Sodium/myo-inositol cotransporter

Overview
NameSodium/myo-inositol cotransporter
Smed IDSMED30029255
Length (bp)2394
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Sodium/myo-inositol cotransporter (SMED30029255) t-SNE clustered cells

Violin plots show distribution of expression levels for Sodium/myo-inositol cotransporter (SMED30029255) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Sodium/myo-inositol cotransporter (SMED30029255) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Sodium/myo-inositol cotransporter (SMED30029255) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029255

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30029255h1SMcG0009705 Contig12849newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029255h1SMcG0009705 Contig12849uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30029255h1SMcG0009705 dd_Smed_v4_6415_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029255h1SMcG0009705 dd_Smed_v4_6415_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029255h1SMcG0009705 dd_Smed_v4_6415_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029255h1SMcG0009705 dd_Smed_v4_6415_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Human
Match: SLC5A3 (solute carrier family 5 member 3 [Source:HGNC Symbol;Acc:HGNC:11038])

HSP 1 Score: 625.165 bits (1611), Expect = 0.000e+0
Identity = 300/567 (52.91%), Postives = 422/567 (74.43%), Query Frame = 2
Query:  236 DISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTYW---NYWKQDSITPEDIIFSVPLREKSIV 1927
            DI+++ +YF+ ++  GF +M +SNR T+ GYFLAG+ M W+ +GASLF SNIGSEHFIGLAGSGAA G  VGA+E NA +LL LLGWVF+P++I SG YT+PEY+ KRFGG R+Q Y A +SL++YIFTK+SV+LYS +LFI E+L  N+++SV +L+ +T L+TVTGGL AV+YTDT Q ++M+IG++ L +IS  +IGG   +  +Y  A   V    L   L+++      P K+A +M R   D D+PW GFILGQTPAS+WYWC DQ++VQRVL+AKN++HAKG T+ AG LKLLP+FI+V+PGMISRILF D++AC   E C+ VC   +GCSN+AYP+LV+KL+P GLRGLM++VM+AAL+SDL SIFNSAST+FT+D+Y+LIR  A++RELMI+GR+FV  M+ +SI W+P+I  MQGGQ+++YIQ ++ YL+PP+AA +++AIFW R NE+GA    + G ++G VR+I+ F ++   C+Q D RP F +  H+MY A   F    ++ +++SLLT P  K     TT+W   N   +++ +P++  +   ++EKSI+
Sbjct:    9 DIAIVALYFILVMCIGFFAMWKSNRSTVSGYFLAGRSMTWVAIGASLFVSNIGSEHFIGLAGSGAASGFAVGAWEFNALLLLQLLGWVFIPIYIRSGVYTMPEYLSKRFGGHRIQVYFAALSLILYIFTKLSVDLYSGALFIQESLGWNLYVSVILLIGMTALLTVTGGLVAVIYTDTLQALLMIIGALTLMIISIMEIGGFEEVKRRYMLASPDVTSILLTYNLSNTNSCNVSPKKEALKMLRNPTDEDVPWPGFILGQTPASVWYWCADQVIVQRVLAAKNIAHAKGSTLMAGFLKLLPMFIIVVPGMISRILFTDDIACINPEHCMLVCGSRAGCSNIAYPRLVMKLVPVGLRGLMMAVMIAALMSDLDSIFNSASTIFTLDVYKLIRKSASSRELMIVGRIFVAFMVVISIAWVPIIVEMQGGQMYLYIQEVADYLTPPVAALFLLAIFWKRCNEQGAFYGGMAGFVLGAVRLILAFAYRAPECDQPDNRPGFIKDIHYMYVATGLFWVTGLITVIVSLLTPPPTKEQIRTTTFWSKKNLVVKENCSPKEEPYK--MQEKSIL 573          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Human
Match: SLC5A1 (solute carrier family 5 member 1 [Source:HGNC Symbol;Acc:HGNC:11036])

HSP 1 Score: 585.489 bits (1508), Expect = 0.000e+0
Identity = 313/644 (48.60%), Postives = 442/644 (68.63%), Query Frame = 2
Query:  236 DISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTL----HCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTYWNYWKQDSITPEDIIFSVPLREKSIVV-PKKEIDLELENVGGRHKCKMMLLRYWNKFLGISNTGETDSSVLPITEEQSESLFRKSILNRLYQRKRDRYILNV 2152
            DIS+IVIYFV ++A G  +M  +NR T+ G+FLAG+ M+W P+GASLFASNIGS HF+GLAG+GAA GI +G FE NA +L+ +LGW+F+P++I +G  T+PEY+ KRFGG+R+Q YL+++SL++YIFTKIS +++S ++FI  AL LN++L++ +LLA+T L T+TGGLAAV+YTDT Q +IM++GS+ILT  +F ++GG  A  EKY +AI        P I++         CY P   +F +FR     D+PW GFI G +  ++WYWCTDQ++VQR LSAKN+SH KGG I  G LKL+P+FIMVMPGMISRIL+ +++AC    +C + C    GC+N+AYP LV++L+P+GLRGLMLSVMLA+L+S LTSIFNSASTLFT+DIY  +R  A+ +ELMI GRLF+L++IG+SI W+P++Q+ Q GQLF YIQ+I+ YL PPIAA +++AIFW R NE GA   LI GL+IG  RMI +F +    C +    P      H++YFA+  F+   + ++VISLLT+P+P V   R      W   +   E I   +   E++I   PK+ I++E +      K K +  R ++ F G+   G        +TEE+ +++  K  +    ++   R +LNV
Sbjct:   28 DISIIVIYFVVVMAVGLWAMFSTNRGTVGGFFLAGRSMVWWPIGASLFASNIGSGHFVGLAGTGAASGIAIGGFEWNALVLVVVLGWLFVPIYIKAGVVTMPEYLRKRFGGQRIQVYLSLLSLLLYIFTKISADIFSGAIFINLALGLNLYLAIFLLLAITALYTITGGLAAVIYTDTLQTVIMLVGSLILTGFAFHEVGGYDAFMEKYMKAI--------PTIVSDGNTTFQEKCYTPRADSFHIFRDPLTGDLPWPGFIFGMSILTLWYWCTDQVIVQRCLSAKNMSHVKGGCILCGYLKLMPMFIMVMPGMISRILYTEKIACVVPSECEKYCGTKVGCTNIAYPTLVVELMPNGLRGLMLSVMLASLMSSLTSIFNSASTLFTMDIYAKVRKRASEKELMIAGRLFILVLIGISIAWVPIVQSAQSGQLFDYIQSITSYLGPPIAAVFLLAIFWKRVNEPGAFWGLILGLLIGISRMITEFAYGTGSCMEPSNCPTIICGVHYLYFAIILFAISFITIVVISLLTKPIPDVHLYRLC----WSLRNSKEERI--DLDAEEENIQEGPKETIEIETQV---PEKKKGIFRRAYDLFCGLEQHGAPK-----MTEEEEKAMKMK--MTDTSEKPLWRTVLNV 647          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Human
Match: SLC5A11 (solute carrier family 5 member 11 [Source:HGNC Symbol;Acc:HGNC:23091])

HSP 1 Score: 573.933 bits (1478), Expect = 0.000e+0
Identity = 300/598 (50.17%), Postives = 415/598 (69.40%), Query Frame = 2
Query:  218 KNIGPLDISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTYWNYWK---QDSITPEDIIFSVPLREKSI--VVPKKEIDLEL--ENVGGRHKCKM 1990
            K + P DI+V+V+YF+ ++A G  S  ++ RDT+KGYFLAG  M+W PVGASLFASN+GS HFIGLAGSGAA GI V A+ELN    + +L W+FLP++I     T+PEY+ KRFGG R+   LAV+ L +YIFTKISV++Y+ ++FI ++L L+++L++  LLA+T + TV GGLAAV+YTD  Q +IM+IG++ L   SFA +GG+  L EKY  A+A  N ++     NSS   C LP + AF +FR    +D+PW G + G +  S+WYWCTDQ++VQR L+AKNLSHAKGG + A  LK+LPLFIMV PGM+SRILFPD+VACA  E C ++C   SGCS++AYPKLV++LLP GLRGLM++VM+AAL+S LTSIFNSAST+FT+D++  +RP A+ +ELMI+GR+FVLL++ +SILW+PV+Q  QGGQLFIYIQ+IS YL PP+A  +++  FW R NEKGA   LI GL++G VR+++DF++ +  C+Q D RP   +  H++YF++   +   + +  +S  TEP  K      T++       Q    P     S+ L +  +        +  E+  EN    H C M
Sbjct:   22 KGLEPGDIAVLVLYFLFVLAVGLWSTVKTKRDTVKGYFLAGGDMVWWPVGASLFASNVGSGHFIGLAGSGAATGISVSAYELNGLFSVLMLAWIFLPIYIAGQVTTMPEYLRKRFGGIRIPIILAVLYLFIYIFTKISVDMYAGAIFIQQSLHLDLYLAIVGLLAITAVYTVAGGLAAVIYTDALQTLIMLIGALTLMGYSFAAVGGMEGLKEKYFLALAS-NRSE-----NSS---CGLPREDAFHIFRDPLTSDLPWPGVLFGMSIPSLWYWCTDQVIVQRTLAAKNLSHAKGGALMAAYLKVLPLFIMVFPGMVSRILFPDQVACADPEICQKICSNPSGCSDIAYPKLVLELLPTGLRGLMMAVMVAALMSSLTSIFNSASTIFTMDLWNHLRPRASEKELMIVGRVFVLLLVLVSILWIPVVQASQGGQLFIYIQSISSYLQPPVAVVFIMGCFWKRTNEKGAFWGLISGLLLGLVRLVLDFIYVQPRCDQPDERPVLVKSIHYLYFSMILSTVTLITVSTVSWFTEPPSKEMVSHLTWFTRHDPVVQKEQAPPAAPLSLTLSQNGMPEASSSSSVQFEMVQENTSKTHSCDM 610          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Human
Match: SLC5A11 (solute carrier family 5 member 11 [Source:HGNC Symbol;Acc:HGNC:23091])

HSP 1 Score: 573.933 bits (1478), Expect = 0.000e+0
Identity = 300/598 (50.17%), Postives = 415/598 (69.40%), Query Frame = 2
Query:  218 KNIGPLDISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTYWNYWK---QDSITPEDIIFSVPLREKSI--VVPKKEIDLEL--ENVGGRHKCKM 1990
            K + P DI+V+V+YF+ ++A G  S  ++ RDT+KGYFLAG  M+W PVGASLFASN+GS HFIGLAGSGAA GI V A+ELN    + +L W+FLP++I     T+PEY+ KRFGG R+   LAV+ L +YIFTKISV++Y+ ++FI ++L L+++L++  LLA+T + TV GGLAAV+YTD  Q +IM+IG++ L   SFA +GG+  L EKY  A+A  N ++     NSS   C LP + AF +FR    +D+PW G + G +  S+WYWCTDQ++VQR L+AKNLSHAKGG + A  LK+LPLFIMV PGM+SRILFPD+VACA  E C ++C   SGCS++AYPKLV++LLP GLRGLM++VM+AAL+S LTSIFNSAST+FT+D++  +RP A+ +ELMI+GR+FVLL++ +SILW+PV+Q  QGGQLFIYIQ+IS YL PP+A  +++  FW R NEKGA   LI GL++G VR+++DF++ +  C+Q D RP   +  H++YF++   +   + +  +S  TEP  K      T++       Q    P     S+ L +  +        +  E+  EN    H C M
Sbjct:   22 KGLEPGDIAVLVLYFLFVLAVGLWSTVKTKRDTVKGYFLAGGDMVWWPVGASLFASNVGSGHFIGLAGSGAATGISVSAYELNGLFSVLMLAWIFLPIYIAGQVTTMPEYLRKRFGGIRIPIILAVLYLFIYIFTKISVDMYAGAIFIQQSLHLDLYLAIVGLLAITAVYTVAGGLAAVIYTDALQTLIMLIGALTLMGYSFAAVGGMEGLKEKYFLALAS-NRSE-----NSS---CGLPREDAFHIFRDPLTSDLPWPGVLFGMSIPSLWYWCTDQVIVQRTLAAKNLSHAKGGALMAAYLKVLPLFIMVFPGMVSRILFPDQVACADPEICQKICSNPSGCSDIAYPKLVLELLPTGLRGLMMAVMVAALMSSLTSIFNSASTIFTMDLWNHLRPRASEKELMIVGRVFVLLLVLVSILWIPVVQASQGGQLFIYIQSISSYLQPPVAVVFIMGCFWKRTNEKGAFWGLISGLLLGLVRLVLDFIYVQPRCDQPDERPVLVKSIHYLYFSMILSTVTLITVSTVSWFTEPPSKEMVSHLTWFTRHDPVVQKEQAPPAAPLSLTLSQNGMPEASSSSSVQFEMVQENTSKTHSCDM 610          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Human
Match: SLC5A2 (solute carrier family 5 member 2 [Source:HGNC Symbol;Acc:HGNC:11037])

HSP 1 Score: 557.37 bits (1435), Expect = 0.000e+0
Identity = 281/540 (52.04%), Postives = 387/540 (71.67%), Query Frame = 2
Query:  230 PLDISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTY 1849
            P DI VI  YF+ +I  G  SMCR+NR T+ GYFLAG+ M+W PVGASLFASNIGS HF+GLAG+GAA G+ V  FE NA  ++ LLGW+F PV++ +G  T+P+Y+ KRFGG+R++ YL+V+SL +YIFTKISV+++S ++FI +AL  NI+ SV  LL +T + TVTGGLAA++YTDT Q  +++ G+ IL   +F ++GG S LF+KY  A   +  ++ PA+ N S+  CY P   ++ + R     D+PW   +LG T  S WYWC+DQ++VQR L+ K+L+H K G I  G LKL P+F+MVMPGMISRIL+PDEVAC   E C RVC    GCSN+AYP+LV+KL+P+GLRGLML+VMLAAL+S L SIFNS+STLFT+DIY  +RP A +REL+++GRL+V+ ++ +S+ WLPV+Q  QGGQLF YIQA+S YL+PP++A +V+A+F  R NE+GA   LI GL++G  R+I +F +    C Q    P F    H++YFA+  F    ++ + +SL T P+P+    R  +
Sbjct:   23 PADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGRSMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNALFVVLLLGWLFAPVYLTAGVITMPQYLRKRFGGRRIRLYLSVLSLFLYIFTKISVDMFSGAVFIQQALGWNIYASVIALLGITMIYTVTGGLAALMYTDTVQTFVILGGACILMGYAFHEVGGYSGLFDKYLGAATSLTVSEDPAVGNISSF-CYRPRPDSYHLLRHPVTGDLPWPALLLGLTIVSGWYWCSDQVIVQRCLAGKSLTHIKAGCILCGYLKLTPMFLMVMPGMISRILYPDEVACVVPEVCRRVCGTEVGCSNIAYPRLVVKLMPNGLRGLMLAVMLAALMSSLASIFNSSSTLFTMDIYTRLRPRAGDRELLLVGRLWVVFIVVVSVAWLPVVQAAQGGQLFDYIQAVSSYLAPPVSAVFVLALFVPRVNEQGAFWGLIGGLLMGLARLIPEFSFGSGSCVQPSACPAFLCGVHYLYFAIVLFFCSGLLTLTVSLCTAPIPRKHLHRLVF 561          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Celegans
Match: ZK822.5 (pep chromosome:WBcel235:IV:11937418:11940604:1 gene:WBGene00014092.1 transcript:ZK822.5a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZK822.5)

HSP 1 Score: 63.1586 bits (152), Expect = 5.895e-10
Identity = 88/382 (23.04%), Postives = 162/382 (42.41%), Query Frame = 2
Query:  299 RSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKG--------IGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGG---KRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIG--SIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWY--WCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYR 1399
            R +R   + Y + G+ +  LPV  SL  + +     +G+      +G        IGV +  +          +VFLPVF    +  L EY   R+     +R+   L ++  ++Y+    SV LY+ S+ +   L++N W  V +    T L T  GGL AV++TD+ Q +IM  G  ++I   +S  ++GG+  +      +  R++E                      +M   +D  +  W+    G     +W   +  +Q+ +QR  S  +L  A+   I+      +   I+   G I+   F +     T E       + S    +++ + +++  P GL GL +S +++A +S L+S  NS +     D  +
Sbjct:   39 RGDRTAKEEYLMGGRQLPPLPVALSLLTTFLSGILMLGVPAEMFQRGAQIWLNFVIGVASSIVTC--------FVFLPVFHKMKSTCLHEYFIHRYNSILIRRLFSLLFLLFTIVYM----SVVLYAPSVALSPVLQINKWYLVLIFGCTTTLYTCLGGLKAVVWTDSLQAVIMYTGVFTLIYKGLSHPRVGGLERVLSIAWDS-GRISELG--------------------RMDWRIDQYNSLWINLFSGTI---VWLASFGVNQLAIQRYASLPSLKVAQSIIIYTLAPFTVLCSIVAFVGFIALAYFYNCNPLETGE------VKESDHITISFARDILQPTP-GLFGLYVSCIMSATLSTLSSGMNSMAAAIYEDFLK 377          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Celegans
Match: ZK822.5 (pep chromosome:WBcel235:IV:11937384:11940604:1 gene:WBGene00014092.1 transcript:ZK822.5a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZK822.5)

HSP 1 Score: 63.1586 bits (152), Expect = 5.895e-10
Identity = 88/382 (23.04%), Postives = 162/382 (42.41%), Query Frame = 2
Query:  299 RSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKG--------IGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGG---KRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIG--SIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWY--WCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYR 1399
            R +R   + Y + G+ +  LPV  SL  + +     +G+      +G        IGV +  +          +VFLPVF    +  L EY   R+     +R+   L ++  ++Y+    SV LY+ S+ +   L++N W  V +    T L T  GGL AV++TD+ Q +IM  G  ++I   +S  ++GG+  +      +  R++E                      +M   +D  +  W+    G     +W   +  +Q+ +QR  S  +L  A+   I+      +   I+   G I+   F +     T E       + S    +++ + +++  P GL GL +S +++A +S L+S  NS +     D  +
Sbjct:   39 RGDRTAKEEYLMGGRQLPPLPVALSLLTTFLSGILMLGVPAEMFQRGAQIWLNFVIGVASSIVTC--------FVFLPVFHKMKSTCLHEYFIHRYNSILIRRLFSLLFLLFTIVYM----SVVLYAPSVALSPVLQINKWYLVLIFGCTTTLYTCLGGLKAVVWTDSLQAVIMYTGVFTLIYKGLSHPRVGGLERVLSIAWDS-GRISELG--------------------RMDWRIDQYNSLWINLFSGTI---VWLASFGVNQLAIQRYASLPSLKVAQSIIIYTLAPFTVLCSIVAFVGFIALAYFYNCNPLETGE------VKESDHITISFARDILQPTP-GLFGLYVSCIMSATLSTLSSGMNSMAAAIYEDFLK 377          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Celegans
Match: cho-1 (High-affinity choline transporter 1 [Source:UniProtKB/Swiss-Prot;Acc:O02228])

