFDMNGVYIRSFGSQ------GAGKGQFMHPRGLAM----------------------------DIAGH---LIIADMGNHRLQILNSAGEFVKEIGSEGSGDGQLSFPESVAIMPNSGYIVVSDLSNNRIHV 753          

HSP 4 Score: 56.9954 bits (136), Expect = 4.653e-8
Identity = 59/277 (21.30%), Postives = 102/277 (36.82%), Query Frame = 1
Query:  163 ICSQCKNSFSEPVVLNCLHIFDRGCLSKFECTDSIFPVVTCPKCHMQSGSLSSLKPYITQYAIESKEINVSTIDFNDF----------------KCVLCTSGEDSKY---KCVDCAGLLCERCKILHKEVKFLNSHLEVEELTDEDKTNIKLLKKHLADNKPVKCEVHCERKYTNYCIQCGMLACSRCLLSDHADHSTVLLQDFPEKIRFRIGNYIENCIKAEEMNKIAIEKLNNALMEVNNSHDENKTHIEEVCNEWKTAIDDIKTEYLKKNKELH 936
            +C+ C +   EP +L C+H F   C+ +    D+    +TCP C  ++         I +  +ES  +N       D                 +C  C + E++     +CVDC   LC  C   HK V     H  +     E+  +  L K  L       C+ H       +CI C    C  C + +H +H  V  ++     R  I   +E       + K  ++K++     + + H      I +       A+ + + E LK+   +H
Sbjct:   16 VCAICLDRLVEPRLLICMHTFCTPCIQRISNNDA-SASLTCPTCRKETP--------IPETGVESLHLNFFVNQMLDVVRHKADELKKEIRETRRCEGCENNEEADVATSRCVDCNKPLCTTCVADHKRVHATLDHRVIAISEGEEGEDQALDKYSLT-----FCKYHTRNVIKYFCITCDEAICRVCTILEHREHQYVYPKEALPLRRNDIQGLLEKAKSRIPLLKGTLKKVDAMSRRLKDCHQALAKEIHQNTQARVKALIEGENELLKQLAGVH 278          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Nematostella
Match: EDO49584 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGQ9])

HSP 1 Score: 86.2705 bits (212), Expect = 5.016e-17
Identity = 78/275 (28.36%), Postives = 127/275 (46.18%), Query Frame = 1
Query: 1762 ARWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVN-NMGHIXXXXXXXXXXXXXXEGGELIK---WFDCSSCMREPSDIAVHGDEYFIC-DFKGHCVCVFKQDGTFVQRFGNETITN----FPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSV---KVSRACGLKITSEGYLVTLAKNNHHVLVM 2550
             ++G  GS  GE +   G  +     I+V D  NHR+Q+F   G F+ QFG  G   GQ   P  V  I    R VVC+R +   R+QIF R G F +K  +  +   + LAV+ N   IVA  +      +  + G+  K   + D +  +  P  +AV+   + I  D   H + +F   G F+  FG +   +     P G+ V  +G +++ D   +R  I V+S DG+  ++F        +++   GL +T +G +      N+ V V+
Sbjct:  524 VKFGRKGSDIGEFNGIFGVAVDDEGRIIVTDCHNHRVQVFNAQGAFMFQFGRKGEGSGQFQCPTGVG-IDPEGRIVVCERLS--PRIQIFDRDGMFQQKFHVPDLK-ASTLAVDENRRIIVADSANRCIHVISLDTGQSFKFGSFGDGNGELSYPCYVAVNPQGHIIVSDMHSHRIQIFDSRGRFLFNFGRKGSQDGELQRPTGVAVMQNGHIIVADRDNHR--IQVFSSDGRYFAKFGSKGEGDGQLNDPHGLALTPDGNICIADFRNNRVQVV 792          

HSP 2 Score: 71.2478 bits (173), Expect = 2.355e-12
Identity = 73/327 (22.32%), Postives = 136/327 (41.59%), Query Frame = 1
Query:  166 CSQCKNSFSEPVVLNCLHIFDRGCLSKFECTDSIFPVVTCPKCHMQSG-SLSSLKPYITQYAIESKEINVSTIDFNDFKCVLCTSGED---SKYKCVDCAGLLCERCKILHKEVKFLNSH--LEVEELTDEDKTNIKLLKKHLADNKPVKCEVHCERKYTNYCIQCGMLACSRCLLSDH--ADHSTVLLQDFPEKIRFRIGNYIENC---IKAEEMNKIAIEKLN---NALMEVNNSHDEN--KTHIEEVCNEWKTAIDDIKTEYLKKNKELHDDLEFRIMNGINRGEKYLEHIEYALEFTKSYLDKCSNVEFCKIIKVVLNCLTDL 1098
            C  C   F+ P +L CLH F + CL       S    ++CP C +        +  +   + + +  I+V+ +  +D K +LC+S E+   +  +C++C   LC  C+  H  ++   +H  + +EEL         L       ++P+ C  H   K   +C  C    C  C ++ H  A+H    L D  +K    I   +E     I A E +   +E++     A  EV  S  +      ++ + +  K+ ++++++   +K+  L    E        R E  L+ +     FT+  L   ++VE   + K +   L +L
Sbjct:   71 CPLCHEMFANPRLLPCLHTFCKRCLENLVPPRS--HTLSCPSCRLDVALGERGINGFAPNFVVTTM-IDVAAVRNHDQKPILCSSCEEKLPAAARCIECMDFLCYDCRNAHMRLRLTKTHRVVSIEELRSSSHPEDLL-------HRPIFCSDHGHEKLRYFCESCDQAICRECTMTTHSTANHKYTQLTDTIDKQTNSIQTLVEKLRRKIPAVEQSTKDVEEVTCRLEARAEVAKSEVQKCFPRILKILQDREKSMMNEVESVVRQKSNVLSMQQE--------RLENELKRLSITCTFTEQVLRHGNSVEILVVKKQLCERLNEL 379          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Nematostella
Match: EDO47729 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLP8])

HSP 1 Score: 86.2705 bits (212), Expect = 5.409e-17
Identity = 73/270 (27.04%), Postives = 119/270 (44.07%), Query Frame = 1
Query: 1792 GEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWFDCSSCMREPSDIAVHGD-EYFICDFKGHCVCVFKQDGTFVQRFG----NETITNFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMS----------EFECPSVKVSRACGLKITSEGYLVTLAKNNHHVLVMDT 2556
            G  + P+G       ++VV D  NHRIQI+  +G+ + QFG+ G+ +G++W+P  VA+ +S   +V  D GN  +R+Q F + G F+RK          G     +G                              M+ P   AV G+    + D   H + VF  +G F+  FG    ++   N P  I VS  G++L+ D+ GN F + V+   G  +S          +F CP+       G+   +EG++V     N +V V ++
Sbjct:  487 GVATDPYG-------QLVVTDHHNHRIQIYDSEGKMMRQFGIRGKGDGEIWYPAGVAVDKSGNIFVA-DHGN--NRIQAFTQEGEFIRKF---------GGKGTGLGQ-----------------------------MKGPCGAAVDGENRVLVADRDNHRIQVFDSEGNFLFTFGSYGDSQGKFNCPRHISVSSKGEILVSDA-GN-FRVQVFDGAGNFLSKFGEKGSNNGQFSCPA-------GVATDAEGHIVVADLKNLNVQVFNS 699          