HSP 1 Score: 50.447 bits (119), Expect = 4.743e-6
Identity = 73/337 (21.66%), Postives = 137/337 (40.65%), Query Frame = 2
Query:  536 LPEYMHKRFGGKRVQCYLAVVSLMMYIF-TKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTD---------QMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRL-IRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQG 1513
            L  + HK   G+R+   + V +L+   F T   ++   A+L +   +++N  +++   +A+    T TGG  AV YTD  Q   + +G                                          L   +P+       + +  N   W+G I G    S+W  C           Q+  QRVLS+K    A+  +  AG+  +L      + G I+R         +   +  +V        N+  P +   L P  +  + L  + AA++S   S   SA+++F  +I++L IRP A+ +E++I+ R+ ++ +  ++ +    IQ++ G
Sbjct:  116 LDPFQHKY--GQRIGGLMYVPALLGETFWTAAILSALGATLSVILGIDMNASVTLSACIAV--FYTFTGGYYAVAYTDVVQLFCIFVG------------------------------------------LWVCVPAAMVHDGAKDISRNAGDWIGEIGGFKETSLWIDCMLLLVFGGIPWQVYFQRVLSSKTAHGAQTLSFVAGVGCILMAIPPALIGAIARNTDWRMTDYSPWNNGTKVESIPPDKRNMVVPLVFQYLTPRWVAFIGLGAVSAAVMSSADSSVLSAASMFAHNIWKLTIRPHASEKEVIIVMRIAIICVGIMATIMALTIQSIYG 406          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Celegans
Match: ZK822.5 (pep chromosome:WBcel235:IV:11938574:11940604:1 gene:WBGene00014092.1 transcript:ZK822.5b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZK822.5)

HSP 1 Score: 49.6766 bits (117), Expect = 7.431e-6
Identity = 61/262 (23.28%), Postives = 114/262 (43.51%), Query Frame = 2
Query:  626 ISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIG--SIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWY--WCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYR 1399
            +SV LY+ S+ +   L++N W  V +    T L T  GGL AV++TD+ Q +IM  G  ++I   +S  ++GG+  +      +  R++E                      +M   +D  +  W+    G     +W   +  +Q+ +QR  S  +L  A+   I+      +   I+   G I+   F +     T E       + S    +++ + +++  P GL GL +S +++A +S L+S  NS +     D  +
Sbjct:    1 MSVVLYAPSVALSPVLQINKWYLVLIFGCTTTLYTCLGGLKAVVWTDSLQAVIMYTGVFTLIYKGLSHPRVGGLERVLSIAWDS-GRISELG--------------------RMDWRIDQYNSLWINLFSGTI---VWLASFGVNQLAIQRYASLPSLKVAQSIIIYTLAPFTVLCSIVAFVGFIALAYFYNCNPLETGE------VKESDHITISFARDILQPTP-GLFGLYVSCIMSATLSTLSSGMNSMAAAIYEDFLK 231          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Fly
Match: CG10444 (gene:FBgn0034494 transcript:FBtr0086305)

HSP 1 Score: 80.8777 bits (198), Expect = 2.047e-15
Identity = 108/463 (23.33%), Postives = 199/463 (42.98%), Query Frame = 2
Query:  305 NRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFG-GKRVQCYLA-VVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMIS-RILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPD--GLRGLMLSVMLAALVSDLTSIFNSASTLFTVD----IYRLI--RPVANNRELM---IIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLII 1651
             + T + Y +A Q M   PV  SL AS + +   +G++      G       +   +   +  + FLPVF      ++ EY+ +RFG   R+   LA  V +++Y+     + LY+ +L +     ++  +++ V+  +    +  GGL AVL TD FQ  +M      +  +S  K GG +A+++   +   RVN  +    L+ +  H                     W   I+G     +  +  +Q  VQR+LS +NL  A+     + +   LP+      GM+S   +F          DC  + +      +   P   ++ +    GL GL +S + +A +S ++S   S S +   D    +Y+ I  R + +++  M   I+  +F LL IGL+      +    GG L   +  I G +  P+ A + + +  +R N++G +   +  LI+
Sbjct:   34 KQKTTQEYLMADQSMTTFPVSFSLMASFMSAISLMGVSNESYEFGTIFCVINIAYVLSTPIAAYFFLPVFYRMRTTSVYEYLERRFGQATRLSASLAFTVQMVLYM----GIALYAPALALEAVTGIHRSMAIVVIGLVCTFYSTLGGLKAVLITDVFQSFLMFAAIYAVIAVSAIKAGGFAAIWDVAVER-GRVNFIEFS--LDPTVRHT--------------------WWSLIIGGMVTYLSLYGVNQTQVQRLLSVRNLKSAQ-----SALWWNLPIL-----GMLSFSTIFSGLSIFYYYRDCDPLLKGRIDKRDQIMPLFALETMGQYPGLCGLFVSGIFSASLSTISSAVTSLSAVTLEDYLKPLYKAIFKRTLIDSKSTMPTKIVACIFGLLCIGLAF-----VAGSMGGVLQASL-TIFGVVGGPLLAIFTLGVCTTRSNQRGVLLGFLVSLIV 453          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Fly
Match: Smvt (gene:FBgn0039873 transcript:FBtr0085860)

HSP 1 Score: 71.633 bits (174), Expect = 1.549e-12
Identity = 97/410 (23.66%), Postives = 174/410 (42.44%), Query Frame = 2
Query:  308 RDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGK-RVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPD------GLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRE--LMIIGRLFVLLMIGLSILWLPVIQNMQ 1510
             DT + Y + G+ M  +P+  SL AS + +   + +     A GI      +   +++ LL ++ +PVF N+      EY+  RF  K RV   L     ++ +F  + + ++  SL   +    N+ L   V+ ++    T+ GG+ AV++TD  Q  IMV   +++ V+   ++GG   +    G+   R++      +   ST+     S              M W G++             +Q  VQR++S  +L HA+   +  G   +L +F     G++    F          DC  +  Q+   S +   K+V   + D      G+ G+ +S + +A +S L++  NS   L  V  +  I+P   + E    +I +LFV       IL   VI+N  
Sbjct:   53 EDTTEEYLMGGKRMKTIPIAISLVASQLSAISIMTIPAEMYAYGINWVFNVVCMVLVVPLLNYLVIPVFYNNNITNCYEYLEMRFCRKVRV---LQTFIFILTMFFMLPIFIFLPSLAFAQVTGFNVHLINTVVCSICVFYTMFGGIKAVVWTDVIQAAIMVASVVLVGVLGAHRVGGFFEVLRIAGEG-GRLDINYNFDLTTRSTIWNIFTSAT------------MMWTGYV-----------GLNQSCVQRIVSLPSLGHARRSLVLFGFGFILIMFFNCFTGIVIYSRF---------HDCDPI--QSGHVSKV--DKMVPYFVQDTVGNLWGMPGVFISCVFSAALSTLSASINS---LGGVVYFDYIKPHIRHTEHRANVIMKLFVFFTGIYCILGGMVIENFN 419          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Fly
Match: CG42235 (gene:FBgn0250757 transcript:FBtr0290141)

HSP 1 Score: 69.707 bits (169), Expect = 7.388e-12
Identity = 108/460 (23.48%), Postives = 194/460 (42.17%), Query Frame = 2
Query:  326 YFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTK-----ISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFA-KIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDN-DMPWLGFILGQTPASIWYWCTDQMMVQRVLS---AKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPD--GLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVA----NNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGG 1657
            Y + G+ M   PV  SL AS +     +G +      G       +  +I   +  ++FLPVF N    +  EY   RF  K V+       L    FT      + + +Y  +L   +   +NI +   ++  +    T  GGL AV++TD  Q +IM IG++I  +I     +GG+  + ++   +  R+   +                         LD    M  L  ++G    + + +  +QMM+QR +S    K ++H    T F  I+ L+ LF        S  L+   +  AT  DC  +  + +   +   P LV++ +    G+ G+ ++ + +A +S L++  NS S +F  D    I+P+A       +  +  RL  +++  +S+  + V++ M    L + I AI   +  P+   + + +     N K AIT  I+G    G
Sbjct:  158 YLVGGRQMKVFPVALSLVASFVSGISLLGTSTEIYVYGTQYAFILVTLAISGAISWYIFLPVFCNLQLTSTYEYFEMRFN-KSVRL------LGSAFFTGANLIWLPIVIYVPALAFNQVTGINIHVITPIVCLVCIFYTTAGGLKAVVWTDVIQTVIM-IGAVIFVIIKGTLDVGGLGVVIQRNFDS-GRIEWPEF-----------------------TLDPKVRMSMLALMVGCVGHNCYQFGCNQMMIQRYMSLPGVKQMAH----TSFIFIVGLVLLF--------SLCLYNGLLLFATYYDCDPLTTKLAVAKDQLVPLLVVQSMSSFPGIAGMFVAGVFSAALSSLSTGMNSLSAVFLED---YIKPLAKKPLTEHQTGVTVRLCTVIIGIISVALVFVVERMSSHVLQLGI-AIGSVVQGPLLGLFSMGLLCPSINSKSAITGSIFGFFFMG 569          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Fly
Match: CG42235 (gene:FBgn0250757 transcript:FBtr0290137)

HSP 1 Score: 65.4698 bits (158), Expect = 1.619e-10
Identity = 84/363 (23.14%), Postives = 155/363 (42.70%), Query Frame = 2
Query:  326 YFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGG--KRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFA-KIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPD--GLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYR 1399
            Y + G+ M   PV  SL AS +     +G +      G       +  +I   +  ++FLPVF N    +  EY   R+G   + +   L +V  M+++     V LY  ++   +     I +   ++  +    T  GGL AV++TD  Q  +M  GSI+   +     +GG+  + ++  +   R+N  +L           + P+ +            +  L  ILG T   I     +Q+ +QR LS  +  HAK         + + +F +++  ++S   +   V+ A   DC  +  + +   +     L+++ L    GL GL +S + +A +S L++  NS + + T DI R
Sbjct:  158 YLVGGRQMKVFPVALSLVASFVSGISLLGTSTEIYVYGTQYAFILVTLAISGAISWYIFLPVFCNLQLTSTYEYFQLRYGAGIRNLGSVLFIVGTMLWL----PVALYVPAITYNQVTGTGIHVITPIVCTICTFYTCVGGLKAVVWTDVIQSFVM-FGSILAVCVKGTFDVGGLGVVLQR-NEDGGRLNAPEL----------TWDPTVR------------LSMLSVILGGTLHKIQSSDVNQVSIQRFLSLPSYEHAK---------RCMLVFTVLLIFLLSCCSYMGLVSYAVYHDCDPISTKLAAAVDQLPSLLMMRTLGSLPGLPGLFVSGVFSAALSSLSTGLNSLACVITQDIVR 483          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Fly
Match: CG6723 (gene:FBgn0037895 transcript:FBtr0082405)

HSP 1 Score: 62.003 bits (149), Expect = 1.510e-9
Identity = 91/400 (22.75%), Postives = 172/400 (43.00%), Query Frame = 2
Query:  230 PLDISVIVIYFVCL---IATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAK-IGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYW----CTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPD--GLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYR 1399
            P  ++ + ++ +C+   I  GF++   S  D    Y L G+ M+ +P+  SL AS +     +GL     + GI           +  ++G  +LPVF +    +  EY+  RF  +R++ Y +V+  +M +   + + +Y  +L   +   + +     ++  +    T  GGL AV++TD  Q I M +G++ L  I   + IGG   + E+   +  R+    L   ++ +  H +                   W  F  G     I YW       Q M+QR LS  +L  A+       I  +  L +M + G    +++      AT ++C  +  + +   +   P  V+K L +  G+ GL ++ + +A +S L++  NS S +   D  +
Sbjct:   17 PDYVAFVSMFLLCIGIGIYFGFMNKSVSEDD----YMLGGRKMLVIPIAFSLVASFVSGITLLGLPTEVYSYGIQYLYVSCGVIGMGVVMGVFYLPVFHDLNITSTYEYLEVRFD-RRLRLYGSVMFAIMNV-AYLPIVIYVPALAFNQVTGIGVHTITPIVCIICVFYTSLGGLKAVVWTDVVQAISM-LGALCLVAIKGTRDIGGAGVVLER-AWSSDRLEAPDLS--IDPTVRHTF-------------------WCLFFGG-----IVYWTQTNAVSQNMIQRYLSLPSLGDARKALC---IFCVGVLILMALCGYNGLLIY------ATYQNCDPLTTKLAKARDQLLPLFVMKTLGELPGMTGLFIAGVFSAALSSLSTCLNSMSAVVLEDFVK 373          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Zebrafish
Match: slc5a3b (solute carrier family 5 member 3b [Source:ZFIN;Acc:ZDB-GENE-070912-43])

HSP 1 Score: 612.453 bits (1578), Expect = 0.000e+0
Identity = 293/550 (53.27%), Postives = 414/550 (75.27%), Query Frame = 2
Query:  236 DISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSS------TLHCYL-PSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTYWNYWK 1864
            DI+V+ +YFV ++  G ++M ++N  T+ GYFLAG+ M W  +GASLF SNIGSEHFIGLAGSGAA G  V A+E NA +LL LLGWVF+PV+I+SG YT+PEY+ KR+GGKR++ Y A +SL++YIFTK+SV+LY+ +LFI E+L  N++LS+ +L+++T L+TVTGGL AV+YTDT Q ++M+ G++ LT+IS  K+GG+  + EKY +A+  V      AIL SS      T  C + P   + ++ R   D D+PW GF+LGQTP+SIWYWC DQ++VQRVL+AKN++HAKG T+ AG+LK+LP+FI+V+PGMISRILFPDE+AC   E C+ VC   +GCSN+AYP+LV+ ++P GLRGLM++VM+AAL+SDL SIFNSAST+FT+DIY+++R  A++REL++IGR+FV+ M+ +SI W+PVI  MQGGQ+++YIQ ++GYL+PPIAA +++ +FW R NE GA    + G ++G  R+++ F+++E  C+Q D RP F  + H+MY A   F    +V +V+SL T P  +   +RTT W   K
Sbjct:    5 DITVVALYFVLVLVIGLLAMWKANHSTVSGYFLAGRTMNWAVIGASLFVSNIGSEHFIGLAGSGAASGFAVAAWEFNALLLLQLLGWVFIPVYIHSGVYTMPEYLSKRYGGKRLKIYFAGLSLLLYIFTKLSVDLYAGALFIQESLGWNLYLSIILLISMTALLTVTGGLVAVIYTDTLQAVLMIGGALTLTIISLIKVGGLEGVREKYMEAVPNVT-----AILASSNFSFEYTNSCRIYPKPDSLKLLRGPLDEDIPWPGFLLGQTPSSIWYWCADQVIVQRVLAAKNIAHAKGSTLMAGVLKILPMFIIVIPGMISRILFPDELACIGPEHCMAVCGSQAGCSNIAYPRLVMSVMPVGLRGLMMAVMIAALMSDLDSIFNSASTIFTLDIYKMLRARASSRELVVIGRIFVIFMVAISIAWVPVIIEMQGGQMYLYIQEVAGYLTPPIAALFLLGVFWKRCNEIGAFCGGMTGFVLGTTRLLLGFIYREPKCDQPDERPAFITRIHYMYIAAGLFWISGLVAVVVSLCTTPPDEERIKRTTMWGLRK 549          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Zebrafish
Match: slc5a3a (solute carrier family 5 member 3a [Source:ZFIN;Acc:ZDB-GENE-090312-3])

HSP 1 Score: 606.29 bits (1562), Expect = 0.000e+0
Identity = 299/560 (53.39%), Postives = 408/560 (72.86%), Query Frame = 2
Query:  212 MLKNIGPLDISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYL-PSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTYWNYWKQDSITPED 1888
            M   +   DI V+ +YFV ++  GF SM R+NR T+ GYFLAG+ M W  +GASLF SNIGSEHFIGLAGSGAA G+ VGA+E NA +LL LLGWVF+PV+I+SG YT+PEY+ KRFGG R++ Y A ++L++YIFTK+SV+LYS +LFI E+L  N++LS+ +L+ LT L+TVTGGL AV+YTDT Q  +M+ G++ L  IS  K+GG+  L  KY  A+  +    L   L  S   C++ P   +F++ R   D D+PW  F+LGQTPASIWYWC DQ++VQRVL+A+N++HAKG T+ AG+LK+LP+FI+V+PGMISR+LF DE+AC   E C++VC   +GC+N AYP+LV+ ++P GLRGLM++VMLAAL+SDL SIFNSAST+FT+DIY++IR  A+++ELM++GRLFV+L++ +SI W+P +  MQGGQ+F+YIQ +S YL+PPIAA +++ + W R NE GA      GLI+G VR+I+ FV++E  C+  D RP F +  HFMY A   F     VM+V+SL T P  K    +TT W    ++   P D
Sbjct:    1 MASTMEAADIIVVAMYFVLVLCFGFFSMWRANRGTVSGYFLAGRSMNWFVIGASLFVSNIGSEHFIGLAGSGAASGLAVGAWEFNAILLLQLLGWVFIPVYIHSGVYTMPEYLSKRFGGNRLKIYFASLTLLLYIFTKLSVDLYSGALFIQESLGWNLYLSIILLITLTALLTVTGGLVAVIYTDTLQAFLMISGALCLMAISLVKVGGLEGLRTKYMNALPNITFITLENNLTYSN-SCHVNPKADSFKLLRSPLDKDLPWPAFLLGQTPASIWYWCADQVIVQRVLAARNIAHAKGSTLLAGVLKVLPMFIIVIPGMISRVLFADELACIGPEHCMQVCNSRAGCTNTAYPRLVMNIMPVGLRGLMMAVMLAALMSDLDSIFNSASTIFTLDIYKMIRHQASSKELMVVGRLFVVLIVAISIAWVPFVIEMQGGQMFLYIQEVSDYLTPPIAALFLLGVLWKRCNETGAFWGGFVGLILGIVRLILAFVYREPDCDSVDDRPAFIKDVHFMYVAAVLFWVSGFVMVVVSLCTNPPSKEQISKTTLWGLRNRNQ--PAD 557          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Zebrafish
Match: slc5a1 (solute carrier family 5 member 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1524])