HSP 2 Score: 78.5666 bits (192), Expect = 1.091e-14
Identity = 60/215 (27.91%), Postives = 93/215 (43.26%), Query Frame = 1
Query: 1765 RWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWFDCSSCMREPSDIAVHGDEYF-ICDFKGHCVCVFKQDGTFVQRFG-------NETITNFPNGIDVSDHGDVLIGD 2385
            ++G  G+G G+M  P G  +     ++VAD  NHRIQ+F  +G FL  FG  G  +G+   PR ++ + S    +V D GN   R+Q+F  +G+FL K                                  E G     F C      P+ +A   + +  + D K   V VF  DG F++R         N +    P G+ +SD+G+V++ D
Sbjct:  565 KFGGKGTGLGQMKGPCGAAVDGENRVLVADRDNHRIQVFDSEGNFLFTFGSYGDSQGKFNCPRHIS-VSSKGEILVSDAGN--FRVQVFDGAGNFLSKFG--------------------------------EKGSNNGQFSC------PAGVATDAEGHIVVADLKNLNVQVFNSDGEFIKRISQDPDSVKNASYFGKPTGVAISDNGNVVVAD 738          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Medaka
Match: trim3b (tripartite motif-containing protein 3 [Source:NCBI gene;Acc:101169131])

HSP 1 Score: 100.908 bits (250), Expect = 3.955e-21
Identity = 85/266 (31.95%), Postives = 129/266 (48.50%), Query Frame = 1
Query: 1765 RWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWFDCSSCMRE----PSDIAVHG-DEYFICDFKGHCVCVFKQDGTFVQRFGNETIT----NFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNH 2535
            R GS G  +GE ++  G     +  +VVAD+ N  IQ+F+ DGQF  +FGV GR  GQL  P  V +  +    VV D  N    + IFG  G F  KI    +    G+AV+  GHI+ VD+ +  VF+    G+L+  F            P  +AV+  +E  + DF  H V V+  DG F+ +FG+        N P G+ V  +G++++ D   +R  I V+   G  +S     +  +    GL +TS+G++      NH
Sbjct:  483 RVGSRGREKGEFTNLQGISASSNGRVVVADSNNQCIQVFSNDGQFKMRFGVRGRSPGQLQRPTGVTVDMNGD-IVVADYDNR--WVSIFGSDGKFKNKIGAGRLMGPKGVAVDKNGHIITVDNKACCVFIFQSNGKLVTKFGGRGTTDRQFAGPHFVAVNNKNEIIVTDFHNHSVKVYNADGEFLFKFGSHGEGNGQFNAPTGVAVDANGNIIVADWGNSR--IQVFDSTGSFLSYINTSADPLYGPQGLALTSDGHVAVADSGNH 743          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Medaka
Match: trim3b (tripartite motif-containing protein 3 [Source:NCBI gene;Acc:101169131])

HSP 1 Score: 99.7525 bits (247), Expect = 8.629e-21
Identity = 87/280 (31.07%), Postives = 133/280 (47.50%), Query Frame = 1
Query: 1765 RWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKW------------------FDCSSCMREPSDIAVHG-DEYFICDFKGHCVCVFKQDGTFVQRFGNETIT----NFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNH 2535
            R GS G  +GE ++  G     +  +VVAD+ N  IQ+F+ DGQF  +FGV GR  GQL  P  V +  +    VV D  N    + IFG  G F  KI    +    G+AV+  GHI+ VD+ +  VF+    G+L+                    F+ SS +  P  +AV+  +E  + DF  H V V+  DG F+ +FG+        N P G+ V  +G++++ D   +R  I V+   G  +S     +  +    GL +TS+G++      NH
Sbjct:  483 RVGSRGREKGEFTNLQGISASSNGRVVVADSNNQCIQVFSNDGQFKMRFGVRGRSPGQLQRPTGVTVDMNGD-IVVADYDNR--WVSIFGSDGKFKNKIGAGRLMGPKGVAVDKNGHIITVDNKACCVFIFQSNGKLVTKFGGRGTTDRQFAEKLGPNFNKSSSVFSPHFVAVNNKNEIIVTDFHNHSVKVYNADGEFLFKFGSHGEGNGQFNAPTGVAVDANGNIIVADWGNSR--IQVFDSTGSFLSYINTSADPLYGPQGLALTSDGHVAVADSGNH 757          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Medaka
Match: trim2a (tripartite motif containing 2 [Source:NCBI gene;Acc:101163547])

HSP 1 Score: 99.3673 bits (246), Expect = 1.253e-20
Identity = 81/266 (30.45%), Postives = 131/266 (49.25%), Query Frame = 1
Query: 1765 RWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWF----DCSSCMREPSDIAV-HGDEYFICDFKGHCVCVFKQDGTFVQRFGNETIT----NFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNH 2535
            R G+ G  +GE ++  G       ++++AD+ N  +Q+F+ DGQF S+FGV GR  GQL  P  VA +      ++ D  N+   + IF   G F  KI    +    G+AV+  GHI+ VD+ +  VF+    G+L+  F    +       P   AV + +E  + DF  H V VF  +G F+ +FG+        N P G+ V  +G++++ D   +R  I V+   G  +S     +  +    GL +TS+G++V     NH
Sbjct:  475 RIGTKGRNKGEFTNLQGVAASSLGKVLIADSNNQCVQMFSNDGQFKSRFGVRGRTPGQLQRPTGVA-VHPNGDIIIADYDNK--WVSIFSSEGKFKNKIGSGKLMGPKGVAVDKNGHIIVVDNKACCVFIFQVNGKLVTKFGNRGNGDKQFAGPHFAAVNNNNEIIVTDFHNHSVKVFNTEGEFLLKFGSNGEGNGQFNAPTGVSVDANGNIIVADWGNSR--IQVFDGSGSFLSYINTSADPLYGPQGLALTSDGHVVVADSGNH 735          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Medaka
Match: trim2a (tripartite motif containing 2 [Source:NCBI gene;Acc:101163547])