HSP 1 Score: 568.926 bits (1465), Expect = 0.000e+0
Identity = 307/632 (48.58%), Postives = 420/632 (66.46%), Query Frame = 2
Query:  230 PLDISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTYWNYWKQDSITPEDIIFSVPLREKSIVVPKKEIDLELENVGGRHKCKMMLLRYWNKFLGISN------TGETDSSV-LPITEEQSESLFRKSI 2104
            P DISVIVIYF+ ++A G  +M R+NR T+ G+FLAG+ M+W P+GASLFASNIGS HF+G+AG+GAA GI +G FE NA +++ +LGW+F+P++I +G  T+PEY+ KRFGG+R++ YL+V+SL +Y+FTKIS ++++ ++FI +AL LNI+L+V +LL +T L TVTGGLAAV+YTDT Q IIMV+GS IL   +F K+GG     + Y  AI  V  T +       +  CY P   +F +FR   + D+PW G + G T  + WYWCTDQ++VQR LSAKNLSH K G I  G LKLLP+F+MV PGMISR+L+PDE+AC   ++C  VC    GC+N+AYPKLV+ L+P+GLRGLMLSVMLA+L+S LTSIFNSASTLFT+DIY  IRP A  +ELMI GRLF+LL+IG+SI W+P++Q  Q GQLF YIQ+I+ YL+PPIAA + +AIF  R NE GA   L  GL++G  RMI +F +    C      P      H++YFAL  F   C++++ ISL+T+P+     ++  Y   W   + T E I        +       E D   E  G    CK    + +N F G         T E ++ + + +T+   + L+R  +
Sbjct:   46 PADISVIVIYFLVVLAVGVWAMVRTNRATVGGFFLAGRSMVWWPIGASLFASNIGSGHFVGIAGTGAAAGIAIGGFEWNALVVVIILGWLFVPIYIKAGVVTMPEYLKKRFGGQRIRIYLSVLSLCLYVFTKISADMFAGAIFINQALGLNIYLAVVILLLITALYTVTGGLAAVIYTDTLQTIIMVVGSFILMGFAFNKVGGYENFRDSYMTAIPSVIGTNI-------SESCYTPRADSFHIFRDPINGDLPWPGLLFGLTIQAGWYWCTDQVIVQRCLSAKNLSHVKAGCILCGYLKLLPMFLMVFPGMISRVLYPDEIACVDPDECKAVCGAEVGCTNIAYPKLVVDLMPNGLRGLMLSVMLASLMSSLTSIFNSASTLFTMDIYTKIRPKAKEKELMIAGRLFMLLLIGISIAWIPIVQTAQSGQLFDYIQSITSYLAPPIAAVFALAIFCKRVNEPGAFYGLCVGLLVGLARMITEFAYGTGSCVNPSNCPTIICGVHYLYFALILFGLSCILILSISLMTKPI----EDKHLYRLCWSLRNNTEERIDLEADDWTEDQDSNSMETDEMREEPGC---CK----KAYNWFCGFDQGNAPKLTKEQEAELKMKLTDTTEKPLWRNVV 659          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Zebrafish
Match: slc5a2 (solute carrier family 5 member 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2498])

HSP 1 Score: 561.607 bits (1446), Expect = 0.000e+0
Identity = 272/538 (50.56%), Postives = 377/538 (70.07%), Query Frame = 2
Query:  236 DISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTY 1849
            DISVI+IYF+ +IA G  S  R+NR T+ GYFLAG+ M+W PVG SLFASNIGS HF+GLAG+ AA GI VG FE NA  ++ LLGWVF+PV++ +G  T+P+Y+ KRFGG R+  YL+++SL +YIFTKISV+++S ++FI +AL  NI+++V  LL +T L TVTGGLAA++YTDT Q  +++ G+ +L   SF ++GG SAL EKY  ++     +  P   N S  HCY+P + AF + R     D+PW G I G      WYWCTDQ++VQR L+A++L+H K G I  G LKLLP+F+MV PGMISR+L+PD+V C     C +VC    GCSN+AYPKLV+ ++P GLRGLML+VMLAAL+S L SIFNS+STLFT+DI+  IRP A ++ELM++GR+++L ++G+SI W+PV+Q  Q GQLF YIQ+++ YL+PPIAA + +AIF  R NE GA   L+ GL++G  RM+ +FV+    C +    P      H++YFA+  F    ++++ +S  T P+      R  +
Sbjct:   16 DISVIIIYFLVVIAVGIWSTFRTNRGTVGGYFLAGRTMVWWPVGTSLFASNIGSGHFVGLAGTAAASGIAVGGFEWNALFIVLLLGWVFVPVYLTAGVITMPQYLKKRFGGSRISLYLSIISLFLYIFTKISVDMFSGAVFIQQALGWNIYVAVIALLCITALYTVTGGLAALMYTDTVQTFVIIAGAFVLMGFSFYEVGGYSALLEKYNSSLPSQTLSLNPNEYNISQ-HCYMPREDAFHLLRDPTTGDLPWPGVIFGIAIIGSWYWCTDQVIVQRCLAARSLTHVKAGCILCGYLKLLPMFLMVFPGMISRVLYPDDVGCVEKSVCNKVCGTEVGCSNIAYPKLVVSVMPTGLRGLMLAVMLAALMSSLASIFNSSSTLFTMDIWTRIRPQARDKELMVVGRVWILCIVGISICWIPVVQAAQSGQLFDYIQSVTSYLAPPIAAVFFLAIFVKRVNESGAFWGLMGGLVMGLCRMVPEFVFGSGSCLKPSNCPKVICGVHYLYFAILLFFCTAILVLFVSYNTPPIKDKHLHRLVF 552          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Zebrafish
Match: slc5a9 (solute carrier family 5 member 9 [Source:NCBI gene;Acc:564815])

HSP 1 Score: 550.436 bits (1417), Expect = 0.000e+0
Identity = 291/625 (46.56%), Postives = 415/625 (66.40%), Query Frame = 2
Query:  281 GFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTYWN-YWKQDSITPEDIIFSVPLREKSIVVPKKEIDLELENVGGRHKCKMMLLRYWNKFLGISNTGETDSSVLPITEEQSESLFRKSILNRLYQRKRDRYILNV 2152
            G  S  R+NR T+ GYFLAG+ M W P+GASL +SN+GS  FIGLAG+GAA G+ VG FE NA+ +L  LGW+F+PV+I++G  T+PEY+ KRFGG+R++ Y++V+SL++YI TKIS +++S +LFI  +L  +++LS  +LLA+T L T+ GGL AV+YTD  Q +IMVIG+ +L  I+F K+G    L  +Y        E   PA+   +T  C+LP   AF +FR     D+PW G I G T  + W WCTDQ++VQR LSAKNLSHAK G++  G LK+ P+F +VMPGMISR L+PDEVAC   ++C ++C    GCSN+AYPKLV++L+P G+RGLM++VM+AAL+S LTSIFNS+STLFT+DI++ IRP A+ +ELM++GR+F+LL++ LSI+W+PVIQ    GQLF YIQAI+ +LSPPI   +++AIFW R NE+GA   L+ GL++G VRMIM+FV+    C +TD RP   +  H++YFAL   +   +++  +SL T P+P+    R T+W  + K++ +  ED     P  +     P        E+ G          R      G+S T + D     +TEE+ ++L +K  L  + +    + + NV
Sbjct:   42 GIWSSIRANRGTVGGYFLAGRSMTWWPIGASLMSSNVGSGLFIGLAGTGAAGGLAVGGFEWNAAWVLIALGWIFVPVYISAGVVTMPEYLRKRFGGQRIRIYMSVLSLILYILTKISTDIFSGALFIQVSLGWDLYLSTVILLAVTALYTIAGGLTAVIYTDALQTVIMVIGAFVLMFIAFDKVGWYEGLLVQY--------EKAAPALTVPNT-TCHLPRSDAFHIFRDPVTGDIPWPGLIFGLTVLATWVWCTDQVIVQRSLSAKNLSHAKAGSVLGGYLKVFPMFFVVMPGMISRALYPDEVACVDPDECQKICGAKVGCSNIAYPKLVVELMPVGMRGLMIAVMMAALMSSLTSIFNSSSTLFTMDIWQRIRPRASEKELMVVGRVFILLLVALSIVWIPVIQTANSGQLFDYIQAITSFLSPPITTVFIMAIFWGRVNEQGAFWGLMVGLVVGMVRMIMEFVYGTPSCGETDLRPSLLKDVHYLYFALILLALTVLIITAVSLCTAPIPEKHLVRLTWWTRHSKEERVELED-----PWAK-----PAGSDLSTTESEGSDEDAPAWWKRAGMWLCGLSQTTKQD-----LTEEERQALEKK--LTSIEEDHMWKTVCNV 640          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Xenopus
Match: SLC5A11 (solute carrier family 5 (sodium/inositol cotransporter), member 11 [Source:NCBI gene;Acc:100488766])

HSP 1 Score: 592.808 bits (1527), Expect = 0.000e+0
Identity = 292/566 (51.59%), Postives = 408/566 (72.08%), Query Frame = 2
Query:  218 KNIGPLDISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTYWNYWKQDSITPEDIIFSVPLRE 1915
            K++  +DI V+V+YFV ++  G  S+CR+ R T+KGYFLAG+ M W PVGASLFASN+GS HFIGLAGSGAA GI V A+E N    +  L W+FLP++I++G  T+PEY+ +RFGGKR+Q +LA++ L +YIFTKISV++Y+ +LFI +AL+ +++++V  LL +T + TV GGLAAV+YTDT Q +IM+IG++IL   SF +IGG  AL EKY QAI   +         S    C +P + AF +FR    +D+PW G ++G T  S+WYWCTDQ++VQR LSAKNLSHAKGG++ A  LK+LPLF+MV+PGMISR+LF D+VACA  E C  +C   SGCS++AYPK+VI+LLP GLRGLM+SVM+AAL+S LTSIFNSAST+FT+D++R IRP +   ELMI+GR+FVL ++ +SILW+P++Q  QGGQLFIYIQ+IS YL PP+A  ++   FW R NEKGA   +  GL +G +RM++DF++    C+Q DTRP   +  H++Y ++       +V++ +S+ TEP  K    R T+++ +  + + P +   + P + 
Sbjct:   21 KSLETVDIVVLVLYFVFVLGVGLWSICRTKRGTVKGYFLAGKDMAWWPVGASLFASNVGSGHFIGLAGSGAASGIAVTAYEWNGLFCVLALAWLFLPIYISAGVTTMPEYLQRRFGGKRIQIFLAILYLFIYIFTKISVDMYAGALFIQQALQWDLYVAVIGLLVITAIYTVAGGLAAVIYTDTLQTVIMIIGALILMAYSFIEIGGFEALQEKYFQAIPNTH---------SGNSTCGIPREDAFHIFRDPVTSDLPWPGVLVGMTIPSLWYWCTDQVIVQRSLSAKNLSHAKGGSLLAASLKVLPLFMMVLPGMISRVLFTDQVACADPELCKEICGNPSGCSDIAYPKMVIELLPTGLRGLMMSVMIAALMSSLTSIFNSASTIFTMDLWRHIRPRSTEWELMIVGRVFVLALVVVSILWIPLVQASQGGQLFIYIQSISSYLQPPVAVVFIAGCFWKRTNEKGAFWGMTIGLAVGLIRMVLDFIYVAPQCDQPDTRPGVVKYVHYLYLSMILGLLTLIVVVAVSIWTEPPSKQMISRLTWFSRFDTEVVGPVETTDNSPAQN 577          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Xenopus
Match: SLC5A11 (solute carrier family 5 (sodium/inositol cotransporter), member 11 [Source:NCBI gene;Acc:100488766])

HSP 1 Score: 589.341 bits (1518), Expect = 0.000e+0
Identity = 284/544 (52.21%), Postives = 393/544 (72.24%), Query Frame = 2
Query:  284 FISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTYWNYWKQDSITPEDIIFSVPLRE 1915
            F S+CR+ R T+KGYFLAG+ M W PVGASLFASN+GS HFIGLAGSGAA GI V A+E N    +  L W+FLP++I++G  T+PEY+ +RFGGKR+Q +LA++ L +YIFTKISV++Y+ +LFI +AL+ +++++V  LL +T + TV GGLAAV+YTDT Q +IM+IG++IL   SF +IGG  AL EKY QAI   +         S    C +P + AF +FR    +D+PW G ++G T  S+WYWCTDQ++VQR LSAKNLSHAKGG++ A  LK+LPLF+MV+PGMISR+LF D+VACA  E C  +C   SGCS++AYPK+VI+LLP GLRGLM+SVM+AAL+S LTSIFNSAST+FT+D++R IRP +   ELMI+GR+FVL ++ +SILW+P++Q  QGGQLFIYIQ+IS YL PP+A  ++   FW R NEKGA   +  GL +G +RM++DF++    C+Q DTRP   +  H++Y ++       +V++ +S+ TEP  K    R T+++ +  + + P +   + P + 
Sbjct:   37 FQSICRTKRGTVKGYFLAGKDMAWWPVGASLFASNVGSGHFIGLAGSGAASGIAVTAYEWNGLFCVLALAWLFLPIYISAGVTTMPEYLQRRFGGKRIQIFLAILYLFIYIFTKISVDMYAGALFIQQALQWDLYVAVIGLLVITAIYTVAGGLAAVIYTDTLQTVIMIIGALILMAYSFIEIGGFEALQEKYFQAIPNTH---------SGNSTCGIPREDAFHIFRDPVTSDLPWPGVLVGMTIPSLWYWCTDQVIVQRSLSAKNLSHAKGGSLLAASLKVLPLFMMVLPGMISRVLFTDQVACADPELCKEICGNPSGCSDIAYPKMVIELLPTGLRGLMMSVMIAALMSSLTSIFNSASTIFTMDLWRHIRPRSTEWELMIVGRVFVLALVVVSILWIPLVQASQGGQLFIYIQSISSYLQPPVAVVFIAGCFWKRTNEKGAFWGMTIGLAVGLIRMVLDFIYVAPQCDQPDTRPGVVKYVHYLYLSMILGLLTLIVVVAVSIWTEPPSKQMISRLTWFSRFDTEVVGPVETTDNSPAQN 571          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Xenopus
Match: SLC5A11 (solute carrier family 5 (sodium/inositol cotransporter), member 11 [Source:NCBI gene;Acc:100488766])

HSP 1 Score: 589.341 bits (1518), Expect = 0.000e+0
Identity = 298/621 (47.99%), Postives = 419/621 (67.47%), Query Frame = 2
Query:  284 FISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTYWNYWKQDSITPEDIIFSVPLREKSIVVPKKEIDLELENVGGRHKCKMMLLRYWNKFLGISNTGETDSSVLPITEEQSESLFRKSI--LNRLYQRKRDRY 2140
            F S+CR+ R T+KGYFLAG+ M W PVGASLFASN+GS HFIGLAGSGAA GI V A+E N    +  L W+FLP++I++G  T+PEY+ +RFGGKR+Q +LA++ L +YIFTKISV++Y+ +LFI +AL+ +++++V  LL +T + TV GGLAAV+YTDT Q +IM+IG++IL   SF +IGG  AL EKY QAI   +         S    C +P + AF +FR    +D+PW G ++G T  S+WYWCTDQ++VQR LSAKNLSHAKGG++ A  LK+LPLF+MV+PGMISR+LF D+VACA  E C  +C   SGCS++AYPK+VI+LLP GLRGLM+SVM+AAL+S LTSIFNSAST+FT+D++R IRP +   ELMI+GR+FVL ++ +SILW+P++Q  QGGQLFIYIQ+IS YL PP+A  ++   FW R NEKGA   +  GL +G +RM++DF++    C+Q DTRP   +  H++Y ++       +V++ +S+ TEP  K    R T+++ +  + + P +   + P +    V         +E++  +         Y N  +G ++     SS          S  +K+I  L  +  RK D++
Sbjct:   12 FQSICRTKRGTVKGYFLAGKDMAWWPVGASLFASNVGSGHFIGLAGSGAASGIAVTAYEWNGLFCVLALAWLFLPIYISAGVTTMPEYLQRRFGGKRIQIFLAILYLFIYIFTKISVDMYAGALFIQQALQWDLYVAVIGLLVITAIYTVAGGLAAVIYTDTLQTVIMIIGALILMAYSFIEIGGFEALQEKYFQAIPNTH---------SGNSTCGIPREDAFHIFRDPVTSDLPWPGVLVGMTIPSLWYWCTDQVIVQRSLSAKNLSHAKGGSLLAASLKVLPLFMMVLPGMISRVLFTDQVACADPELCKEICGNPSGCSDIAYPKMVIELLPTGLRGLMMSVMIAALMSSLTSIFNSASTIFTMDLWRHIRPRSTEWELMIVGRVFVLALVVVSILWIPLVQASQGGQLFIYIQSISSYLQPPVAVVFIAGCFWKRTNEKGAFWGMTIGLAVGLIRMVLDFIYVAPQCDQPDTRPGVVKYVHYLYLSMILGLLTLIVVVAVSIWTEPPSKQMISRLTWFSRFDTEVVGPVETTDNSPAQNGISV---------MEDISEKPHATSTDAIY-NDIIGTADDDNPSSS----------SCLKKTILWLCGMDSRKGDKH 603          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Xenopus
Match: SLC5A11 (solute carrier family 5 (sodium/inositol cotransporter), member 11 [Source:NCBI gene;Acc:100488766])

HSP 1 Score: 585.489 bits (1508), Expect = 0.000e+0
Identity = 281/514 (54.67%), Postives = 382/514 (74.32%), Query Frame = 2
Query:  284 FISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPK 1825
            F S+CR+ R T+KGYFLAG+ M W PVGASLFASN+GS HFIGLAGSGAA GI V A+E N    +  L W+FLP++I++G  T+PEY+ +RFGGKR+Q +LA++ L +YIFTKISV++Y+ +LFI +AL+ +++++V  LL +T + TV GGLAAV+YTDT Q +IM+IG++IL   SF +IGG  AL EKY QAI   +        NS+   C +P + AF +FR    +D+PW G ++G T  S+WYWCTDQ++VQR LSAKNLSHAKGG++ A  LK+LPLF+MV+PGMISR+LF D+VACA  E C  +C   SGCS++AYPK+VI+LLP GLRGLM+SVM+AAL+S LTSIFNSAST+FT+D++R IRP +   ELMI+GR+FVL ++ +SILW+P++Q  QGGQLFIYIQ+IS YL PP+A  ++   FW R NEKGA   +  GL +G +RM++DF++    C+Q DTRP   +  H++Y ++       +V++ +S+ TEP  K
Sbjct:  134 FQSICRTKRGTVKGYFLAGKDMAWWPVGASLFASNVGSGHFIGLAGSGAASGIAVTAYEWNGLFCVLALAWLFLPIYISAGVTTMPEYLQRRFGGKRIQIFLAILYLFIYIFTKISVDMYAGALFIQQALQWDLYVAVIGLLVITAIYTVAGGLAAVIYTDTLQTVIMIIGALILMAYSFIEIGGFEALQEKYFQAIPNTHSG------NST---CGIPREDAFHIFRDPVTSDLPWPGVLVGMTIPSLWYWCTDQVIVQRSLSAKNLSHAKGGSLLAASLKVLPLFMMVLPGMISRVLFTDQVACADPELCKEICGNPSGCSDIAYPKMVIELLPTGLRGLMMSVMIAALMSSLTSIFNSASTIFTMDLWRHIRPRSTEWELMIVGRVFVLALVVVSILWIPLVQASQGGQLFIYIQSISSYLQPPVAVVFIAGCFWKRTNEKGAFWGMTIGLAVGLIRMVLDFIYVAPQCDQPDTRPGVVKYVHYLYLSMILGLLTLIVVVAVSIWTEPPSK 638          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Xenopus
Match: SLC5A11 (solute carrier family 5 (sodium/inositol cotransporter), member 11 [Source:NCBI gene;Acc:100488766])