HSP 1 Score: 99.3673 bits (246), Expect = 1.253e-20
Identity = 81/266 (30.45%), Postives = 131/266 (49.25%), Query Frame = 1
Query: 1765 RWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWF----DCSSCMREPSDIAV-HGDEYFICDFKGHCVCVFKQDGTFVQRFGNETIT----NFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNH 2535
            R G+ G  +GE ++  G       ++++AD+ N  +Q+F+ DGQF S+FGV GR  GQL  P  VA +      ++ D  N+   + IF   G F  KI    +    G+AV+  GHI+ VD+ +  VF+    G+L+  F    +       P   AV + +E  + DF  H V VF  +G F+ +FG+        N P G+ V  +G++++ D   +R  I V+   G  +S     +  +    GL +TS+G++V     NH
Sbjct:  475 RIGTKGRNKGEFTNLQGVAASSLGKVLIADSNNQCVQMFSNDGQFKSRFGVRGRTPGQLQRPTGVA-VHPNGDIIIADYDNK--WVSIFSSEGKFKNKIGSGKLMGPKGVAVDKNGHIIVVDNKACCVFIFQVNGKLVTKFGNRGNGDKQFAGPHFAAVNNNNEIIVTDFHNHSVKVFNTEGEFLLKFGSNGEGNGQFNAPTGVSVDANGNIIVADWGNSR--IQVFDGSGSFLSYINTSADPLYGPQGLALTSDGHVVVADSGNH 735          
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Medaka
Match: trim2a (tripartite motif containing 2 [Source:NCBI gene;Acc:101163547])

HSP 1 Score: 99.3673 bits (246), Expect = 1.253e-20
Identity = 81/266 (30.45%), Postives = 131/266 (49.25%), Query Frame = 1
Query: 1765 RWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWF----DCSSCMREPSDIAV-HGDEYFICDFKGHCVCVFKQDGTFVQRFGNETIT----NFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNH 2535
            R G+ G  +GE ++  G       ++++AD+ N  +Q+F+ DGQF S+FGV GR  GQL  P  VA +      ++ D  N+   + IF   G F  KI    +    G+AV+  GHI+ VD+ +  VF+    G+L+  F    +       P   AV + +E  + DF  H V VF  +G F+ +FG+        N P G+ V  +G++++ D   +R  I V+   G  +S     +  +    GL +TS+G++V     NH
Sbjct:  475 RIGTKGRNKGEFTNLQGVAASSLGKVLIADSNNQCVQMFSNDGQFKSRFGVRGRTPGQLQRPTGVA-VHPNGDIIIADYDNK--WVSIFSSEGKFKNKIGSGKLMGPKGVAVDKNGHIIVVDNKACCVFIFQVNGKLVTKFGNRGNGDKQFAGPHFAAVNNNNEIIVTDFHNHSVKVFNTEGEFLLKFGSNGEGNGQFNAPTGVSVDANGNIIVADWGNSR--IQVFDGSGSFLSYINTSADPLYGPQGLALTSDGHVVVADSGNH 735          
BLAST of B-box type zinc finger protein ncl-1 vs. Planmine SMEST
Match: SMESG000059098.1 (SMESG000059098.1)

HSP 1 Score: 1610.89 bits (4170), Expect = 0.000e+0
Identity = 832/832 (100.00%), Postives = 832/832 (100.00%), Query Frame = 1
Query:   73 MTDLDSTLIEDFTLEYAEGGSLENKQELPTICSQCKNSFSEPVVLNCLHIFDRGCLSKFECTDSIFPVVTCPKCHMQSGSLSSLKPYITQYAIESKEINVSTIDFNDFKCVLCTSGEDSKYKCVDCAGLLCERCKILHKEVKFLNSHLEVEELTDEDKTNIKLLKKHLADNKPVKCEVHCERKYTNYCIQCGMLACSRCLLSDHADHSTVLLQDFPEKIRFRIGNYIENCIKAEEMNKIAIEKLNNALMEVNNSHDENKTHIEEVCNEWKTAIDDIKTEYLKKNKELHDDLEFRIMNGINRGEKYLEHIEYALEFTKSYLDKCSNVEFCKIIKVVLNCLTDLSEKQIDTDVRTSIPFKENVSSITNVIRTNFGVFLNNEKANDKSSSVSSMIEFSGDLNNCFNSLTINDIAAHDHFKQQSILQTTDQYKPPNLIIQSNNACSISNGNLNFDVNPISPTNAYPXXXXXXXXXXXXXXXXXXXXXXFPYQGQFENRAQFDDNGVPIMPLMPNTTQTSPVPTFPPIDTFNGSSSNGYMRPGSTGYXXXXXXXXXXXXXQCAAMTVKARWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWFDCSSCMREPSDIAVHGDEYFICDFKGHCVCVFKQDGTFVQRFGNETITNFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNHHVLVMDTLYIS 2568
            MTDLDSTLIEDFTLEYAEGGSLENKQELPTICSQCKNSFSEPVVLNCLHIFDRGCLSKFECTDSIFPVVTCPKCHMQSGSLSSLKPYITQYAIESKEINVSTIDFNDFKCVLCTSGEDSKYKCVDCAGLLCERCKILHKEVKFLNSHLEVEELTDEDKTNIKLLKKHLADNKPVKCEVHCERKYTNYCIQCGMLACSRCLLSDHADHSTVLLQDFPEKIRFRIGNYIENCIKAEEMNKIAIEKLNNALMEVNNSHDENKTHIEEVCNEWKTAIDDIKTEYLKKNKELHDDLEFRIMNGINRGEKYLEHIEYALEFTKSYLDKCSNVEFCKIIKVVLNCLTDLSEKQIDTDVRTSIPFKENVSSITNVIRTNFGVFLNNEKANDKSSSVSSMIEFSGDLNNCFNSLTINDIAAHDHFKQQSILQTTDQYKPPNLIIQSNNACSISNGNLNFDVNPISPTNAYPLLSSSGHLDGLNSSSSLGDVVSFPYQGQFENRAQFDDNGVPIMPLMPNTTQTSPVPTFPPIDTFNGSSSNGYMRPGSTGYNPNPRPPFPNRGNQCAAMTVKARWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIVAVDSVSPSVFVVSEGGELIKWFDCSSCMREPSDIAVHGDEYFICDFKGHCVCVFKQDGTFVQRFGNETITNFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNHHVLVMDTLYIS
Sbjct:    1 MTDLDSTLIEDFTLEYAEGGSLENKQELPTICSQCKNSFSEPVVLNCLHIFDRGCLSKFECTDSIFPVVTCPKCHMQSGSLSSLKPYITQYAIESKEINVSTIDFNDFKCVLCTSGEDSKYKCVDCAGLLCERCKILHKEVKFLNSHLEVEELTDEDKTNIKLLKKHLADNKPVKCEVHCERKYTNYCIQCGMLACSRCLLSDHADHSTVLLQDFPEKIRFRIGNYIENCIKAEEMNKIAIEKLNNALMEVNNSHDENKTHIEEVCNEWKTAIDDIKTEYLKKNKELHDDLEFRIMNGINRGEKYLEHIEYALEFTKSYLDKCSNVEFCKIIKVVLNCLTDLSEKQIDTDVRTSIPFKENVSSITNVIRTNFGVFLNNEKANDKSSSVSSMIEFSGDLNNCFNSLTINDIAAHDHFKQQSILQTTDQYKPPNLIIQSNNACSISNGNLNFDVNPISPTNAYPLLSSSGHLDGLNSSSSLGDVVSFPYQGQFENRAQFDDNGVPIMPLMPNTTQTSPVPTFPPIDTFNGSSSNGYMRPGSTGYNPNPRPPFPNRGNQCAAMTVKARWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIVAVDSVSPSVFVVSEGGELIKWFDCSSCMREPSDIAVHGDEYFICDFKGHCVCVFKQDGTFVQRFGNETITNFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNHHVLVMDTLYIS 832          
BLAST of B-box type zinc finger protein ncl-1 vs. Planmine SMEST
Match: SMESG000035122.1 (SMESG000035122.1)