HSP 1 Score: 584.334 bits (1505), Expect = 0.000e+0
Identity = 281/514 (54.67%), Postives = 382/514 (74.32%), Query Frame = 2
Query:  284 FISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPK 1825
            F S+CR+ R T+KGYFLAG+ M W PVGASLFASN+GS HFIGLAGSGAA GI V A+E N    +  L W+FLP++I++G  T+PEY+ +RFGGKR+Q +LA++ L +YIFTKISV++Y+ +LFI +AL+ +++++V  LL +T + TV GGLAAV+YTDT Q +IM+IG++IL   SF +IGG  AL EKY QAI   +        NS+   C +P + AF +FR    +D+PW G ++G T  S+WYWCTDQ++VQR LSAKNLSHAKGG++ A  LK+LPLF+MV+PGMISR+LF D+VACA  E C  +C   SGCS++AYPK+VI+LLP GLRGLM+SVM+AAL+S LTSIFNSAST+FT+D++R IRP +   ELMI+GR+FVL ++ +SILW+P++Q  QGGQLFIYIQ+IS YL PP+A  ++   FW R NEKGA   +  GL +G +RM++DF++    C+Q DTRP   +  H++Y ++       +V++ +S+ TEP  K
Sbjct:   32 FQSICRTKRGTVKGYFLAGKDMAWWPVGASLFASNVGSGHFIGLAGSGAASGIAVTAYEWNGLFCVLALAWLFLPIYISAGVTTMPEYLQRRFGGKRIQIFLAILYLFIYIFTKISVDMYAGALFIQQALQWDLYVAVIGLLVITAIYTVAGGLAAVIYTDTLQTVIMIIGALILMAYSFIEIGGFEALQEKYFQAIPNTHSG------NST---CGIPREDAFHIFRDPVTSDLPWPGVLVGMTIPSLWYWCTDQVIVQRSLSAKNLSHAKGGSLLAASLKVLPLFMMVLPGMISRVLFTDQVACADPELCKEICGNPSGCSDIAYPKMVIELLPTGLRGLMMSVMIAALMSSLTSIFNSASTIFTMDLWRHIRPRSTEWELMIVGRVFVLALVVVSILWIPLVQASQGGQLFIYIQSISSYLQPPVAVVFIAGCFWKRTNEKGAFWGMTIGLAVGLIRMVLDFIYVAPQCDQPDTRPGVVKYVHYLYLSMILGLLTLIVVVAVSIWTEPPSK 536          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Mouse
Match: Slc5a3 (solute carrier family 5 (inositol transporters), member 3 [Source:MGI Symbol;Acc:MGI:1858226])

HSP 1 Score: 625.165 bits (1611), Expect = 0.000e+0
Identity = 301/567 (53.09%), Postives = 419/567 (73.90%), Query Frame = 2
Query:  236 DISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTYWNYW---KQDSITPEDIIFSVPLREKSIV 1927
            DI+V+ +YF+ ++  GF +M +SNR T+ GYFLAG+ M W+ +GASLF SNIGSEHFIGLAGSGAA G  VGA+E NA +LL LLGWVF+P++I SG YT+PEY+ KRFGG R+Q Y A +SL++YIFTK+SV+LYS +LFI E+L  N+++SV +L+ +T L+TVTGGL AV+YTDT Q ++M+IG++ L VIS  KIGG   +  +Y  A   V    L   L+++      P   A +M R   D D+PW GFILGQTPAS+WYWC DQ++VQRVL+AKN++HAKG T+ AG LKLLP+FI+V+PGMISRI+F DE+AC   E C++VC   +GCSN+AYP+LV+ L+P GLRGLM++VM+AAL+SDL SIFNSAST+FT+D+Y+LIR  A++RELMI+GR+FV  M+ +SI W+P+I  MQGGQ+++YIQ ++ YL+PP+AA +++AIFW R NE+GA    + G ++G VR+I+ F ++   C+Q D RP F +  H+MY A   F    ++ +++SLLT P  K     TT+W+      ++S + +D  +   ++EKSI+
Sbjct:    9 DIAVVALYFILVMCIGFFAMWKSNRSTVSGYFLAGRSMTWVAIGASLFVSNIGSEHFIGLAGSGAASGFAVGAWEFNALLLLQLLGWVFIPIYIRSGVYTMPEYLSKRFGGHRIQVYFAALSLLLYIFTKLSVDLYSGALFIQESLGWNLYVSVILLIGMTALLTVTGGLVAVIYTDTLQALLMIIGALTLMVISMVKIGGFEEVKRRYMLASPDVASILLKYNLSNTNACMVHPKANALKMLRDPTDEDVPWPGFILGQTPASVWYWCADQVIVQRVLAAKNIAHAKGSTLMAGFLKLLPMFIIVVPGMISRIVFADEIACINPEHCMQVCGSRAGCSNIAYPRLVMTLVPVGLRGLMMAVMIAALMSDLDSIFNSASTIFTLDVYKLIRKSASSRELMIVGRIFVAFMVVISIAWVPIIVEMQGGQMYLYIQEVADYLTPPVAALFLLAIFWKRCNEQGAFYGGMAGFVLGAVRLILAFTYRAPECDQPDNRPGFIKDIHYMYVATALFWITGLITVIVSLLTPPPTKDQIRTTTFWSKKTLVTKESCSQKDEPYK--MQEKSIL 573          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Mouse
Match: Slc5a11 (solute carrier family 5 (sodium/glucose cotransporter), member 11 [Source:MGI Symbol;Acc:MGI:1919316])

HSP 1 Score: 587.8 bits (1514), Expect = 0.000e+0
Identity = 312/646 (48.30%), Postives = 437/646 (67.65%), Query Frame = 2
Query:  218 KNIGPLDISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTYWNYW----KQDSITPEDIIFSVPLREKSIVVPKKEIDLEL----------ENVGGRHKCKMMLLRYWNKFLGIS-NTGETDSSVLPITEEQSESLFRKSILN 2110
            K++ P DI+V+V+YF+ ++A G  S  R+ RDT+KGYFLAG  M+W PVGASLFASN+GS HFIGLAGSGAA GI V A+ELN    + +L WVFLP++I     T+PEY+ +RFGG R+   LAV+ L +YIFTKISV++Y+ ++FI ++L L+++L++  LLA+T L TV GGLAAV+YTD  Q +IM+IG+ IL   SFA +GG+  L ++Y  A+A  N ++     NSS   C LP + AF +FR    +D+PW G + G +  S+WYWCTDQ++VQR L+AKNLSHAKGG++ A  LK+LPLF+MV PGM+SR+LFPD+VACA  + C RVC   SGCS++AYPKLV++LLP GLRGLM++VM+AAL+S LTSIFNSAST+FT+D++  IRP A+ RELMI+GR+FV  ++ +SILW+P++Q  QGGQLFIYIQ+IS YL PP+A  +++  FW R NEKGA + LI GL++G VR+I+DFV+ +  C+Q D RP   +  H++YF++    +  + ++ +S  TE   K    R T++       ++DS  PE  +     +  +   P   I LE           + V  RH  K++    W    G+  N  E  S   P+     E+   K++L+
Sbjct:   22 KSMEPADIAVLVLYFLFVLAVGLWSTVRTKRDTVKGYFLAGGDMVWWPVGASLFASNVGSGHFIGLAGSGAAVGISVAAYELNGLFSVLMLAWVFLPIYIAGQVTTMPEYLRRRFGGNRISITLAVLYLFIYIFTKISVDMYAGAIFIQQSLHLDLYLAIVGLLAITALYTVAGGLAAVIYTDALQTVIMLIGAFILMGYSFAAVGGMEGLKDQYFLALAS-NRSE-----NSS---CGLPREDAFHIFRDPLTSDLPWPGILFGMSIPSLWYWCTDQVIVQRSLAAKNLSHAKGGSLMAAYLKVLPLFLMVFPGMVSRVLFPDQVACAHPDICQRVCSNPSGCSDIAYPKLVLELLPTGLRGLMMAVMVAALMSSLTSIFNSASTIFTMDLWNHIRPRASERELMIVGRIFVFALVLVSILWIPIVQASQGGQLFIYIQSISSYLQPPVAMVFIMGCFWKRTNEKGAFSGLILGLLLGLVRLILDFVYAQPRCDQPDDRPAVVKDVHYLYFSMILSFTTLITVVTVSWFTETPSKEMVSRLTWFTRHEPVAQKDSAPPETPLSLTLSQNGTTEAPGTSIQLETVQESTTKACGDGVSPRHS-KVVRAILW--LCGMEKNKEEPPSKAEPVIVSLEENPLVKTLLD 655          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Mouse
Match: Slc5a11 (solute carrier family 5 (sodium/glucose cotransporter), member 11 [Source:MGI Symbol;Acc:MGI:1919316])

HSP 1 Score: 587.8 bits (1514), Expect = 0.000e+0
Identity = 312/646 (48.30%), Postives = 437/646 (67.65%), Query Frame = 2
Query:  218 KNIGPLDISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTYWNYW----KQDSITPEDIIFSVPLREKSIVVPKKEIDLEL----------ENVGGRHKCKMMLLRYWNKFLGIS-NTGETDSSVLPITEEQSESLFRKSILN 2110
            K++ P DI+V+V+YF+ ++A G  S  R+ RDT+KGYFLAG  M+W PVGASLFASN+GS HFIGLAGSGAA GI V A+ELN    + +L WVFLP++I     T+PEY+ +RFGG R+   LAV+ L +YIFTKISV++Y+ ++FI ++L L+++L++  LLA+T L TV GGLAAV+YTD  Q +IM+IG+ IL   SFA +GG+  L ++Y  A+A  N ++     NSS   C LP + AF +FR    +D+PW G + G +  S+WYWCTDQ++VQR L+AKNLSHAKGG++ A  LK+LPLF+MV PGM+SR+LFPD+VACA  + C RVC   SGCS++AYPKLV++LLP GLRGLM++VM+AAL+S LTSIFNSAST+FT+D++  IRP A+ RELMI+GR+FV  ++ +SILW+P++Q  QGGQLFIYIQ+IS YL PP+A  +++  FW R NEKGA + LI GL++G VR+I+DFV+ +  C+Q D RP   +  H++YF++    +  + ++ +S  TE   K    R T++       ++DS  PE  +     +  +   P   I LE           + V  RH  K++    W    G+  N  E  S   P+     E+   K++L+
Sbjct:   22 KSMEPADIAVLVLYFLFVLAVGLWSTVRTKRDTVKGYFLAGGDMVWWPVGASLFASNVGSGHFIGLAGSGAAVGISVAAYELNGLFSVLMLAWVFLPIYIAGQVTTMPEYLRRRFGGNRISITLAVLYLFIYIFTKISVDMYAGAIFIQQSLHLDLYLAIVGLLAITALYTVAGGLAAVIYTDALQTVIMLIGAFILMGYSFAAVGGMEGLKDQYFLALAS-NRSE-----NSS---CGLPREDAFHIFRDPLTSDLPWPGILFGMSIPSLWYWCTDQVIVQRSLAAKNLSHAKGGSLMAAYLKVLPLFLMVFPGMVSRVLFPDQVACAHPDICQRVCSNPSGCSDIAYPKLVLELLPTGLRGLMMAVMVAALMSSLTSIFNSASTIFTMDLWNHIRPRASERELMIVGRIFVFALVLVSILWIPIVQASQGGQLFIYIQSISSYLQPPVAMVFIMGCFWKRTNEKGAFSGLILGLLLGLVRLILDFVYAQPRCDQPDDRPAVVKDVHYLYFSMILSFTTLITVVTVSWFTETPSKEMVSRLTWFTRHEPVAQKDSAPPETPLSLTLSQNGTTEAPGTSIQLETVQESTTKACGDGVSPRHS-KVVRAILW--LCGMEKNKEEPPSKAEPVIVSLEENPLVKTLLD 655          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Mouse
Match: Slc5a2 (solute carrier family 5 (sodium/glucose cotransporter), member 2 [Source:MGI Symbol;Acc:MGI:2181411])

HSP 1 Score: 572.778 bits (1475), Expect = 0.000e+0
Identity = 296/625 (47.36%), Postives = 426/625 (68.16%), Query Frame = 2
Query:  230 PLDISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTY---WNYWKQDSITPEDIIFSVPLREKSIVVPKKEIDLELENVGGRHKCKMMLLRYWNKFLGISNTGETDSSVLPITEEQSESLFR 2095
            P DI VI  YF+ +I  G  SM R+NR T+ GYFLAG+ M+W PVGASLFASNIGS HF+GLAG+GAA G+ V  FE NA  ++ LLGW+F+PV++ +G  T+P+Y+ KRFGG R++ YL+V+SL +YIFTKISV+++S ++FI +AL  NI+ SV  LL +T + TVTGGLAA++YTDT Q  +++ G+ ILT  +F ++GG S LF+KY  A+  +  ++ P++ N S+  CY P   ++ + R     D+PW   +LG T  S WYWC+DQ++VQR L+ KNL+H K G I  G LKL+P+F+MVMPGMISRIL+PDEVAC   E C RVC    GCSN+AYP+LV+KL+P+GLRGLML+VMLAAL+S L SIFNS+STLFT+DIY  +RP A ++EL+++GRL+V+ ++ +S+ WLPV+Q  QGGQLF YIQ++S YL+PP++A +V+A+F  R NEKGA   L+ GL++G  R+I +F +    C +    P  F + H++YFA+  F    ++ + ISL T P+P+    R  +    +  +++ +  +++    P   ++     +E  +E+E V  +     +L R    F G+S +G    S  P TEE + +  R
Sbjct:   21 PADILVIAAYFLLVIGVGLWSMFRTNRGTVGGYFLAGRSMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNALFVVLLLGWLFVPVYLTAGVITMPQYLRKRFGGHRIRLYLSVLSLFLYIFTKISVDMFSGAVFIQQALGWNIYASVIALLGITMIYTVTGGLAALMYTDTVQTFVILAGAFILTGYAFHEVGGYSGLFDKYLGAMTSLTVSKDPSVGNISS-TCYQPRPDSYHLLRDPVTGDLPWPALLLGLTIVSGWYWCSDQVIVQRCLAGKNLTHIKAGCILCGYLKLMPMFLMVMPGMISRILYPDEVACVVPEVCKRVCGTEVGCSNIAYPRLVVKLMPNGLRGLMLAVMLAALMSSLASIFNSSSTLFTMDIYTRLRPRAGDKELLLVGRLWVVFIVAVSVAWLPVVQAAQGGQLFDYIQSVSSYLAPPVSAVFVLALFVPRVNEKGAFWGLVGGLLMGLARLIPEFFFGSGSCVRPSACPALFCRVHYLYFAIILFICSGILTLGISLCTAPIPQKHLHRLVFSLRHSKEEREDLDADELEGPAPAPVQN---GGQECAMEMEEV--QSPAPGLLRRCLLWFCGMSKSG--SGSPPPTTEEVAATTRR 637          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Mouse
Match: Slc5a4b (solute carrier family 5 (neutral amino acid transporters, system A), member 4b [Source:MGI Symbol;Acc:MGI:1890478])

HSP 1 Score: 553.132 bits (1424), Expect = 0.000e+0
Identity = 302/648 (46.60%), Postives = 419/648 (64.66%), Query Frame = 2
Query:  236 DISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTYWNYWKQDSITPEDIIFSVPLREKSIVVPKKEIDLELENVGG-----RHKCKMMLLRYWNKFLGISNTGETDSSVLPITEEQSESLFRKSILNRLYQRKRDRYILNVLMVL 2164
            DISVIVIYF+ ++A G  SM RSNR T+ G+FLAG  M W P+GASLFASNIGS HF+GLAG+GAA GI + A E NA +++ +LGWVFLP++I +G  T+PEY+ KRFGGKR+Q YL+V+SL + +  + S  ++S ++FI  AL LN++L+V +LLA+T   TV GGLA+V+YTD+ Q  IM++GS+IL   +FA++GG  +  EKY  AI  V E     I    +  CY P   +F +FR     D+PW G I G T  +IWYWC DQ++VQR L  KN+SH K   I  G LKLLP+F+MVMPGMISRIL+ D+VAC    +C + C  A GC+N AYP LV++L+PDGLRGLMLSVMLA+L+S LTSIFNSASTLFT+D+Y  IR  A+ RELMI GR+F +++I +SILW+P++Q  Q GQLF YI ++S YL PP+ A +++AIF+ R NE+GA   L+ GL++G +R+I +FV+    C      P      H+MYFA+  F    +V++ +S LTEP+P V   R   W+ W                 E+ I +  +E++ + E  GG       + +  L R      G+ NTG        +T+E+  +L +K   +   ++   R ++N+  VL
Sbjct:   28 DISVIVIYFIVVLAVGLWSMVRSNRGTVGGFFLAGHDMAWWPMGASLFASNIGSNHFVGLAGTGAASGIAIAAVEWNALLMVLVLGWVFLPIYIKAGVLTMPEYLRKRFGGKRLQIYLSVLSLFIMVALQTSSIIFSGAIFIQLALGLNLYLAVFILLAITAFYTVAGGLASVIYTDSVQTFIMLLGSLILMGFAFAEVGGYESFTEKYMNAIPSVVEGDNLTI----SPKCYTPQPDSFHVFRDPVTGDIPWPGLIFGMTILAIWYWCADQVIVQRCLCGKNMSHVKAACILCGYLKLLPMFLMVMPGMISRILYTDKVACVVPSECEKQCGTAVGCTNYAYPTLVLELMPDGLRGLMLSVMLASLMSSLTSIFNSASTLFTIDLYTKIRKKASERELMIAGRIFGMVLIAVSILWVPLVQVSQNGQLFHYIGSVSSYLGPPLGAVFMLAIFFKRVNEQGAFWGLMVGLVVGLIRLIAEFVYGTGSCVAPSNCPKIICGVHYMYFAIILFFVSIIVILGVSFLTEPIPDVHLYRLC-WSLWNNT--------------EERIDLDAEELETQ-EEAGGALEEDSEQSRGCLKRACCLLCGLQNTGPK------LTKEEEAALRQK--FSDTSEKPLWRTVMNINAVL 647          
BLAST of Sodium/myo-inositol cotransporter vs. UniProt/SwissProt
Match: sp|P31637|SC5A3_CANLF (Sodium/myo-inositol cotransporter OS=Canis lupus familiaris OX=9615 GN=SLC5A3 PE=2 SV=1)

HSP 1 Score: 626.32 bits (1614), Expect = 0.000e+0
Identity = 298/567 (52.56%), Postives = 421/567 (74.25%), Query Frame = 2
Query:  236 DISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTYWNYWK---QDSITPEDIIFSVPLREKSIV 1927
            DI+++ +YF+ ++  GF +M +SNR T+ GYFLAG+ M W+ +GASLF SNIGSEHFIGLAGSGAA G  VGA+E NA +LL LLGWVF+P++I SG YT+PEY+ KRFGG R+Q Y A +SL++YIFTK+SV+LYS +LFI E+L  N+++SV +L+ +T L+TVTGGL AV+YTDT Q ++M++G++ L +IS  +IGG   +  +Y  A   V    L   L+++      P K A +M R   D D+PW GF+LGQTPAS+WYWC DQ++VQRVL+AKN++HAKG T+ AG LKLLP+FI+V+PGMISRILF D++AC   E C++VC   +GCSN+AYP+LV+KL+P GLRGLM++VM+AAL+SDL SIFNSAST+FT+D+Y+LIR  A++RELMI+GR+FV  M+ +SI W+P+I  MQGGQ+++YIQ ++ YL+PP+AA +++AIFW R NE+GA    + G ++G VR+ + F ++   C+Q D RP F +  H+MY A   F    ++ +++SLLT P  K     TT+W+      ++S +P+D  +   ++EKSI+
Sbjct:    9 DIAIVALYFILVMCIGFFAMWKSNRSTVSGYFLAGRSMTWVAIGASLFVSNIGSEHFIGLAGSGAASGFAVGAWEFNALLLLQLLGWVFIPIYIRSGVYTMPEYLSKRFGGHRIQVYFAALSLILYIFTKLSVDLYSGALFIQESLGWNLYVSVILLIGMTALLTVTGGLVAVIYTDTLQALLMIVGALTLMIISMMEIGGFEEVKRRYMLASPNVTSILLTYNLSNTNSCNVHPKKDALKMLRNPTDEDVPWPGFVLGQTPASVWYWCADQVIVQRVLAAKNIAHAKGSTLMAGFLKLLPMFIIVVPGMISRILFADDIACINPEHCMQVCGSRAGCSNIAYPRLVMKLVPVGLRGLMMAVMIAALMSDLDSIFNSASTIFTLDVYKLIRRSASSRELMIVGRIFVAFMVVISIAWVPIIVEMQGGQMYLYIQEVADYLTPPVAALFLLAIFWKRCNEQGAFYGGMAGFVLGAVRLTLAFAYRAPECDQPDNRPGFIKDIHYMYVATALFWVTGLITVIVSLLTPPPTKEQIRTTTFWSKKSLVVKESCSPKDEPYK--MQEKSIL 573          
BLAST of Sodium/myo-inositol cotransporter vs. UniProt/SwissProt
Match: sp|Q9JKZ2|SC5A3_MOUSE (Sodium/myo-inositol cotransporter OS=Mus musculus OX=10090 GN=Slc5a3 PE=1 SV=2)

HSP 1 Score: 625.165 bits (1611), Expect = 0.000e+0
Identity = 301/567 (53.09%), Postives = 419/567 (73.90%), Query Frame = 2
Query:  236 DISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTYWNYW---KQDSITPEDIIFSVPLREKSIV 1927
            DI+V+ +YF+ ++  GF +M +SNR T+ GYFLAG+ M W+ +GASLF SNIGSEHFIGLAGSGAA G  VGA+E NA +LL LLGWVF+P++I SG YT+PEY+ KRFGG R+Q Y A +SL++YIFTK+SV+LYS +LFI E+L  N+++SV +L+ +T L+TVTGGL AV+YTDT Q ++M+IG++ L VIS  KIGG   +  +Y  A   V    L   L+++      P   A +M R   D D+PW GFILGQTPAS+WYWC DQ++VQRVL+AKN++HAKG T+ AG LKLLP+FI+V+PGMISRI+F DE+AC   E C++VC   +GCSN+AYP+LV+ L+P GLRGLM++VM+AAL+SDL SIFNSAST+FT+D+Y+LIR  A++RELMI+GR+FV  M+ +SI W+P+I  MQGGQ+++YIQ ++ YL+PP+AA +++AIFW R NE+GA    + G ++G VR+I+ F ++   C+Q D RP F +  H+MY A   F    ++ +++SLLT P  K     TT+W+      ++S + +D  +   ++EKSI+
Sbjct:    9 DIAVVALYFILVMCIGFFAMWKSNRSTVSGYFLAGRSMTWVAIGASLFVSNIGSEHFIGLAGSGAASGFAVGAWEFNALLLLQLLGWVFIPIYIRSGVYTMPEYLSKRFGGHRIQVYFAALSLLLYIFTKLSVDLYSGALFIQESLGWNLYVSVILLIGMTALLTVTGGLVAVIYTDTLQALLMIIGALTLMVISMVKIGGFEEVKRRYMLASPDVASILLKYNLSNTNACMVHPKANALKMLRDPTDEDVPWPGFILGQTPASVWYWCADQVIVQRVLAAKNIAHAKGSTLMAGFLKLLPMFIIVVPGMISRIVFADEIACINPEHCMQVCGSRAGCSNIAYPRLVMTLVPVGLRGLMMAVMIAALMSDLDSIFNSASTIFTLDVYKLIRKSASSRELMIVGRIFVAFMVVISIAWVPIIVEMQGGQMYLYIQEVADYLTPPVAALFLLAIFWKRCNEQGAFYGGMAGFVLGAVRLILAFTYRAPECDQPDNRPGFIKDIHYMYVATALFWITGLITVIVSLLTPPPTKDQIRTTTFWSKKTLVTKESCSQKDEPYK--MQEKSIL 573          
BLAST of Sodium/myo-inositol cotransporter vs. UniProt/SwissProt
Match: sp|P53794|SC5A3_HUMAN (Sodium/myo-inositol cotransporter OS=Homo sapiens OX=9606 GN=SLC5A3 PE=1 SV=2)

HSP 1 Score: 624.78 bits (1610), Expect = 0.000e+0
Identity = 300/567 (52.91%), Postives = 422/567 (74.43%), Query Frame = 2
Query:  236 DISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTYW---NYWKQDSITPEDIIFSVPLREKSIV 1927
            DI+++ +YF+ ++  GF +M +SNR T+ GYFLAG+ M W+ +GASLF SNIGSEHFIGLAGSGAA G  VGA+E NA +LL LLGWVF+P++I SG YT+PEY+ KRFGG R+Q Y A +SL++YIFTK+SV+LYS +LFI E+L  N+++SV +L+ +T L+TVTGGL AV+YTDT Q ++M+IG++ L +IS  +IGG   +  +Y  A   V    L   L+++      P K+A +M R   D D+PW GFILGQTPAS+WYWC DQ++VQRVL+AKN++HAKG T+ AG LKLLP+FI+V+PGMISRILF D++AC   E C+ VC   +GCSN+AYP+LV+KL+P GLRGLM++VM+AAL+SDL SIFNSAST+FT+D+Y+LIR  A++RELMI+GR+FV  M+ +SI W+P+I  MQGGQ+++YIQ ++ YL+PP+AA +++AIFW R NE+GA    + G ++G VR+I+ F ++   C+Q D RP F +  H+MY A   F    ++ +++SLLT P  K     TT+W   N   +++ +P++  +   ++EKSI+
Sbjct:    9 DIAIVALYFILVMCIGFFAMWKSNRSTVSGYFLAGRSMTWVTIGASLFVSNIGSEHFIGLAGSGAASGFAVGAWEFNALLLLQLLGWVFIPIYIRSGVYTMPEYLSKRFGGHRIQVYFAALSLILYIFTKLSVDLYSGALFIQESLGWNLYVSVILLIGMTALLTVTGGLVAVIYTDTLQALLMIIGALTLMIISIMEIGGFEEVKRRYMLASPDVTSILLTYNLSNTNSCNVSPKKEALKMLRNPTDEDVPWPGFILGQTPASVWYWCADQVIVQRVLAAKNIAHAKGSTLMAGFLKLLPMFIIVVPGMISRILFTDDIACINPEHCMLVCGSRAGCSNIAYPRLVMKLVPVGLRGLMMAVMIAALMSDLDSIFNSASTIFTLDVYKLIRKSASSRELMIVGRIFVAFMVVISIAWVPIIVEMQGGQMYLYIQEVADYLTPPVAALFLLAIFWKRCNEQGAFYGGMAGFVLGAVRLILAFAYRAPECDQPDNRPGFIKDIHYMYVATGLFWVTGLITVIVSLLTPPPTKEQIRTTTFWSKKNLVVKENCSPKEEPYQ--MQEKSIL 573          
BLAST of Sodium/myo-inositol cotransporter vs. UniProt/SwissProt
Match: sp|P53793|SC5A3_BOVIN (Sodium/myo-inositol cotransporter OS=Bos taurus OX=9913 GN=SLC5A3 PE=3 SV=1)

HSP 1 Score: 622.854 bits (1605), Expect = 0.000e+0
Identity = 299/567 (52.73%), Postives = 420/567 (74.07%), Query Frame = 2
Query:  236 DISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTYWNYWK---QDSITPEDIIFSVPLREKSIV 1927
            DI+++ +YF+ ++  GF +M +SNR T+ GYFLAG+ M W+ +GASLF SNIGSEHFIGLAGSGAA G  VGA+E NA +LL LLGWVF+P++I SG YT+PEY+ KRFGG R+Q Y A +SL++YIFTK+SV+LYS +LFI E++  N+++SV +L+ +T L+TVTGGL AV+YTDT Q ++M++G++ L VIS  +IGG   +  +Y  A   V    L   L+++      P K A +M R   D D+PW GFILGQTPAS+WYWC DQ++VQRVL+AKN++HAKG T+ AG LKLLP+FI+V+PGMISRILF D++AC   E C++VC   +GCSN+AYP+LV+KL+P GLRGLM++VM+AAL+SDL SIFNSAST+FT+D+Y+LIR  A++RELMI+GR+FV  M+ +SI W+P+I  MQGGQ+++YIQ ++ YL+PP+AA +++AIFW R NE+GA    + G I+  VR+ + F ++   C+Q D RP F +  H+MY A   F    ++ +++SLLT P  K     TT+W+      ++S +P+D  +   ++EKSI+
Sbjct:    9 DIAIVALYFILVMCIGFFAMWKSNRSTVSGYFLAGRSMTWVAIGASLFVSNIGSEHFIGLAGSGAASGFAVGAWEFNALLLLQLLGWVFIPIYIRSGVYTMPEYLSKRFGGHRIQVYFAALSLILYIFTKLSVDLYSGALFIQESMGWNLYVSVILLIGMTALLTVTGGLVAVIYTDTLQALLMIVGALTLMVISMMEIGGFEEVKRRYMLASPNVTSILLTYNLSNTNSCNVHPKKDALKMLRNPTDEDVPWPGFILGQTPASVWYWCADQVIVQRVLAAKNIAHAKGSTLMAGFLKLLPMFIIVVPGMISRILFADDIACINPEHCMQVCGSRAGCSNIAYPRLVMKLVPVGLRGLMMAVMIAALMSDLDSIFNSASTIFTLDVYKLIRKSASSRELMIVGRIFVAFMVVISIAWVPIIVEMQGGQMYLYIQEVADYLTPPVAALFLLAIFWKRCNEQGAFYGGMAGFILVVVRLTLAFAYRAPECDQPDNRPVFIKDIHYMYVATALFWITGLITVIVSLLTPPPTKEQIRTTTFWSKKSLVVKESCSPKDEPYK--MQEKSIL 573          
BLAST of Sodium/myo-inositol cotransporter vs. UniProt/SwissProt
Match: sp|Q8K0E3|SC5AB_MOUSE (Sodium/myo-inositol cotransporter 2 OS=Mus musculus OX=10090 GN=Slc5a11 PE=1 SV=1)

HSP 1 Score: 587.8 bits (1514), Expect = 0.000e+0
Identity = 312/646 (48.30%), Postives = 437/646 (67.65%), Query Frame = 2
Query:  218 KNIGPLDISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTYWNYW----KQDSITPEDIIFSVPLREKSIVVPKKEIDLEL----------ENVGGRHKCKMMLLRYWNKFLGIS-NTGETDSSVLPITEEQSESLFRKSILN 2110
            K++ P DI+V+V+YF+ ++A G  S  R+ RDT+KGYFLAG  M+W PVGASLFASN+GS HFIGLAGSGAA GI V A+ELN    + +L WVFLP++I     T+PEY+ +RFGG R+   LAV+ L +YIFTKISV++Y+ ++FI ++L L+++L++  LLA+T L TV GGLAAV+YTD  Q +IM+IG+ IL   SFA +GG+  L ++Y  A+A  N ++     NSS   C LP + AF +FR    +D+PW G + G +  S+WYWCTDQ++VQR L+AKNLSHAKGG++ A  LK+LPLF+MV PGM+SR+LFPD+VACA  + C RVC   SGCS++AYPKLV++LLP GLRGLM++VM+AAL+S LTSIFNSAST+FT+D++  IRP A+ RELMI+GR+FV  ++ +SILW+P++Q  QGGQLFIYIQ+IS YL PP+A  +++  FW R NEKGA + LI GL++G VR+I+DFV+ +  C+Q D RP   +  H++YF++    +  + ++ +S  TE   K    R T++       ++DS  PE  +     +  +   P   I LE           + V  RH  K++    W    G+  N  E  S   P+     E+   K++L+
Sbjct:   22 KSMEPADIAVLVLYFLFVLAVGLWSTVRTKRDTVKGYFLAGGDMVWWPVGASLFASNVGSGHFIGLAGSGAAVGISVAAYELNGLFSVLMLAWVFLPIYIAGQVTTMPEYLRRRFGGNRISITLAVLYLFIYIFTKISVDMYAGAIFIQQSLHLDLYLAIVGLLAITALYTVAGGLAAVIYTDALQTVIMLIGAFILMGYSFAAVGGMEGLKDQYFLALAS-NRSE-----NSS---CGLPREDAFHIFRDPLTSDLPWPGILFGMSIPSLWYWCTDQVIVQRSLAAKNLSHAKGGSLMAAYLKVLPLFLMVFPGMVSRVLFPDQVACAHPDICQRVCSNPSGCSDIAYPKLVLELLPTGLRGLMMAVMVAALMSSLTSIFNSASTIFTMDLWNHIRPRASERELMIVGRIFVFALVLVSILWIPIVQASQGGQLFIYIQSISSYLQPPVAMVFIMGCFWKRTNEKGAFSGLILGLLLGLVRLILDFVYAQPRCDQPDDRPAVVKDVHYLYFSMILSFTTLITVVTVSWFTETPSKEMVSRLTWFTRHEPVAQKDSAPPETPLSLTLSQNGTTEAPGTSIQLETVQESTTKACGDGVSPRHS-KVVRAILW--LCGMEKNKEEPPSKAEPVIVSLEENPLVKTLLD 655          
BLAST of Sodium/myo-inositol cotransporter vs. TrEMBL
Match: A0A564Z9A5 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS13316 PE=3 SV=1)

HSP 1 Score: 716.457 bits (1848), Expect = 0.000e+0
Identity = 350/579 (60.45%), Postives = 437/579 (75.47%), Query Frame = 2
Query:  236 DISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPA---ILN--------------------------SSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTYWNYWKQDSITPE 1885
            DI+V+VIYF  ++  G  +MCR+  ++++GYFLAG+FM WLPVGASLFASNIGSEHFIGLAGSGA++GI VGAFE NA+ILL LLGWVFLPV+I+SG YTLP+YM KRFGG R++ YL V+SL++YIFTKISVNLYS SLFI EAL  NIW S+  +L++T LIT+TGGLAAVLYTD  Q  +M+ G+I+LT I F+KIGG   L E+YG AI+ VN +       ILN                          S++L C LPS KAF M R + D +MPWLG+ILGQTPASIWYWC DQMMVQRVL+AK+LSHA+G T+ AG +KL PLFI+++PGMISRIL+PD + C TAE+C ++C    GCS+ AYPKLV+ ++PDGLRGLMLSVMLAAL+SDLTSIFNS+STLFTVDIY   R  A NRELMI+GRLFV +M+ LSILW+PVIQ+MQGGQL+IYIQ+ISGYLSPPIAA Y++A+ W R NE GA T L+YG IIG VRMI+ FV+ +  C + D RP+   K H+MYFA+FSF S  +VM ++SL++ P  +      T+W   + + +TP 
Sbjct:   11 DIAVLVIYFTIILGAGLFAMCRARVNSVQGYFLAGRFMTWLPVGASLFASNIGSEHFIGLAGSGASQGIAVGAFEFNAAILLQLLGWVFLPVYISSGVYTLPDYMKKRFGGSRIRIYLTVLSLILYIFTKISVNLYSGSLFINEALGWNIWFSILFILSMTALITITGGLAAVLYTDLVQTFVMLFGAILLTGIGFSKIGGFPGLLERYGSAISAVNLSSTDGESLILNIESVAESNALAGIKPSVDSVASSPNISTSLTCALPSSKAFVMLRDVSDPEMPWLGYILGQTPASIWYWCADQMMVQRVLAAKSLSHAQGATLMAGFIKLFPLFIIIIPGMISRILYPDTIGCGTAEECFKICGNHHGCSDWAYPKLVMGIMPDGLRGLMLSVMLAALMSDLTSIFNSSSTLFTVDIYTSFRRKAGNRELMIVGRLFVFVMVALSILWVPVIQSMQGGQLYIYIQSISGYLSPPIAAVYIMALMWKRNNELGAFTGLVYGFIIGVVRMILSFVYSDPICGEPDNRPWIVAKVHYMYFAMFSFFSTGLVMCLVSLISHPPTEEQIRGLTFWT--RNEGLTPN 587          
BLAST of Sodium/myo-inositol cotransporter vs. TrEMBL
Match: A0A564Z7G3 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS13316 PE=3 SV=1)