HSP 1 Score: 667.922 bits (1722), Expect = 0.000e+0
Identity = 403/874 (46.11%), Postives = 548/874 (62.70%), Query Frame = 1
Query:   73 MTDLDSTLIEDFTLEYAEGGSLENKQELPTICSQCKNSFSEPVVLNCLHIFDRGCLSKFECTDSIFPVVTCPKCHMQSGSLSSLKPY---ITQYAIESKEINVSTIDFNDFKCVLCTSGEDSKYKCVDCAGLLCERCKILHKEVKFLNSHLEVEELTDEDKTNIKLLKKHLADNKPVKCEVHCERKYTNYCIQCGMLACSRCLLSDHADHSTVLLQDFPEKIRFRIGNYIENC-IKAEEMNKIAIEKLNNALMEVNNSHDENKTHIEEVCNEWKTAIDDIKTEYLKKNKELHDDLEFRIMNGINRGEKYLEHIEYALEFTKSYLDKCSNVEFCKIIKVVLNCLTDLS-------------------EKQIDTDVRTSIPFKENVSSITNVIRTNF----GVF-----------LNNEKANDKSSSVSSMIEFSGDLNNCFNSLTINDIAAHDHFKQQSILQTTDQYKPPNLIIQSNNACSISNGNLNFDVNPISPTNAYPXXXXXXXXXXXXXXXXXXXXXXFPYQGQFENRAQFDDNGVPIMPLMPNTTQTSPVPTFPPID----TFNGSSSNGYMRPGSTGYXXXXXXXXXXXXXQCAAMTVKARWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWFDCSSCMREPSDIAVHGDEYFICDFKGHCVCVFKQDGTFVQRFGNETITNFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNHHVLVMDTLYIS 2568
            M+D D    E F  +   G +LE+   +P +C  C+N  SEP++L CLH+FD+ C+   E     +  + CPKC   +  LS+ +P    +    ++SK  + S  + N+ KC+LCT+ E   YKC DCAG++CERC+ILHKEV    SH  V+ELT +D+ NIK + K L+DNKPVKC +H E    ++C +C    C++C + DH +H  + L++  E I   + + +  C I  +++N+  +EKLN +L EV  S + NK  IE     WK+AID +K E++  NK  HD+LE+R+M  IN   K  +HI+ A++F   YL K S  E  K IK  L+CLT LS                    + I T VRT+     N+ S +N   +N     G+F           L N  +++ + S++     SG+  +     + +++  H    Q S   T          + SNN+ +  +   +    PIS  +       S   +     +S G V +    GQ+ + A +D+N +   P++P        P FP +D    + N   +N   RP     NP P+PPFPNR      M +K RWGS GS RG+++SPHGFCLGF+EEIVVADTQNHRI IF+KDGQF++QFG+AGR+EG LW PRKV IIR++Q YVVCDRG+ERSRMQIF ++G+F+RKI+I YIDIVAGLA+N+MGHIVAVDSVSP++FVV+E GE++KW +CSS MREPSDI VHG+ Y+ICDFKGHCVCV+KQDGTF+ RFGNE ITN+PNGIDVS+HGD+L+GDSHGNRFH+AV++ DG L  EFECPSVKVSRACGLKITSEGYLVTLAKNNH+VLV+DTLY++
Sbjct:    1 MSDYD----EMFYSKLMNGNNLEDSSGIPQLCEICENRLSEPILLPCLHVFDKNCILGIENDLLDYSQIKCPKCDFTT-VLSNSQPLNVNLFNVKLDSKHKDES--EDNETKCILCTNDEIGVYKCSDCAGIICERCRILHKEVVIFQSHNNVQELTQKDRDNIKDVVKSLSDNKPVKCPIHKESHIDSFCFKCCTGLCTKCKIIDHKNHEIIPLEEIFESINKDLDSSMAKCKITKDKLNE-TVEKLNWSLSEVAKSRNHNKCVIENAYETWKSAIDKMKEEFVAMNKTYHDNLEYRLMAQINDSHKTSDHIDSAMKFINFYLKKSSFFEASKFIKPTLDCLTTLSGLKSDPGQITTSVLLQCPSSEFIKTCVRTNFGSFPNLDSFSNSGHSNIFQENGLFSSSSFNTSNSGLQNLVSSEPNDSITMYSPISGNFEDNEMIASKDNLLFHSKLNQLSSGSTNR--------LMSNNSFTGLDSMTHPSNLPISLMHQTSNEFFSYPNEISPLLTSKGSVSASTDSGQYISHALYDENCL-TSPMLPRLG-----PEFP-LDGSQVSLNSQFNNNTFRP-LVNMNPVPKPPFPNRNRNYVPMVIKERWGSQGSNRGQLNSPHGFCLGFNEEIVVADTQNHRIHIFSKDGQFINQFGIAGREEGHLWHPRKVTIIRNSQHYVVCDRGSERSRMQIFAKNGYFIRKIAIPYIDIVAGLAINSMGHIVAVDSVSPTIFVVTEMGEMVKWIECSSQMREPSDIVVHGENYYICDFKGHCVCVYKQDGTFLFRFGNEKITNYPNGIDVSNHGDILVGDSHGNRFHVAVFTKDGHLTGEFECPSVKVSRACGLKITSEGYLVTLAKNNHNVLVIDTLYVN 850          
BLAST of B-box type zinc finger protein ncl-1 vs. Planmine SMEST
Match: SMESG000035122.1 (SMESG000035122.1)

HSP 1 Score: 666.381 bits (1718), Expect = 0.000e+0
Identity = 399/863 (46.23%), Postives = 543/863 (62.92%), Query Frame = 1
Query:  106 FTLEYAEGGSLENKQELPTICSQCKNSFSEPVVLNCLHIFDRGCLSKFECTDSIFPVVTCPKCHMQSGSLSSLKPY---ITQYAIESKEINVSTIDFNDFKCVLCTSGEDSKYKCVDCAGLLCERCKILHKEVKFLNSHLEVEELTDEDKTNIKLLKKHLADNKPVKCEVHCERKYTNYCIQCGMLACSRCLLSDHADHSTVLLQDFPEKIRFRIGNYIENC-IKAEEMNKIAIEKLNNALMEVNNSHDENKTHIEEVCNEWKTAIDDIKTEYLKKNKELHDDLEFRIMNGINRGEKYLEHIEYALEFTKSYLDKCSNVEFCKIIKVVLNCLTDLS-------------------EKQIDTDVRTSIPFKENVSSITNVIRTNF----GVF-----------LNNEKANDKSSSVSSMIEFSGDLNNCFNSLTINDIAAHDHFKQQSILQTTDQYKPPNLIIQSNNACSISNGNLNFDVNPISPTNAYPXXXXXXXXXXXXXXXXXXXXXXFPYQGQFENRAQFDDNGVPIMPLMPNTTQTSPVPTFPPID----TFNGSSSNGYMRPGSTGYXXXXXXXXXXXXXQCAAMTVKARWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWFDCSSCMREPSDIAVHGDEYFICDFKGHCVCVFKQDGTFVQRFGNETITNFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLKITSEGYLVTLAKNNHHVLVMDTLYIS 2568
            F  +   G +LE+   +P +C  C+N  SEP++L CLH+FD+ C+   E     +  + CPKC   +  LS+ +P    +    ++SK  + S  + N+ KC+LCT+ E   YKC DCAG++CERC+ILHKEV    SH  V+ELT +D+ NIK + K L+DNKPVKC +H E    ++C +C    C++C + DH +H  + L++  E I   + + +  C I  +++N+  +EKLN +L EV  S + NK  IE     WK+AID +K E++  NK  HD+LE+R+M  IN   K  +HI+ A++F   YL K S  E  K IK  L+CLT LS                    + I T VRT+     N+ S +N   +N     G+F           L N  +++ + S++     SG+  +     + +++  H    Q S   T          + SNN+ +  +   +    PIS  +       S   +     +S G V +    GQ+ + A +D+N +   P++P        P FP +D    + N   +N   RP     NP P+PPFPNR      M +K RWGS GS RG+++SPHGFCLGF+EEIVVADTQNHRI IF+KDGQF++QFG+AGR+EG LW PRKV IIR++Q YVVCDRG+ERSRMQIF ++G+F+RKI+I YIDIVAGLA+N+MGHIVAVDSVSP++FVV+E GE++KW +CSS MREPSDI VHG+ Y+ICDFKGHCVCV+KQDGTF+ RFGNE ITN+PNGIDVS+HGD+L+GDSHGNRFH+AV++ DG L  EFECPSVKVSRACGLKITSEGYLVTLAKNNH+VLV+DTLY++
Sbjct:    2 FYSKLMNGNNLEDSSGIPQLCEICENRLSEPILLPCLHVFDKNCILGIENDLLDYSQIKCPKCDFTT-VLSNSQPLNVNLFNVKLDSKHKDES--EDNETKCILCTNDEIGVYKCSDCAGIICERCRILHKEVVIFQSHNNVQELTQKDRDNIKDVVKSLSDNKPVKCPIHKESHIDSFCFKCCTGLCTKCKIIDHKNHEIIPLEEIFESINKDLDSSMAKCKITKDKLNE-TVEKLNWSLSEVAKSRNHNKCVIENAYETWKSAIDKMKEEFVAMNKTYHDNLEYRLMAQINDSHKTSDHIDSAMKFINFYLKKSSFFEASKFIKPTLDCLTTLSGLKSDPGQITTSVLLQCPSSEFIKTCVRTNFGSFPNLDSFSNSGHSNIFQENGLFSSSSFNTSNSGLQNLVSSEPNDSITMYSPISGNFEDNEMIASKDNLLFHSKLNQLSSGSTNR--------LMSNNSFTGLDSMTHPSNLPISLMHQTSNEFFSYPNEISPLLTSKGSVSASTDSGQYISHALYDENCL-TSPMLPRLG-----PEFP-LDGSQVSLNSQFNNNTFRP-LVNMNPVPKPPFPNRNRNYVPMVIKERWGSQGSNRGQLNSPHGFCLGFNEEIVVADTQNHRIHIFSKDGQFINQFGIAGREEGHLWHPRKVTIIRNSQHYVVCDRGSERSRMQIFAKNGYFIRKIAIPYIDIVAGLAINSMGHIVAVDSVSPTIFVVTEMGEMVKWIECSSQMREPSDIVVHGENYYICDFKGHCVCVYKQDGTFLFRFGNEKITNYPNGIDVSNHGDILVGDSHGNRFHVAVFTKDGHLTGEFECPSVKVSRACGLKITSEGYLVTLAKNNHNVLVIDTLYVN 844          
BLAST of B-box type zinc finger protein ncl-1 vs. Planmine SMEST
Match: SMESG000007013.1 (SMESG000007013.1)

HSP 1 Score: 67.3958 bits (163), Expect = 2.561e-11
Identity = 52/230 (22.61%), Postives = 96/230 (41.74%), Query Frame = 1
Query: 1765 RWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRMQIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWFDCSSCMREPSDIAVHGDEYF-ICDFKGHCVCVFKQDGTFVQRFG----NETITNFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLM 2439
            R G  GSG G+  +P G C+   +E+ + DT NHRIQ+ + +G F+  FG  G++   L  P  V +IR  Q  +V D   +  +++++  SG F                                             F  +S  + P  +A   ++Y  + D + H + +   +G  +++FG         N+P  I +S    +++ D+  N   + ++S +G L+
Sbjct:   60 RIGRKGSGTGQFLNPSGLCISKEDELFICDTGNHRIQVVSLEGHFIRCFGKFGKEISNLNNPISVLLIRDEQYILVTD--GDIKKIKMYSISGQFS------------------------------------------CIFSENSNFKHPFALAKTQNDYVAVTDLETHLINIIDPEGNLIRQFGGIGDKPYSLNYPTQIAISRDRQIIVVDNGTN--SLKIFSFNGILL 243          
BLAST of B-box type zinc finger protein ncl-1 vs. Planmine SMEST
Match: SMESG000015738.1 (SMESG000015738.1)