HSP 1 Score: 714.146 bits (1842), Expect = 0.000e+0
Identity = 350/579 (60.45%), Postives = 437/579 (75.47%), Query Frame = 2
Query:  236 DISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPA---ILN--------------------------SSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTYWNYWKQDSITPE 1885
            DI+V+VIYF  ++  G  +MCR+  ++++GYFLAG+FM WLPVGASLFASNIGSEHFIGLAGSGA++GI VGAFE NA+ILL LLGWVFLPV+I+SG YTLP+YM KRFGG R++ YL V+SL++YIFTKISVNLYS SLFI EAL  NIW S+  +L++T LIT+TGGLAAVLYTD  Q  +M+ G+I+LT I F+KIGG   L E+YG AI+ VN +       ILN                          S++L C LPS KAF M R + D +MPWLG+ILGQTPASIWYWC DQMMVQRVL+AK+LSHA+G T+ AG +KL PLFI+++PGMISRIL+PD + C TAE+C ++C    GCS+ AYPKLV+ ++PDGLRGLMLSVMLAAL+SDLTSIFNS+STLFTVDIY   R  A NRELMI+GRLFV +M+ LSILW+PVIQ+MQGGQL+IYIQ+ISGYLSPPIAA Y++A+ W R NE GA T L+YG IIG VRMI+ FV+ +  C + D RP+   K H+MYFA+FSF S  +VM ++SL++ P  +      T+W   + + +TP 
Sbjct:   11 DIAVLVIYFTIILGAGLFAMCRARVNSVQGYFLAGRFMTWLPVGASLFASNIGSEHFIGLAGSGASQGIAVGAFEFNAAILLQLLGWVFLPVYISSGVYTLPDYMKKRFGGSRIRIYLTVLSLILYIFTKISVNLYSGSLFINEALGWNIWFSILFILSMTALITITGGLAAVLYTDLVQTFVMLFGAILLTGIGFSKIGGFPGLLERYGSAISAVNLSSTDGESLILNIESVAESNALAGIKPSVDSVASSPNISTSLTCALPSSKAFVMLRDVSDPEMPWLGYILGQTPASIWYWCADQMMVQRVLAAKSLSHAQGATLMAGFIKLFPLFIIIIPGMISRILYPDTIGCGTAEECFKICGNHHGCSDWAYPKLVMGIMPDGLRGLMLSVMLAALMSDLTSIFNSSSTLFTVDIYTSFRRKAGNRELMIVGRLFVFVMVALSILWVPVIQSMQGGQLYIYIQSISGYLSPPIAAVYIMALMWKRNNELGAFTGLVYGFIIGVVRMILSFVYSDPICGEPDNRPWIVAKVHYMYFAMFSFFSTGLVMCLVSLISHPPTEEQIRGLTFWT--RNEGLTPN 587          
BLAST of Sodium/myo-inositol cotransporter vs. TrEMBL
Match: A0A4Z2CNW9 (Sodium/myo-inositol cotransporter OS=Schistosoma japonicum OX=6182 GN=EWB00_009104 PE=3 SV=1)

HSP 1 Score: 706.057 bits (1821), Expect = 0.000e+0
Identity = 362/728 (49.73%), Postives = 485/728 (66.62%), Query Frame = 2
Query:  236 DISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVN------ETQLPAILNS-------------------STLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTYWNYWKQDSITPEDIIFSVP------------LREKSIVVPKKEIDLELENVGGRHKCKMMLLRYW---------NKFLGISNTGETDSSVLPITEEQSESLFRKSILNRLYQRKRDRYILNVLMVLQXXXXXXXXXXXSVAFPEIEIGKVPVFNSTDNLRKIS*Y 2281
            DISV+++Y +CL +TG  S+    R TI  YFLAG+F+ WLP+GASLFASNIGSEHFIGLAGSG+  GI VGAFELNASI+L LLGWVFLPV+I SG  TLPEYM  RFGG R+Q YLA++SL +YIFTKISVNLYS SLF+ EALE N WLS+ +LL++T +ITVTGGLAAVLYTDT Q  +M+ GS +LT++SF K+GG   L   YG AIA VN      E  L  ++ +                   S L C LPS+KAF++ R +DD DMPWLGF+ GQTP+SIWYWC DQMMVQR L+AK+LSHA+G T+  GI+K  PLFI+V+PGMISR+L+P+E+ C    DC+ VC   +GCSN+AYPKLV+ L+P GLRGLML+VM+AAL+SDLTSIFNSASTLFTVD+Y+  R  A N ELMI+GR FV++++ LS+ W+P+IQ+ QG +L+IYIQAI+ YL+PPIA+ Y+ A+ W R NEKGA T LIYGLIIG +RMI+  V+ +  C + DTRP+F +  H+MYFA+FSF+S  +++IV+SL + P       R TYW  W  +     D I                L    +V P   ID +        +     +  W         ++F  +++  +    +  + +E++ +  R + +  L+Q  R ++ L + ++  I      +I +S+ F EI IG +P+  ++  ++K S Y
Sbjct:    9 DISVLILYLICLFSTGLYSLFTHRRGTITDYFLAGRFVTWLPIGASLFASNIGSEHFIGLAGSGSVAGIAVGAFELNASIILQLLGWVFLPVYIASGVNTLPEYMRNRFGGSRIQIYLAIMSLFLYIFTKISVNLYSGSLFLTEALEWNTWLSIIILLSITAIITVTGGLAAVLYTDTLQFFVMIAGSTVLTILSFIKVGGFQGLLTAYGGAIAEVNISSSEGENLLSTMILTAEAKNITSLIQLSSEPTVDSRLKCALPSRKAFKLLREIDDPDMPWLGFLFGQTPSSIWYWCADQMMVQRTLAAKSLSHAQGATLMTGIIKQFPLFIIVIPGMISRVLYPNEIGCFPGSDCLAVCGHRNGCSNMAYPKLVVDLMPSGLRGLMLTVMIAALISDLTSIFNSASTLFTVDVYQKWRSSAQNTELMIVGRAFVIVLVALSVAWIPIIQHFQGDELYIYIQAIAAYLTPPIASVYLCAVLWKRCNEKGAFTGLIYGLIIGLIRMILTLVYVDPICGEADTRPWFIKNIHYMYFAVFSFTSTAILVIVVSLFSAPPTPNQLHRLTYWTAWNSNKEDGNDEIKHSSGSIDSQLHIVDYLTAPGLVSP---IDFKTTVNKPNSRITFKFICLWLCGMENLPCSRFSEMTDKIDESKKLHFMRKEEALTKARLNSITSLHQDPRAKFGLLIGLIGIISLSIFGYIFYSLYFGEIAIGPIPLVGNSTLIQKYSKY 733          
BLAST of Sodium/myo-inositol cotransporter vs. TrEMBL
Match: A0A068XTY2 (Sodium:myo inositol cotransporter OS=Echinococcus multilocularis OX=6211 GN=EmuJ_001173900 PE=4 SV=1)

HSP 1 Score: 704.516 bits (1817), Expect = 0.000e+0
Identity = 369/679 (54.34%), Postives = 462/679 (68.04%), Query Frame = 2
Query:  236 DISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIA--RVNETQLPAIL---------------------------NSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTYWNYWKQDSITP--------------------EDIIFSVPLREKSIVVPKKEIDLELENVGGR-HKCKMMLLRYWNKFLGISNTGETDSSVLPITEEQSESLFRKSILNRLYQ 2122
            DI+V+VIYF+ ++ TG  +M R+  ++++GYFLAG+FM W+PVGASLFASNIGSEHFIGL GSGAAKGI VGAFE NA+ILL LLGWVFLPV+I+SGA+TLP+YM KRFGG R+Q YL V+SL++YIFTKISVNLYS SLFI EAL  NIW S+   LA+T LIT++GGLAAVLYTD  Q  +M+ G+++LT I F+KIGG   L E YG +I+   VN T   A++                            S+ L C LPS+ AF M R + D +MPWLG+I GQTPASIWYWC DQMMVQRVL+AK+LSHA+G T+ AG +KL PLFI+VMPGMISRIL+PD + C TAE C R+C    GCS+LAYPKLV+ ++PDGLRGLML+VMLAAL+SDLTSIFNS+STLFTVDIY   R  A+NRELMI+GR+FVL+M+ LSILW+PVIQ MQGGQL+IYIQ+++G+LSPPIAA YV A+   R NE GA T LIYG +IG  RMI+ FV+ +  C + DTRP+   K H+MYFA+FSF S  +VM ++SLL+ P  +      T+W      + T                     E+I  ++P  EK   V  KE+  +L     R  K  + L R       I N  E  S  L   +E+ E +  K   N   Q
Sbjct:   10 DIAVLVIYFLVVLGTGLFAMFRARVNSVQGYFLAGRFMTWIPVGASLFASNIGSEHFIGLGGSGAAKGIAVGAFEFNAAILLQLLGWVFLPVYISSGAFTLPDYMKKRFGGSRIQIYLTVLSLLLYIFTKISVNLYSGSLFITEALGWNIWFSILFTLAMTALITISGGLAAVLYTDLVQTCVMLFGAVLLTAIGFSKIGGFKGLLEFYGASISAIDVNATAGAALIMNIRDVASSEALAGLTPTVDSVAASPNTSADLKCALPSRSAFVMLRDVSDPEMPWLGYIFGQTPASIWYWCADQMMVQRVLAAKSLSHAQGATLMAGFIKLFPLFIIVMPGMISRILYPDTLGCGTAEQCYRICGNRYGCSDLAYPKLVMGVMPDGLRGLMLAVMLAALMSDLTSIFNSSSTLFTVDIYACFRRKASNRELMIVGRIFVLVMVALSILWVPVIQTMQGGQLYIYIQSVAGFLSPPIAAVYVTALLSKRTNELGAFTGLIYGFLIGLTRMILSFVYSDPVCGEEDTRPWIVAKVHYMYFAMFSFFSTAIVMCLVSLLSPPPSEEQVRGLTFWTRNVSSATTAASSISVTDTDTVVKHEMRLGEEINSNLPEDEKPGEVKVKEMGDQLTEDKERIAKNDLPLKRL------IVNESENKSEGLGDMDERDEEVMTKVGSNSCDQ 682          
BLAST of Sodium/myo-inositol cotransporter vs. TrEMBL
Match: W6U3C3 (Sodium/myo-inositol cotransporter OS=Echinococcus granulosus OX=6210 GN=EGR_09523 PE=4 SV=1)

HSP 1 Score: 704.131 bits (1816), Expect = 0.000e+0
Identity = 366/678 (53.98%), Postives = 461/678 (67.99%), Query Frame = 2
Query:  236 DISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIA--RVNETQLPAIL---------------------------NSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTYWNYWKQDSITP--------------------EDIIFSVPLREKSIVVPKKEIDLELENVGGRHKCKMMLLRYWNKFLGISNTGETDSSVLPITEEQSESLFRKSILNRLYQ 2122
            DI+V+VIYF+ ++ TG  +M R+  ++++GYFLAG+FM W+PVGASLFASNIGSEHFIGL GSGAAKGI VGAFE NA+ILL LLGWVFLPV+I+SGA+TLP+YM KRFGG R+Q YL V+SL++YIFTKISVNLYS SLFI EAL  NIW S+   LA+T +IT++GGLAAVLYTD  Q  +M+ G+++LT I F+KIGG   L + YG AI+   VN T   A++                            S+ L C LPS+ AF M R + D +MPWLG+I GQTPASIWYWC DQMMVQRVL+AK+LSHA+G T+ AG +KL PLFI+VMPGMISRIL+PD + C TAE C R+C    GCS+LAYPKLV+ ++PDGLRGLML+VMLAAL+SDLTSIFNS+STLFTVDIY   R  A+NRELMI+GR+FVL+M+ LSILW+PVIQ MQGGQL+IYIQ+++G+LSPPIAA YV A+   R NE GA T LIYG +IG  RMI+ FV+ +  C + DTRP+   K H+MYFA+FSF S  +VM ++SLL+ P  +      T+W      + T                     E+I  ++P  EK   V  KE+  +L     R     + L+       I N  E  S  L   +E+ E +  K   N   Q
Sbjct:   10 DIAVLVIYFLVVLGTGLFAMFRARVNSVQGYFLAGRFMTWIPVGASLFASNIGSEHFIGLGGSGAAKGIAVGAFEFNAAILLQLLGWVFLPVYISSGAFTLPDYMKKRFGGSRIQIYLTVLSLLLYIFTKISVNLYSGSLFITEALGWNIWFSILFTLAMTAVITISGGLAAVLYTDLVQTCVMLFGAVLLTAIGFSKIGGFKGLLDFYGAAISAIDVNATAGAALIMNIRGVASSEASPGLTPTVDSVAASPNTSADLKCALPSRSAFVMLRDVSDPEMPWLGYIFGQTPASIWYWCADQMMVQRVLAAKSLSHAQGATLMAGFIKLFPLFIIVMPGMISRILYPDTLGCGTAEQCYRICGNRYGCSDLAYPKLVMGVMPDGLRGLMLAVMLAALMSDLTSIFNSSSTLFTVDIYACFRRKASNRELMIVGRIFVLVMVALSILWVPVIQTMQGGQLYIYIQSVAGFLSPPIAAVYVTALLSKRTNELGAFTGLIYGFLIGITRMILSFVYSDPVCGEEDTRPWIVAKVHYMYFAMFSFFSTAIVMCLVSLLSPPPSEEQVRGLTFWTRNVSSATTAASSISVTDTDTVVQHEMRLGEEINSNLPEDEKPGEVKVKEMGDQLTEDEERIAKNDLPLKKL-----IVNESENKSDGLGDMDERDEEVMTKVGSNSCNQ 682          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Cavefish
Match: slc5a3b (solute carrier family 5 member 3 [Source:NCBI gene;Acc:103035105])

HSP 1 Score: 619.387 bits (1596), Expect = 0.000e+0
Identity = 300/575 (52.17%), Postives = 427/575 (74.26%), Query Frame = 2
Query:  236 DISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSS---TLHCYL-PSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTYWNYWKQDSITPEDIIFSVPLREKSIVVPKKEID 1948
            DI+V+ +YF+ ++  GF +  ++NR T+ GYFLAG+ M W+ +GASLF SNIGSEHFIGLAGSGAA G  VGA+E NA +LL LLGWVF+PV+I+SG YT+PEY+ KR+GG+R++ Y A +SL++YIFTK+SV+LY+ +LFI+E+L  N++LS+ +L+ +T ++TVTGGL AV+YTDT Q ++M+ G++ LTVIS  K+GG+  + EKY +A+   N T + A  N S   T  C + P   + ++ R   D D+PW GF+LGQTPASIWYWC DQ++VQRVL+AKN++HAKG T+ AG+LK+LP+FI+V+PGMISRILF DE+AC   E C+ VC   +GCSN+AYP+LV+ ++P GLRGLM++VM+AAL+SDL SIFNSAST+FT+DIY+++R  A++REL+I+GRLFV+ M+ +S+ W+PVI  MQGGQ+++YIQ +SGYL+PPIAA +++ +FW R NE GA    + G ++G +R+++ F+++E  C+Q D RP F    H+MY A   F +  +VM+V+SL T P  K   +RTT W     + I  +D       RE++  +  K  D
Sbjct:   10 DIAVVALYFLLVLGIGFFATFKANRSTVSGYFLAGRSMNWVLIGASLFVSNIGSEHFIGLAGSGAASGFAVGAWEFNALLLLQLLGWVFIPVYIHSGVYTMPEYLSKRYGGRRLKVYFAALSLLLYIFTKLSVDLYAGALFIHESLGWNLYLSIILLITMTAVLTVTGGLVAVIYTDTIQAVLMIGGALSLTVISLMKVGGLEGVREKYMEAVP--NVTAILASYNHSFTYTNSCRIHPKPDSLKLLRGPLDEDIPWPGFLLGQTPASIWYWCADQVIVQRVLAAKNIAHAKGSTLMAGMLKVLPMFIIVIPGMISRILFADELACIGPEHCMAVCGSQAGCSNIAYPRLVMSVMPVGLRGLMMAVMIAALMSDLDSIFNSASTIFTLDIYKMVRSCASSRELVIVGRLFVIFMVTISLAWVPVIIEMQGGQMYLYIQEMSGYLTPPIAALFLLGVFWKRCNETGAFWGGMTGFVLGTLRLLLGFIYREPKCDQPDERPLFITHVHYMYIAAGLFWASGLVMVVVSLCTPPPTKERIQRTTLWGLRNIEKIPVKD-------REETYKLTNKSPD 575          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Cavefish
Match: slc5a1 (sodium/glucose cotransporter 1-like [Source:NCBI gene;Acc:103043740])

HSP 1 Score: 565.074 bits (1455), Expect = 0.000e+0
Identity = 303/630 (48.10%), Postives = 421/630 (66.83%), Query Frame = 2
Query:  230 PLDISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTYWNYWKQDSITPEDIIFSVPLREKSIVVPKKEID---LELENVGGRHKCKMMLLRYWNKFLGISNTGETDSSVLPITEEQSESLFRKSILN 2110
            P DISVIVIYF+ ++A G  +M R+NR T+ G+FLAG+ M+W P+GASLFASNIGS HF+GLAG+GAA GI +G FE NA +++ +LGW+F+P++I +G  T+PEY+ KRFGG+R++ YL+V+SL +YIFTKIS +++S ++FI +A++LNI+++V +LL +T L TVTGGLAAV+YTDT Q IIMV+GS IL   +F K+GG     E Y +AI        P+++ + +  CY P   +F +FR     D+PW G I G T  + WYWCTDQ++VQR LS KN+SH K G I  G LKLLP+F+MV PGMISRIL+ D VAC   E C   C    GC+N+AYPKLV+ L+P+GLRGLMLSVM+A+L+S LTSIFNSASTLFT+DIY  IR  A+ +ELMI GR+F++ +IG+SI W+P++Q  Q GQLF YIQ+++ YL+PPIAA + +AIF  R NEKGA   ++ GL IG  RMI +FV+    C Q    P+     H++YF L  +    ++++ ISLLT+P+  V   R      W   + T E +     L E      ++E+D   LE+E +     C     + +N F G       D    P   ++ E+  +K +++
Sbjct:   34 PADISVIVIYFLVVLAVGIWAMVRTNRSTVGGFFLAGRSMVWWPIGASLFASNIGSGHFVGLAGTGAAGGIAIGGFEWNALVVVLILGWLFVPIYIKAGVVTMPEYLKKRFGGQRIRIYLSVLSLFLYIFTKISADMFSGAIFITQAVDLNIYVAVVLLLLITALYTVTGGLAAVIYTDTLQTIIMVVGSFILMGFAFDKVGGYDQFQEAYMKAI--------PSVVGNISSACYTPRADSFHIFRDATTGDLPWPGLIFGLTIQAGWYWCTDQVIVQRCLSGKNMSHVKAGCILCGYLKLLPMFLMVFPGMISRILYTDAVACVVPEVCNEWCGTEVGCTNIAYPKLVLDLMPNGLRGLMLSVMMASLMSSLTSIFNSASTLFTMDIYAKIRHRASEKELMIAGRVFIVALIGISIAWIPIVQTAQSGQLFDYIQSVTSYLAPPIAAVFTLAIFCKRTNEKGAFYGMLIGLAIGLSRMITEFVYGTGSCAQETKCPYIICGIHYLYFGLILYGVSLILVLGISLLTKPIDDVHLHRLC----WSLRNSTEERL----DLGEDDW--NEEEVDSKALEVEELESEPSCWK---KAYNCFCGF------DQKKAPKLTKEEEAELKKQMMD 636          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Cavefish
Match: slc5a2 (solute carrier family 5 member 2 [Source:NCBI gene;Acc:103030281])

HSP 1 Score: 549.666 bits (1415), Expect = 0.000e+0
Identity = 291/622 (46.78%), Postives = 407/622 (65.43%), Query Frame = 2
Query:  230 PLDISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIAR--VNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTY-WNYWKQDSITPEDIIFSVPLREKSIVVPKKEIDLELENVGGRHKCKMMLLRYWNKFLGISNTGETDSSVLPITEEQSES 2086
            P DI+VI+ YFV +I  G  SM R+NR T+ GYFLAG+ M+W PVGASLFASNIGS HF+GLAG+GAA GI VG FE NA  ++ LLGW+F+PV++ +G  T+P+Y+ KRFGG R+  YL+V+SL +YIFTKISV+++S ++FI +AL  NI+++V  LL +T L TVTGGLAA++YTDT Q  I++ G+ +L   SF ++GG S L EKY  A+    +  +  P + N S+  CY P + AF + R     D+PW G + G      WYWCTDQ++VQR L+A++L+H K G I  G LKLLP+F+MV PGMISR+L+PDEV C     C  VC    GCSN+AYPKLV+ ++P+GLRGLML+VMLAAL+S L SIFNS+STLFT+DI+  IRP A +RELMI+GR++VL ++ +SI W+PV+Q  Q GQLF YIQ+++ YL+PPIAA + +AIF  R NE GA   L+ GL++G  RM  +F +    C      P      H++YFA+  F    ++++++S  T P+      R  +   + K+D +  +        + +  V  K +     EN   + K  ++ L  W  F G+S +   +    P  EE +E+
Sbjct:   13 PADITVILGYFVIVIGVGIWSMFRTNRGTVGGYFLAGRTMVWWPVGASLFASNIGSGHFVGLAGTGAASGIAVGGFEWNALFIVLLLGWLFVPVYLTAGVITMPQYLKKRFGGTRISLYLSVISLFLYIFTKISVDMFSGAVFIQQALGWNIYIAVIALLTITALYTVTGGLAALMYTDTVQTFIIIAGAFVLMGFSFREVGGYSTLLEKYSSALPSPSLRLSPSPHLYNISS-ACYTPRQDAFNLLRDPVTGDLPWPGVVFGIAIVGGWYWCTDQVIVQRCLAARSLTHVKAGCIMCGYLKLLPMFLMVFPGMISRVLYPDEVGCVVPSVCKEVCGTEVGCSNIAYPKLVVSVMPNGLRGLMLAVMLAALMSSLASIFNSSSTLFTMDIWTRIRPQARDRELMIVGRVWVLCIVAISICWIPVVQAAQSGQLFDYIQSVTSYLAPPIAAVFFLAIFVKRVNEPGAFWGLMGGLLMGLCRMGPEFYFGSGSCLFPSNCPKLICGVHYLYFAVLLFFCTGILVLLVSYWTPPINDRHLHRLVFSLRHSKEDRVDLDWEEVERGRKARREVEEKNKATRNEENETNKDKSAILRLIGW--FCGLSGSQAPE----PTEEEVAEA 627          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Cavefish
Match: slc5a11 (solute carrier family 5 member 11 [Source:NCBI gene;Acc:103032324])

HSP 1 Score: 546.199 bits (1406), Expect = 0.000e+0
Identity = 295/592 (49.83%), Postives = 417/592 (70.44%), Query Frame = 2
Query:  236 DISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTYWNYWKQDSITPEDI---IFSVPLREKSIVVPKKEIDLELENVG-GRHKCKMMLL 1999
            DI+V+V+YF+ ++A G  SM ++ R T+ GYFLAG+ M W PVG SLFASN+GS HFIGLAGSGAA GIG  A+E N  +++ LLGW+FLP++I +G  T+PEY+ +RFGGKR+Q ++AV+ L +YIFTKISV++Y+ ++FI +AL  +I+L+V +LL +T L TV GGLAAV+YTD  Q +IM++G++ L   SFA++GG  ALF+ Y  AI        P+I + +T  C +P + AF +FR    +D+PW G +LG +  S+WYWC+DQ++VQR L+AKNL HAKGG++ A  LK+LP F+MV+PGMISRIL+PDEV CA  E C  VC  + GCS++AY KLV+ LLP GLRGLM++VMLAAL+S LTSIFNS+STLFT+D++R IR  A   ELMI+GR+FVL+++ +S+LW+P++Q+ QGGQLFIYIQ+IS YL PP++  ++   FW R NEKGA   L+ GL++G VRMI+DFV+    C ++D+RP   +  H++YF++        V++ +SL TE   +    R T++  +    I+  D    IF+V  +        +E  ++  N G  + K K  LL
Sbjct:   28 DIAVLVVYFLLILAVGLWSMWKTKRSTVSGYFLAGKNMTWWPVGTSLFASNVGSGHFIGLAGSGAASGIGPTAYEWNGMLMVLLLGWLFLPIYIAAGVTTMPEYLQRRFGGKRIQIFIAVLYLFIYIFTKISVDMYAGAVFIQQALGWDIYLAVILLLVITALYTVAGGLAAVIYTDAAQTLIMLMGALTLMGFSFAEVGGWQALFDGYSNAI--------PSIRDPNT-TCGIPREDAFHIFRHPVTSDLPWPGVLLGMSIPSMWYWCSDQVIVQRSLAAKNLLHAKGGSLLASYLKVLPFFMMVLPGMISRILYPDEVGCADPEVCKEVCGNSVGCSDIAYAKLVMNLLPAGLRGLMMAVMLAALMSSLTSIFNSSSTLFTMDLWRHIRRAATEWELMIVGRVFVLVLVVVSVLWIPLVQSSQGGQLFIYIQSISIYLQPPVSVVFMAGCFWRRTNEKGAFWGLVLGLLVGVVRMILDFVYPAPQCFESDSRPDVIKYVHYLYFSIILSLLTLAVVVCVSLATEKPTREQISRLTWFTRFDPVQISEVDKEAGIFTVDEKRGETT---EEPIIDTGNAGKAQSKLKATLL 607          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Cavefish
Match: slc5a1 (solute carrier family 5 member 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1524])

HSP 1 Score: 530.791 bits (1366), Expect = 8.132e-180
Identity = 274/554 (49.46%), Postives = 388/554 (70.04%), Query Frame = 2
Query:  230 PLDISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTYWNYWKQDSITPEDI 1891
            P DISVIV+YF+ ++A G  +M R+NR TI G+FLAG+ M+W P+GASLFASNIGS HF+GLAG+GAA GI +G FE NA +++ +LGWVF+P++I SG  T+PEY+ KRFGG+R++ YL+++SL++Y+FTKIS ++YS ++FI +A+++NI+L+V +LL +T L TVTGGLAAV+YTDT Q IIMV+GS +L   +F K+GG     + Y  +I        P ++ + +  CY P   +F +FR     D+PW G I G T  + WYWCTDQ++VQR LSAKN+SH K G I  G LKLLP+FIMV PGMISRIL+PD+VAC   E C  +C    GC+N+AYPKLV+++LP+GLRGLMLSVMLA+L+S LTSIFN++                  +ELMI GR+F++++IG+SI W+P++Q+ QGGQLF Y Q+++ YL+PPIAA +++AIF  R NE+G    +++GL +G  RMI +F +    C Q    P+     H++YF +  F   C+V++ ISLLT+P+    +E+  +   W   + T E +
Sbjct:   21 PADISVIVLYFLVVLAVGVWAMVRTNRSTIGGFFLAGRNMVWWPIGASLFASNIGSVHFVGLAGTGAAAGIAIGGFEWNALVMMIILGWVFVPIYIKSGVVTMPEYLKKRFGGQRIRIYLSLLSLILYVFTKISADIYSGAIFINQAVDVNIYLAVVLLLVITALYTVTGGLAAVIYTDTLQTIIMVLGSFVLVGFAFDKVGGYDKFHDAYMNSI--------PMVVGNVSSECYTPRADSFHIFRDATTGDLPWPGLIFGLTIQAAWYWCTDQVIVQRCLSAKNMSHVKAGCILCGYLKLLPMFIMVFPGMISRILYPDDVACVVPEICNDLCGTEVGCTNIAYPKLVMEILPNGLRGLMLSVMLASLMSSLTSIFNTS-----------------EKELMIAGRVFIVVLIGVSIAWIPMVQSAQGGQLFDYTQSVTSYLAPPIAAVFILAIFCKRTNEQGVFYGMLFGLAVGLSRMIAEFAYGSGSCAQVPDCPYIICGIHYLYFGIILFGISCIVILGISLLTKPI----DEKHLHRLCWSLRNSTEERV 545          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Sea Lamprey
Match: slc5a1 (solute carrier family 5 member 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1524])

HSP 1 Score: 550.051 bits (1416), Expect = 0.000e+0
Identity = 285/528 (53.98%), Postives = 379/528 (71.78%), Query Frame = 2
Query:  236 DISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPL 1819
            DI+VIV YFV ++  G  +M +SNR T+ G+FLAG+ M+W P+GASLFASNIGS HF+GLAGSGAA GI  G FE NA  ++ LLGW+F+P++I +G  T+PEY+ KRFGG R+Q YL+ +SL++Y+ TKIS +++S  +FI +A+ LNI+L+V  LL +TGL TVTGGL AV+YTDT Q +IM++GS+IL V +F  +GG  A++EKY  AI     T  P  +N S   CY P   +  + R     D+PW G + G T  + WYWCTDQ++VQR LSAK++SH KGG I  G LKLLP+++MVMPGMISRIL+ D VAC   E C   C    GC+N+AYP LVI L+P+GLRGLMLSVMLA+L+S LTSIFNSASTLFT+DIY  IR  A  RELM+ GR+F+L++IG+SI W+P+I+  Q GQLF YIQ+I+ YL PPIAA +++AIF  R NE+GA   LI G +IG  R+I +F +    C+     P      H++YFA+  F+  CV+++VISL T+P+
Sbjct:   28 DIAVIVCYFVFVLGVGLWAMYKSNRSTVGGFFLAGRSMVWWPIGASLFASNIGSGHFVGLAGSGAAAGIAQGGFEWNALFIVVLLGWLFVPIYITAGVVTMPEYLKKRFGGNRIQYYLSGLSLILYVLTKISADMFSGGIFIRQAIGLNIYLAVICLLIITGLYTVTGGLTAVIYTDTVQTVIMLVGSLILMVFAFNAVGGYDAMYEKYMLAIP----TPPPPEMNISE-ECYTPRPDSLNLLRDPITGDLPWPGLLFGLTIIATWYWCTDQVIVQRCLSAKDMSHVKGGCIMCGYLKLLPMYLMVMPGMISRILYTDVVACVEPEKCKEYCDTDVGCTNIAYPLLVINLMPNGLRGLMLSVMLASLMSSLTSIFNSASTLFTLDIYNKIRTSATERELMLAGRVFILVLIGISIAWIPIIEGAQSGQLFDYIQSITSYLGPPIAAVFLLAIFVKRVNEEGAFWGLILGFLIGMSRLITEFAYGTGSCKNKTNCPTIICGVHYLYFAIILFTITCVLVVVISLFTKPI 550          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Sea Lamprey
Match: slc5a3a (solute carrier family 5 member 3a [Source:ZFIN;Acc:ZDB-GENE-090312-3])

HSP 1 Score: 476.093 bits (1224), Expect = 8.147e-161
Identity = 253/506 (50.00%), Postives = 374/506 (73.91%), Query Frame = 2
Query:  209 KMLKNIGPLDISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSG--AYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTL---HCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVA--NNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQ 1705
             M + +  +DI+++ +YFV + A G  +M RSNR ++ GYFLAG+ M WLPVGASLF SNIGSEHFIGLAGSGAA G+ V A+ELNA +LL LL WVF PV++ +G    T+P Y+ +RFGG+R++ YL V+SL++Y+ TK+SV+LY+ ++FI ++L  ++++S+  L+  T L+T+ GGLAAV+YTDT Q  +MV G++ L V+   K+GG+  ++  Y +A+  V   +    L++  L       P   + ++ R   D++ PW GF+LGQTPASIWYWCTDQ++VQR+L+A++ S+AKG T+ AG LK+LP+F +V+PGMI+RIL PDE+AC + E C  VC   +GCSN+AYP+LV+ ++P GLRGLM++V++AAL+SDL SIFNSAS++FT+DIYR  R V   ++RELMI+GRL+V++M+ +S+ W+PV+ +MQGGQ+F+YIQ ++GYL+PP+AA +++ +FW R NEKGA    + G  +G  R+++ F++    C Q
Sbjct:   19 AMAERLESVDIAIVGLYFVLVFAVGLWAMRRSNRASVSGYFLAGRAMSWLPVGASLFVSNIGSEHFIGLAGSGAASGLAVAAWELNALLLLQLLSWVFYPVYLATGFGVCTMPGYLARRFGGRRLRVYLVVLSLLLYVLTKVSVDLYAGAVFIQQSLGWDLYVSIVSLIGATALLTMAGGLAAVIYTDTLQAALMVGGALTLMVLGLVKVGGLQNVWSGYMEAVPNVTAIRAAYNLSAGPLCEAAIARPHANSLKVLRGPFDSETPWPGFLLGQTPASIWYWCTDQVIVQRMLAARDHSNAKGATLLAGALKILPMFAIVVPGMIARILMPDELACVSPEHCTAVCGNPAGCSNVAYPRLVLAVMPTGLRGLMMAVIVAALMSDLDSIFNSASSIFTLDIYRHARGVTRVSSRELMIVGRLWVVVMMAVSVAWVPVVVSMQGGQMFLYIQEMAGYLTPPVAAIFLLGVFWKRCNEKGAFCGGLVGSTLGFARLLLAFIYPPPDCTQ 524          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Sea Lamprey
Match: slc5a9 (solute carrier family 5 member 9 [Source:NCBI gene;Acc:564815])

HSP 1 Score: 475.322 bits (1222), Expect = 4.981e-160
Identity = 256/543 (47.15%), Postives = 361/543 (66.48%), Query Frame = 2
Query:  281 GFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELN-------------------------ASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFP--DEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLT-EPLPK 1825
            G  + CR+NR T+ GYFLAG+ M WLP+GASL +SN+GS  FIGLAGSGAA GI +G FE N                         AS +L  LGWVF+PV+I +G  T+P Y+ +RFGG+R   YL+ +SL +Y+FTKIS ++++ ++FI  +L  +I+LS  VL+A+T + T+ GGLAAV+YTD  Q +IMV+G++IL  I   K+ G   +   Y  A+  V       + N++   C+ P   A  + R     D+PW G I G T  + W WCTDQ++VQR LSA++LSHAK G++ AG LK+LP+F +V PGM+SR +FP  DEVAC   ++C RVC    GCSN+AYPKLV++L+P GLRGLM++VM+AAL+S LTSIFNS+ T+FT+D+++  RP A+  ELM++GRLFVLL++ +SILWLPV+Q    G+LF YIQ+++ +L+PPI A +++AIFW R NE GA  +L+ GL IG  RM ++F +    C + D RP   +  H++YFAL       ++ ++ISL T  P P+
Sbjct:   20 GMWASCRTNRSTVGGYFLAGRTMTWLPIGASLMSSNVGSGLFIGLAGSGAAGGIAIGGFEWNVYLSRETSQWVLHLDADSTIELRFWASWVLVALGWVFVPVYITAGVLTMPGYLRRRFGGQR-SLYLSGLSLALYVFTKISTDIFAGAIFIKVSLGWDIYLSTVVLIAVTAIYTIAGGLAAVIYTDALQTVIMVVGAMILMGIGLVKLDGYEGMARSYMAAVPNVT------VPNTT---CHQPRADALHLLRDPVQGDLPWPGLIFGLTVLATWNWCTDQVIVQRSLSARSLSHAKAGSVLAGFLKVLPMFFIVWPGMMSRAMFPALDEVACVVPDECQRVCGSKVGCSNIAYPKLVVELMPTGLRGLMMAVMVAALMSSLTSIFNSSGTIFTIDVWKRFRPRASEMELMVVGRLFVLLLVIISILWLPVVQVANSGRLFDYIQSVTSFLAPPITAIFLLAIFWPRMNEPGAFWALMCGLAIGVSRMALEFSFPPPACGEADRRPPVLRDVHYLYFALLLCGLTALIGVIISLATPAPHPQ 552          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003316.1 (pep scaffold:Pmarinus_7.0:GL476336:129493:160966:1 gene:ENSPMAG00000003020.1 transcript:ENSPMAT00000003316.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 354.369 bits (908), Expect = 1.079e-114
Identity = 190/419 (45.35%), Postives = 282/419 (67.30%), Query Frame = 2
Query:  635 NLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNE-KGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERT----TYWNYWKQDSI 1876
            ++Y+ ++FI   L  +++ S+ +LL +T + T+TGGL AV+YTDTFQ +IM++GS +L ++SF K+GG   L  +Y +A        +P +  +    C  P   AF +FR     D PW G +LG    S WY+CTDQ++VQR +SAKNL+HAKGG++ A   K+LPLF++++PGMISR+LF +EVACAT E C   C   +GC+N+AYPKLV++L+P GL+G+ML+ M+AAL+S LTS+FNS+ST+FT+D++  +RP A+ +ELMI+GR+FVL+++GLSI W+PV+Q  Q GQLF YIQ+++GY +PPI   Y+++IFW   NE +GA   L+ G + G +RM +DF +    C   D RP    + HF++F +  F     VM+ +SL+T     V  +R     T+W+ WK   I
Sbjct:    1 DMYAGAIFIQLTLGWDLYTSIILLLGVTAIYTITGGLKAVIYTDTFQLVIMLVGSFVLMILSFMKVGGFEELQLRYSRA--------MPNVTLAGNTTCGTPRSDAFHIFRDATHGDYPWPGVVLGIPILSAWYFCTDQVLVQRSISAKNLTHAKGGSVLAAYCKILPLFLLILPGMISRVLFTEEVACATRETCQEACGNPAGCTNIAYPKLVVELMPPGLKGVMLAAMMAALMSSLTSVFNSSSTIFTMDLWARLRPRASEQELMIVGRVFVLVLVGLSIAWIPVLQASQSGQLFDYIQSVTGYFAPPILMVYLLSIFWEGFNEQQGAFWGLMAGFLTGVIRMGLDFGYGTPACGDPDPRPPVLARVHFLHFTVLLFVLVGAVMVAVSLVTR--RSVGTKRDLAGLTWWSRWKDTPI 409          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Sea Lamprey
Match: slc5a5 (solute carrier family 5 member 5 [Source:ZFIN;Acc:ZDB-GENE-060503-585])