HSP 1 Score: 66.2402 bits (160), Expect = 1.253e-10
Identity = 80/288 (27.78%), Postives = 128/288 (44.44%), Query Frame = 1
Query: 1768 WGSLGSGRGEMSSPHGFCLGFS-EEIVVADTQNHRIQIFTKDGQFLSQFGVAGRDEG-----QLWFPRKVAIIRSTQRYVVC-DRGNER-SRMQI-------FGRSGHFLRKISIRYIDIVAGLAVNNMGHIXXXXXXXXXXXXXXEGGELIKWFDC--SSC--MREPSDIAV--HGDEYFICDFKGHCVCVFKQDGTFVQRFGNETITNF----PNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVSRACGLK---ITSEGYLVTLAKNNHHVLV 2547
            +GS G+G GE   P G  +  S   I++AD+ NHR+QIF+  G           D+G     QL F     I     + ++C DR + R + M I        G+S +   K+S  +     G+A ++  +I   D  +  + V S  GE IK        C     P  +AV       F+ D   H + VF + GT++  F  +  T F    P GI V + G+VLI D   NR  I+++S+ GK +  F        +  GL+   + ++G +    ++NH + +
Sbjct:  360 FGSKGTGSGEFIWPRGIAIDSSTNRIIIADSSNHRVQIFSDKGVCEKVIPEMVCDQGTDDNVQLKFDCLSGIAIDKNKRIICSDRYHHRVAIMDIDGKLICEIGKSSNNKAKLSYPW-----GIATDSRQNIFICDKDNHRIQVFSNNGEYIKEIGAHGQQCGMFDNPHYLAVCPKTKNIFVSDTSNHRIQVFDKHGTYLYSFNGDGPTKFHLKYPRGITVDNEGNVLICDYGNNR--ISIFSNQGKFLYLFGSHGSHDGQFKGLEGIAVFNDGRIAVSDRDNHRIQI 640          
The following BLAST results are available for this feature:
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRIM29.693e-2430.83tripartite motif containing 2 [Source:HGNC Symbol;... [more]
TRIM21.627e-2330.83tripartite motif containing 2 [Source:HGNC Symbol;... [more]
TRIM32.045e-2132.71tripartite motif containing 3 [Source:HGNC Symbol;... [more]
TRIM32.873e-2132.71tripartite motif containing 3 [Source:HGNC Symbol;... [more]
TRIM32.873e-2132.71tripartite motif containing 3 [Source:HGNC Symbol;... [more]
back to top
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nhl-22.295e-4536.30NHL (Ring finger b-box coiled coil) domain contain... [more]
ncl-11.793e-3731.80B-box type zinc finger protein ncl-1 [Source:UniP... [more]
ncl-12.109e-3731.80B-box type zinc finger protein ncl-1 [Source:UniP... [more]
ncl-13.504e-3731.80B-box type zinc finger protein ncl-1 [Source:UniP... [more]
ncl-13.577e-3731.80B-box type zinc finger protein ncl-1 [Source:UniP... [more]
back to top
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mei-P263.389e-11968.84gene:FBgn0026206 transcript:FBtr0333473[more]
mei-P263.389e-11968.84gene:FBgn0026206 transcript:FBtr0071303[more]
mei-P263.389e-11968.84gene:FBgn0026206 transcript:FBtr0333475[more]
mei-P264.222e-11968.84gene:FBgn0026206 transcript:FBtr0333474[more]
mei-P264.222e-11968.84gene:FBgn0026206 transcript:FBtr0340341[more]
back to top
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trim3b9.928e-2532.33tripartite motif containing 3b [Source:ZFIN;Acc:ZD... [more]
trim3b2.719e-2331.12tripartite motif containing 3b [Source:ZFIN;Acc:ZD... [more]
trim2a4.586e-2130.45tripartite motif containing 2a [Source:ZFIN;Acc:ZD... [more]
trim3a3.988e-2030.07tripartite motif containing 3a [Source:ZFIN;Acc:ZD... [more]
trim2b2.819e-1930.08tripartite motif containing 2b [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actr62.251e-2230.83ARP6 actin related protein 6 homolog [Source:Xenba... [more]
actr63.135e-2230.04ARP6 actin related protein 6 homolog [Source:Xenba... [more]
actr63.774e-2230.83ARP6 actin related protein 6 homolog [Source:Xenba... [more]
actr64.357e-2230.83ARP6 actin related protein 6 homolog [Source:Xenba... [more]
surf4.12.500e-1932.89surfeit 4, gene 1 [Source:Xenbase;Acc:XB-GENE-5807... [more]
back to top
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trim22.621e-2431.20tripartite motif-containing 2 [Source:MGI Symbol;A... [more]
Trim22.621e-2431.20tripartite motif-containing 2 [Source:MGI Symbol;A... [more]
Trim22.621e-2431.20tripartite motif-containing 2 [Source:MGI Symbol;A... [more]
Trim22.621e-2431.20tripartite motif-containing 2 [Source:MGI Symbol;A... [more]
Trim23.642e-2431.20tripartite motif-containing 2 [Source:MGI Symbol;A... [more]
back to top
BLAST of B-box type zinc finger protein ncl-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8MQJ9|BRAT_DROME1.240e-3832.95Brain tumor protein OS=Drosophila melanogaster OX=... [more]
sp|P34611|NCL1_CAEEL2.683e-3631.80B-box type zinc finger protein ncl-1 OS=Caenorhabd... [more]
sp|D3ZQG6|TRIM2_RAT3.143e-2131.20Tripartite motif-containing protein 2 OS=Rattus no... [more]
sp|Q9ESN6|TRIM2_MOUSE3.426e-2131.20Tripartite motif-containing protein 2 OS=Mus muscu... [more]
sp|F7H9X2|TRIM2_CALJA3.798e-2131.20Tripartite motif-containing protein 2 OS=Callithri... [more]
back to top
BLAST of B-box type zinc finger protein ncl-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P7M2I10.000e+045.08Uncharacterized protein OS=Dibothriocephalus latus... [more]
A0A183SGJ70.000e+044.77B-box type zinc finger protein ncl-1 OS=Schistocep... [more]
A0A3P7BWW30.000e+044.77Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A448WE930.000e+044.26Uncharacterized protein OS=Protopolystoma xenopodi... [more]
A0A3Q0KG240.000e+043.71Putative trim56 protein OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trim3a2.109e-2131.95tripartite motif containing 3a [Source:ZFIN;Acc:ZD... [more]
trim2a1.115e-2030.83tripartite motif containing 2 [Source:NCBI gene;Ac... [more]
trim2a1.115e-2030.83tripartite motif containing 2 [Source:NCBI gene;Ac... [more]
trim2a1.115e-2030.83tripartite motif containing 2 [Source:NCBI gene;Ac... [more]
trim3a1.381e-1930.42tripartite motif containing 3a [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
trim2b1.846e-2430.30tripartite motif containing 2b [Source:ZFIN;Acc:ZD... [more]
ENSPMAT00000009943.18.368e-1425.95pep scaffold:Pmarinus_7.0:GL488567:275:4344:1 gene... [more]
ENSPMAT00000005035.14.037e-1124.73pep scaffold:Pmarinus_7.0:GL476697:205350:209715:-... [more]
ENSPMAT00000004722.11.154e-826.95pep scaffold:Pmarinus_7.0:GL477448:190469:194693:-... [more]
back to top
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO298512.403e-1727.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477153.035e-1726.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343084.679e-1729.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495845.016e-1728.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477295.409e-1727.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of B-box type zinc finger protein ncl-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trim3b3.955e-2131.95tripartite motif-containing protein 3 [Source:NCBI... [more]
trim3b8.629e-2131.07tripartite motif-containing protein 3 [Source:NCBI... [more]
trim2a1.253e-2030.45tripartite motif containing 2 [Source:NCBI gene;Ac... [more]
trim2a1.253e-2030.45tripartite motif containing 2 [Source:NCBI gene;Ac... [more]
trim2a1.253e-2030.45tripartite motif containing 2 [Source:NCBI gene;Ac... [more]
back to top
BLAST of B-box type zinc finger protein ncl-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000059098.10.000e+0100.00SMESG000059098.1[more]
SMESG000035122.10.000e+046.11SMESG000035122.1[more]
SMESG000035122.10.000e+046.23SMESG000035122.1[more]
SMESG000007013.12.561e-1122.61SMESG000007013.1[more]
SMESG000015738.11.253e-1027.78SMESG000015738.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029263 ID=SMED30029263|Name=B-box type zinc finger protein ncl-1|organism=Schmidtea mediterranea sexual|type=transcript|length=4208bp
TATAGGTATCCATTTTTATATTTATATATTCAAAGTATATAAACTCGTGC
ATAATTGTTTTTATATTCAGTTATGACAGATCTGGATAGTACATTAATTG
AAGATTTTACCTTGGAGTATGCCGAAGGGGGCAGTTTGGAAAATAAACAA
GAATTACCGACCATTTGTTCTCAATGTAAAAACAGTTTCTCTGAACCAGT
TGTTCTAAACTGTCTACACATATTTGATCGAGGATGCTTATCAAAATTTG
AATGTACAGATAGCATATTTCCCGTTGTTACATGCCCAAAATGTCACATG
CAAAGTGGTAGTCTTTCAAGTTTAAAACCATATATTACTCAATATGCTAT
TGAATCAAAAGAAATAAATGTTTCAACAATCGATTTTAATGATTTCAAAT
GTGTCCTTTGTACCAGTGGCGAAGACAGTAAATATAAATGTGTAGACTGT
GCTGGATTACTATGCGAGCGTTGCAAAATTTTGCACAAAGAAGTCAAGTT
TTTAAATTCGCATTTAGAAGTAGAGGAATTGACAGACGAAGATAAAACAA
ACATTAAGTTGTTAAAAAAGCATTTAGCAGATAACAAACCAGTGAAATGT
GAAGTTCATTGTGAAAGGAAATATACCAACTATTGTATACAATGTGGAAT
GTTAGCATGTTCTCGATGCCTATTATCCGATCATGCTGATCATTCAACAG
TTTTATTGCAAGATTTTCCAGAAAAAATTCGGTTTCGTATAGGGAATTAC
ATAGAAAATTGTATAAAAGCTGAAGAAATGAATAAAATAGCTATTGAAAA
ATTAAATAATGCACTAATGGAAGTCAATAATAGTCACGATGAAAATAAAA
CTCATATTGAGGAAGTATGTAACGAATGGAAAACTGCGATTGATGATATT
AAAACAGAATATTTGAAAAAAAATAAAGAATTACACGATGATTTGGAATT
TAGAATTATGAATGGTATTAATAGAGGGGAAAAGTATTTGGAACACATTG
AATATGCTTTAGAATTCACGAAGTCTTATTTAGATAAGTGCTCTAATGTT
GAGTTTTGTAAAATAATTAAAGTGGTTCTTAACTGTCTTACCGATTTGTC
CGAAAAACAGATTGACACCGATGTGAGAACTAGTATTCCATTTAAAGAAA
ATGTTTCTTCAATTACAAATGTTATCAGAACCAATTTTGGAGTTTTTCTA
AATAATGAGAAAGCAAATGATAAAAGTTCTTCTGTTTCCAGTATGATTGA
GTTTTCAGGGGATCTAAATAATTGCTTCAATTCATTGACAATAAATGACA
TAGCAGCTCATGATCACTTTAAACAGCAAAGTATTTTACAAACAACCGAT
CAGTATAAGCCACCAAATCTGATCATTCAGTCTAATAATGCATGTAGCAT
ATCCAATGGAAATCTTAATTTCGATGTCAATCCTATTAGTCCAACTAATG
CATATCCTTTGCTCTCGTCCAGTGGTCATCTAGATGGGCTTAATAGTTCT
AGTTCATTAGGAGATGTTGTTAGCTTCCCTTATCAGGGTCAATTTGAGAA
TCGTGCTCAATTTGATGATAATGGCGTGCCTATAATGCCATTAATGCCCA
ATACGACTCAAACATCACCTGTCCCTACATTTCCACCCATTGATACATTC
AATGGATCTTCTTCCAATGGTTATATGAGGCCTGGATCTACTGGATATAA
TCCTAATCCTCGTCCTCCATTTCCAAATCGAGGTAATCAATGCGCTGCAA
TGACCGTGAAAGCTCGTTGGGGGTCACTAGGTTCCGGTCGTGGGGAAATG
AGTTCTCCTCACGGTTTCTGTTTAGGATTTTCCGAAGAAATAGTTGTTGC
TGATACTCAAAATCATCGTATTCAAATATTTACCAAAGATGGGCAATTTC
TAAGTCAATTTGGAGTTGCTGGTAGAGATGAAGGTCAGTTATGGTTTCCC
CGGAAAGTGGCTATAATTCGAAGTACTCAGCGATATGTTGTTTGCGATAG
GGGCAATGAACGATCTCGAATGCAAATATTTGGTCGCAGTGGCCATTTTT
TGAGGAAAATTTCAATTCGTTATATAGATATTGTTGCAGGATTAGCAGTG
AATAATATGGGTCACATAGTGGCTGTCGACAGTGTTTCTCCGTCCGTATT
TGTAGTATCTGAAGGAGGCGAATTAATCAAATGGTTTGATTGTAGTAGTT
GCATGCGTGAACCATCAGATATTGCAGTTCATGGTGATGAGTATTTTATT
TGTGATTTCAAGGGTCACTGCGTGTGTGTATTCAAGCAAGACGGTACTTT
TGTCCAGAGGTTTGGTAATGAAACAATTACAAATTTCCCTAACGGAATTG
ACGTGTCGGATCACGGTGACGTATTGATCGGTGATTCACACGGCAATCGT
TTTCATATAGCAGTTTATTCTCATGATGGCAAATTGATGAGTGAGTTTGA
ATGTCCATCTGTCAAGGTTAGTCGCGCGTGTGGTCTCAAAATCACCAGCG
AAGGATATTTGGTAACTCTAGCAAAAAATAATCACCATGTTTTAGTAATG
GATACTTTATATATTTCATAAGATGATTGGTAAAATGATACTCTTATCAG
GGTGGTTTGTTGTTTGCTCTAGAGAAGCAATCCCGATCTTGTTATGTTGA
ATGTTCTCGATTTCCATGCATTACAGATAACTAACTATTATTGTTTTATC
ATTATTGTCACCTATTTGCGCGCGCGTTACTTTTAACTACCACATGTAAA
ACATACATGAATTGATTTTGTGTATGCCCCCATCTCTGTTGTCCTAGCTC
GGGCTGATGGGCGCCAGCTACACTATCAAAATGCTGTCCATCGATATTTG
AACAGCTTAAATGAAATATTTCACGTTTGTATTAGAGAATATTATTATTA
TTTGTATGCGTTGAACATTTTTGTGGCTTTATTTTTCTATTTATTTTTTT
CTATTTTATTCTAATGTTTTTGAAAATATATTAAATATACTAAAAAAAAA
TTCGAGTCGTTATATTTCTTTTTATTGAGTATTGAGTGAATGGTACATAA
TTCGTGGCAGGAAATTGAATTGATTATAATTACCGCCGGTTGGGGTTTGG
AAATGTGAATCTCGATTATGATGATGCGTCGGCAGAGTTGTAGAAGCGAA
TGTGTGTACGCGTGTTTTGGTCGAAATAATAATGATAATACCAAAAAGTG
TGTAAATAAATTTGTATAATCAGGAGAAAGAAAATTACAAAACCAGCACC
TTAATTAATATCTGCATACTATGATGATATTAACTTTTATTTATGATAAA
TAGATGCAATAAGTGGTTAAGGTGCTAATTTGTCGTTTTGTTATTTTCCG
GTATTCACGAATTCGGATTTGTTGTATTTGTGTTTAGTAATTGTTGATTG
GTTAGGTGTTTTTCCATCTTATGTGATGCGTGTACATGTTTTGACATCAT
GTTAATATATTAAACTATTTCCTCCTTTAGAATGCAATATATATACACTT
ATTTAGTGGGGATTTTAATTTGTTAGAGAGCTCATGACATTTTTGTCTTT
TTGTTTTGTTACATGCGCGTCCAGAAAAAGGATTGTTGTGGATTTTTATA
CATATTCTAATAATTTTCTGTACAACACACTACTTGAACACATTTATACA
TATATACACCTATTTATATTATAGTAATTAGATTGTTATCATATTGTCAG
AGTTTTTTGCGCCAGAATGAATTGAAGTATGTTGTTTTTGTATCGCATTG
GTGTGACAACATTTTCTCGTAGTTAAAGCTTCATATTTCTTTAAACTATA
GCGAGAAATGAATGATGCGCTAGGAAGTTATTTTAATAAGTCGAATGCTG
GTTAGCAACTCGTGATTATTTTAACAGCATTTTATCTCACTTTAGCTATT
TTATATTTTAATTCCGATTATTATCATTATAAATGCCTCATTGGCTATTA
AATTAATGTTTTCTTAAGTATTTGTGTTTTCAATTTATTTGGTGTTTAAA
CAAGTTTAAGGTGAGCTTATCAGTTTTTTGTGTACGATTTATGAGGGCTT
ATTATGAGTAGTTATCTCCCTTTGGAGATGTATACTCAAATTGCTTCTGC
AAGTTCTATTTGTATTTTGATTTTTTTGCCAATCGTATTGTTCAATTATT
GAGTTTATTATAATAAATCTTTTGCATTTACAATTTGAATTTTATTCCAT
TACATTGC
back to top

protein sequence of SMED30029263-orf-1

>SMED30029263-orf-1 ID=SMED30029263-orf-1|Name=SMED30029263-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=833bp
MTDLDSTLIEDFTLEYAEGGSLENKQELPTICSQCKNSFSEPVVLNCLHI
FDRGCLSKFECTDSIFPVVTCPKCHMQSGSLSSLKPYITQYAIESKEINV
STIDFNDFKCVLCTSGEDSKYKCVDCAGLLCERCKILHKEVKFLNSHLEV
EELTDEDKTNIKLLKKHLADNKPVKCEVHCERKYTNYCIQCGMLACSRCL
LSDHADHSTVLLQDFPEKIRFRIGNYIENCIKAEEMNKIAIEKLNNALME
VNNSHDENKTHIEEVCNEWKTAIDDIKTEYLKKNKELHDDLEFRIMNGIN
RGEKYLEHIEYALEFTKSYLDKCSNVEFCKIIKVVLNCLTDLSEKQIDTD
VRTSIPFKENVSSITNVIRTNFGVFLNNEKANDKSSSVSSMIEFSGDLNN
CFNSLTINDIAAHDHFKQQSILQTTDQYKPPNLIIQSNNACSISNGNLNF
DVNPISPTNAYPLLSSSGHLDGLNSSSSLGDVVSFPYQGQFENRAQFDDN
GVPIMPLMPNTTQTSPVPTFPPIDTFNGSSSNGYMRPGSTGYNPNPRPPF
PNRGNQCAAMTVKARWGSLGSGRGEMSSPHGFCLGFSEEIVVADTQNHRI
QIFTKDGQFLSQFGVAGRDEGQLWFPRKVAIIRSTQRYVVCDRGNERSRM
QIFGRSGHFLRKISIRYIDIVAGLAVNNMGHIVAVDSVSPSVFVVSEGGE
LIKWFDCSSCMREPSDIAVHGDEYFICDFKGHCVCVFKQDGTFVQRFGNE
TITNFPNGIDVSDHGDVLIGDSHGNRFHIAVYSHDGKLMSEFECPSVKVS
RACGLKITSEGYLVTLAKNNHHVLVMDTLYIS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR000315Znf_B-box
IPR001841Znf_RING
IPR013083Znf_RING/FYVE/PHD
IPR001258NHL_repeat
IPR0110426-blade_b-propeller_TolB-like
IPR013017NHL_repeat_subgr
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001841Zinc finger, RING-typeSMARTSM00184ring_2coord: 32..74
e-value: 0.0016
score: 27.7
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 32..75
score: 9.834
IPR000315B-box-type zinc fingerSMARTSM00336bboxneu5coord: 171..212
e-value: 5.0E-5
score: 32.7
IPR000315B-box-type zinc fingerPFAMPF00643zf-B_boxcoord: 172..211
e-value: 9.0E-6
score: 25.7
IPR000315B-box-type zinc fingerPROSITEPS50119ZF_BBOXcoord: 171..212
score: 10.552
IPR000315B-box-type zinc fingerCDDcd00021BBOXcoord: 174..212
e-value: 2.09746E-5
score: 40.3484
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 22..97
e-value: 1.1E-6
score: 30.2
IPR011042Six-bladed beta-propeller, TolB-likeGENE3DG3DSA:2.120.10.30coord: 553..831
e-value: 8.5E-78
score: 263.4
IPR001258NHL repeatPFAMPF01436NHLcoord: 577..603
e-value: 7.1E-5
score: 22.6
NoneNo IPR availableGENE3DG3DSA:3.30.40.200coord: 105..214
e-value: 7.4E-10
score: 41.3
NoneNo IPR availablePANTHERPTHR25462:SF276MEIOTIC P26, ISOFORM Ccoord: 20..831
NoneNo IPR availablePANTHERPTHR25462FAMILY NOT NAMEDcoord: 20..831
NoneNo IPR availableCDDcd14959NHL_brat_likecoord: 560..829
e-value: 4.62263E-145
score: 426.301
NoneNo IPR availableSUPERFAMILYSSF101898NHL repeatcoord: 574..827
NoneNo IPR availableSUPERFAMILYSSF57845B-box zinc-binding domaincoord: 168..229
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 25..81
IPR013017NHL repeat, subgroupPROSITEPS51125NHLcoord: 567..606
score: 11.39
IPR013017NHL repeat, subgroupPROSITEPS51125NHLcoord: 723..740
score: 6.497
IPR013017NHL repeat, subgroupPROSITEPS51125NHLcoord: 741..783
score: 7.422
IPR013017NHL repeat, subgroupPROSITEPS51125NHLcoord: 673..698
score: 5.654
IPR013017NHL repeat, subgroupPROSITEPS51125NHLcoord: 610..656
score: 8.08