HSP 1 Score: 83.9593 bits (206), Expect = 1.357e-17
Identity = 91/367 (24.80%), Postives = 157/367 (42.78%), Query Frame = 2
Query:  230 PLDISVIVIYFVCLIATG-FISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVM-PGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPD--GLRGLMLS 1318
            P D  V  +  +   + G F ++    + T   +F+ G+ +  LPVG SL AS + +   +G+ G     G       L  S+ + +  +VFLPVF   G  +  +Y+  RF      C      +   ++T + +  Y+ +L + +   L+IW SV    A+    T  GG+ AV++TD FQ ++M+ G   + +    ++GGIS        AI+RVN                  S+  F  F P       +     G T   +  +  +Q  VQR L+ ++ + A+     A  + LL L+++V   GM   ++F      A  +DC  +        +   P  V+ +  +  G+ GL LS
Sbjct:    4 PWDYCVFAVMLLVSTSIGIFYALRGGGQRTTGDFFMGGRHLSALPVGLSLSASFMSAVQVLGVPGEAYRYGAKFLQMCLGQSVNVFITAYVFLPVFYRLGITSTYQYLEMRFNKVVRLCGTTQYIVATVLYTGVVI--YAPALILNQVTGLSIWFSVLSSGAICTFYTTIGGMKAVVWTDAFQVMVMLAGFWAVLIQGTMEVGGIST-------AISRVNNG----------------SRINFGDFDPDPRRRYTFWTLTTGATLLWLSMYGVNQAQVQRYLACRSETQARR----ALFVNLLGLWVIVCSAGMCGLVMF------ALYKDCDPLQAGLVTAPDQLMPYFVLDIFENIPGVPGLFLS 335          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Nematostella
Match: EDO44833 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUY5])

HSP 1 Score: 575.859 bits (1483), Expect = 0.000e+0
Identity = 312/550 (56.73%), Postives = 416/550 (75.64%), Query Frame = 2
Query:  230 PLDISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTYWNYWKQDSIT 1879
            P D++++V+YFV ++  G  +M +S R T+ GYFLAG+FM WLPVGASLFASNIGSEHFIGLAGSGAA GIGVGAFE NA ILL LLGWVFLPV+I  G  TLPEY+++R+GG+R++ +L+++S+++YIFTKISVNL+S +LFI  AL  N++L++ ++L LT L T+TGGLAAV+YTDT    +M +GS+ +  + F+KIGG S L EKY +A+A  NET    + +++T  C  P   +F M R   ++D+PW GF+LGQT ASIWYWC DQ++VQR L+AK+LSHA+G  +FAG +K+LPLF +VMPGMISR+L PD VAC+T E C+ VC    GCSN+AYP+LV+K++P GLRGLM++VM+AAL+SDLTSIFNSASTLFT+D+Y  IR  A+ RELMI+GR+ V +M G+ ILW+PV+QN+QGGQLFIYIQA+S Y SPPIA  YVV+I W++  EKGA   ++ G ++G +RM++DFV+    C + DTRP      H+MYFAL  F    + ++VISLLT+P       R T+W    + S T
Sbjct:   14 PADVAIVVLYFVVVVGVGIYAMFKSTRSTVSGYFLAGRFMTWLPVGASLFASNIGSEHFIGLAGSGAAAGIGVGAFEFNALILLQLLGWVFLPVYIAGGVCTLPEYINRRYGGQRIRVWLSILSILLYIFTKISVNLFSGALFIKLALGWNLYLAILLMLFLTCLCTITGGLAAVIYTDTLCTFLMGVGSLTVMGMGFSKIGGYSGLQEKYMKAVA--NET----LYSNNT--CGWPRHDSFTMLRDPVNSDIPWPGFLLGQTVASIWYWCADQVIVQRALAAKSLSHAQGACLFAGYIKILPLFTLVMPGMISRVLSPDRVACSTRESCMAVCGSEVGCSNIAYPELVLKIMPTGLRGLMMAVMMAALMSDLTSIFNSASTLFTIDVYGRIRSKASVRELMIVGRVMVAVMTGIGILWIPVVQNVQGGQLFIYIQAVSAYFSPPIACLYVVSILWTKATEKGAFWGMVIGFVVGAIRMVLDFVYLAPLCGEADTRPAITANLHYMYFALVLFWITAIAIVVISLLTKPHEGANTARLTWWTLKDEFSTT 555          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Nematostella
Match: EDO43582 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY63])

HSP 1 Score: 533.102 bits (1372), Expect = 1.267e-180
Identity = 310/662 (46.83%), Postives = 433/662 (65.41%), Query Frame = 2
Query:  233 LDISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSG-AYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTYWNYW------------KQDSITPEDIIFSVPLREKSIVVPKKEIDLELENV----GGRHKCKMMLLRYWNKFL-GISNTGETDSSVLPITEEQSESLFRKSILNRLYQRKRDRYILNVLMVL 2164
            LD+  I++YF+ ++A    +M ++NR T+ GYFLAG+ M WLPVGAS+FASNIGSEH IGLAGSGAA G GVG+FE+NA I++     V   V  + G   TLPEY+H+RFGG+R++ +L+V+SL++YIFTKISVNLYS +LFI  AL  N++ ++ +LL L  L T+TGGLAAV+YTDT    +M +GS+ +  + FA++GG   L  KY  A++  N T     L+S+T  C  P + +F++ R    +D+PW GFI+G+T  SIWYWC DQ++VQR LS+K+LSHA+G  +FAG +K+LPLF M++PGMISR+L P+ VAC+T E C+ VC    GCSN+A+P+LV+K++P GLRGLM++VM+AAL+SDLTSIFNSASTLFT+D+Y   R  A+ RELMI+GR+ V +M G+ ILW+PVIQN+QGGQLF+YIQA++ YLSPPIA+ YV+A+FW R  E GA   ++ G ++G +RMI+DF ++   C   D RP      H+MYFA+ +F+   V +++ISL T+P P     R T+W               + D I  E +  S   R K           +LEN     G     K   LR +  ++ G       D++     E Q     R  ++  L Q  R +  LN  +V+
Sbjct:   13 LDVVFIMLYFIVVMAICIYAMTKTNRATVSGYFLAGRLMTWLPVGASVFASNIGSEHLIGLAGSGAAAGFGVGSFEINAMIMIDAWLAVRSSVHRSRGRVCTLPEYIHRRFGGQRIRVWLSVLSLLLYIFTKISVNLYSGALFINLALGWNLYAAIILLLGLACLCTITGGLAAVIYTDTLCTFLMTLGSLTVMSLGFAEVGGYEGLKSKYMVAVS--NHT-----LHSNT-SCGWPRQDSFKLLRDPVYSDIPWPGFIIGETIVSIWYWCADQVIVQRTLSSKSLSHAQGACLFAGWIKVLPLFTMLIPGMISRVLSPERVACSTPEQCMAVCGSEVGCSNIAFPELVLKIMPSGLRGLMMAVMMAALMSDLTSIFNSASTLFTIDVYGRFRSKASVRELMIVGRVMVAVMTGVGILWIPVIQNVQGGQLFVYIQAVTAYLSPPIASIYVLALFWKRTTEMGAFWGMMIGFVVGALRMILDFRYQSPRCGDADERPAITANVHYMYFAIVAFAISTVSIVIISLFTKPHPGANTARLTWWTRHDASASSDHPEEERDDEIAMEHVTLS---RGKQASCDSMTGSRDLENASCPEGTSEGSKQSRLRRFVSWVCGYEQVVSLDTARRTAVEHQQ----RMRLITSLEQDPRAKIFLNANLVV 659          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Nematostella
Match: EDO46199 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQP5])

HSP 1 Score: 489.96 bits (1260), Expect = 7.124e-165
Identity = 262/542 (48.34%), Postives = 378/542 (69.74%), Query Frame = 2
Query:  236 DISVIVIYFVCLIATGFISMCRSNR--DTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIA---RVNETQLPAILNSSTLH-CYLPSKKAFQMFRPLDDNDMPWLG------FILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPK 1825
            D ++I +YF   +A G  +  +  R  +T +GYFLAG+ M+W  VG SLFASNIGSEHFIGLAGSGAA GIGV  +E  A + + LLGWVF+P+++ S  +T+PEY++KRF  + ++ YL  ++L+ Y+FTKISV L++ S+F+YEA+ LNI+LS  V+LA+T + T+ GGL AV++TD  QC +M+IG+I+L ++ F K+GG S L+EK+ +A+    R   T LP  L ++T+  C+  +     MFRPLDD D PWLG      F++G     +WYWCTDQ++VQR L AKN  HA+ G +FAG LK  P+F+MVMPGMISR+LFPD +ACA +  C R C    GC+N AYPKLV+ +LP GL GLM++VM++AL+S L+S+FNS++T+F VDI+  IRP A  RE +I+GR+ V++++ LSI+WLP+I   QG +LF Y+Q I  Y SPP+A  + + I W   +E GA++ LI GL++G V+ I+  ++    C + D RP F  K HF+Y+ L  + +   VM+++SL T+P+P+
Sbjct:   13 DWAIIGVYFALCMAVGLYTKFKRQRGLETSEGYFLAGRSMMWWAVGPSLFASNIGSEHFIGLAGSGAASGIGVACYEWQACLCILLLGWVFVPIYLKSRVFTMPEYLNKRFQSRSIRTYLTAIALLSYVFTKISVVLFAGSVFLYEAVGLNIYLSATVMLAITAIYTLLGGLMAVIFTDVLQCTVMMIGAIVLCILGFDKVGGHSGLWEKFPKAVGKPWRPPNTSLPLNLTNATIESCFKVTPYWGNMFRPLDDPDYPWLGSWTTVFFVIG-----VWYWCTDQVIVQRALGAKNNVHARAGAVFAGFLKATPMFLMVMPGMISRVLFPDSIACADSVSCERHCGNKWGCTNNAYPKLVLNVLPTGLVGLMMAVMMSALMSSLSSVFNSSATIFVVDIWLRIRPKAGERERVIVGRVTVVVVVALSIVWLPII---QGNRLFEYLQTIQAYFSPPLAMVFTLCILWPGLSEVGALSGLIIGLVMGVVKFIVGNLFDPPECGKVDERPEFV-KLHFLYYGLIIYVASGAVMVIVSLFTKPVPR 545          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Nematostella
Match: EDO46200 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQP6])

HSP 1 Score: 461.84 bits (1187), Expect = 2.927e-155
Identity = 246/492 (50.00%), Postives = 345/492 (70.12%), Query Frame = 2
Query:  362 VGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTL----HCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPK 1825
            VG SLFASN+GSEHFIGLAGSGAA GI V ++E  A  +L LLG+VF+P+++ S  +T+PEY++KRF  + V+ YL + +L+ Y+FTK SV++Y+ S+F+YEA+  NI++S  V+LA+T + T+ GGL AV++TD  QC IM+IG+I+L ++SF K+GG   L+ K+G   A  +   L    NSS       CY  ++    MFRPLDD D PWLG         +WYWCTDQ++VQR L AKN  HAK G+IFAG+LK+LPLFIMVMPGMISR+LFPD +AC  +  C++ C    GC+N AYPKLV+ +LP GL GLM++VM+AAL+S L+S FNS++T+FTVD++ + RP A  RE +I+GR+ VL+++G+S++WLP+IQ   G QLF+YIQ I  YL+PPI  ++ + I W R  E GA+  L+ GL++G ++ I   ++    C   D RP F  KFHFM++ L  F    VV +++SL T P+P+
Sbjct:    1 VGPSLFASNMGSEHFIGLAGSGAATGIAVVSYEWQAVWVLLLLGYVFVPIYLKSRVFTMPEYLNKRFQSRSVRTYLTIAALISYVFTKTSVDIYAGSVFLYEAIGWNIYVSAAVILAITAIYTMLGGLMAVIFTDVLQCAIMIIGAIVLAILSFMKVGGHDGLWSKFGTIAATTSALNL---TNSSVALGAQSCYKLTQYWGNMFRPLDDPDYPWLGLWTTLPIMGVWYWCTDQVIVQRSLGAKNNVHAKAGSIFAGLLKILPLFIMVMPGMISRVLFPDSIACPDSRSCMKHCGNEWGCTNNAYPKLVLNVLPTGLVGLMMAVMMAALMSSLSSAFNSSATIFTVDVWLVCRPKAKEREKLIVGRVVVLILVGVSLVWLPIIQGALGSQLFVYIQTIQSYLAPPITMTFGLGILWPRLTEAGALCGLLVGLMMGLLKFIFGNIYTPPSCGVPDDRPGFV-KFHFMWYGLVIFGVTGVVEVLVSLFTTPVPR 488          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Nematostella
Match: EDO36358 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIT8])

HSP 1 Score: 65.855 bits (159), Expect = 8.939e-12
Identity = 75/298 (25.17%), Postives = 127/298 (42.62%), Query Frame = 2
Query:  221 NIGPLDISVIVIYFVCLIATG---FISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGG--KRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAK 1099
              G +D SV  I  + LI+TG   + ++    + T   + LA + M++LPV  SL AS + +   +G+       G        +  IL   +  VF+PVF      +  EY+ KRF    + +   L ++   +Y+    ++  Y  SL +       IW+S+  L  +    T  GG+ AV++ D  Q IIM++G + + V+   K+GG + +++   +  AR+                       F  F P     +     ++G        W  +Q  VQR LSAK+   AK
Sbjct:   10 RFGAVDYSVFAI--MLLISTGIGIYHALTGGKQKTTAEFLLANRKMMFLPVALSLLASFMSAITILGVPSEMYTFGTQYWMIISSYVILFPAVALVFVPVFRAVHITSSYEYLEKRFSLVIRSIGSALFIIQTCLYM----AIVTYGPSLALEAVTGFPIWVSIVALGVVCTFYTTIGGMKAVIWNDVLQAIIMLVGLVAVVVVGSQKVGGFTEVWKTMEKG-ARLK----------------------FIDFNPDPTQRLSIWSLMIGGAFGLFPLWAVNQTAVQRFLSAKSDKEAK 278          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Medaka
Match: slc5a3b (solute carrier family 5 member 3 [Source:NCBI gene;Acc:101171957])

HSP 1 Score: 596.66 bits (1537), Expect = 0.000e+0
Identity = 291/581 (50.09%), Postives = 410/581 (70.57%), Query Frame = 2
Query:  236 DISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTYWNYWKQDSI---TPEDIIFSVPLREKSIVVP--KKEIDLELEN 1963
            DI+V+ +YFV ++  G  +M ++N  T+ GYFLAG+ M W  +GASLF SNIGSEHFIGLAGSGAA G  V A+E NA +LL LLGWVF+PV+I+SG +T+P Y+ KRFGG R++ Y A +S+++YIFTK+SV+LY+ +LFI E++  N+++S+ +L+ +T L+TVTGGL AVLYTD  Q ++M+ G++ LT IS  K+GG+  +  KY QAI  V           S      P   + ++ R   D D+PW GF+LGQTPASIWYWC DQ++VQRVL+AKN++HAKG T+ AG LK+LP+F++V+PGMISRILF DE+AC   E C+ VC  A+GCSN+AYP+LV+ ++P GLRGLM++VM+AAL+SDL SIFNSAST+FT+DIY+  R  A+ REL+I+GR FV++M+ +S+ W+PV   MQGGQ ++YIQ ++GYL+PPIAA +++ +FW R NE GA    + G  +G +R+I+ FV+++  C+Q D RPFF    H+MYFA   F    +V +V+SLLT PL       TT W   K   +    P + I+ +  +     +P   KE+  +++N
Sbjct:    9 DIAVVALYFVLVMFIGLFAMWKANHSTVSGYFLAGRSMTWAVIGASLFVSNIGSEHFIGLAGSGAASGFAVAAWEFNALLLLQLLGWVFIPVYIHSGVFTMPAYLSKRFGGHRLKVYFACLSVLLYIFTKLSVDLYAGALFIQESVGWNLYVSIFLLIGMTALLTVTGGLVAVLYTDALQAVLMIGGALTLTTISLIKVGGLEGVRTKYMQAIPNVTAITAAGNYTYSPSCRIHPKPDSLRILRGPLDEDIPWPGFLLGQTPASIWYWCADQVIVQRVLAAKNIAHAKGATLMAGFLKVLPVFLIVIPGMISRILFADEIACIGPEHCMSVCGSAAGCSNIAYPRLVMAVMPVGLRGLMMAVMIAALMSDLDSIFNSASTIFTLDIYQTFRKKASQRELVIVGRTFVVIMVMISVAWVPVTIEMQGGQTYLYIQEVAGYLTPPIAALFLLGVFWKRCNETGAFWGGMTGFTLGSIRLILAFVYRQPRCDQPDDRPFFITHIHYMYFAAGLFWISGLVAVVVSLLTPPLDDEQTVTTTIWGLRKMQKVPMKNPSE-IYKLAEKNHCNGIPSLHKEMPADVKN 588          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Medaka
Match: slc5a1 (sodium/glucose cotransporter 1 [Source:NCBI gene;Acc:101175417])

HSP 1 Score: 567.385 bits (1461), Expect = 0.000e+0
Identity = 304/630 (48.25%), Postives = 416/630 (66.03%), Query Frame = 2
Query:  230 PLDISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTYWNYWKQDSITPEDIIFSVPLREKSIVVPKKEIDLELEN-VGGRHKCKMMLLRYWNKFLGISNT------GETDSSVLPITEEQSESLFRK 2098
            P DISVIVIYFV ++A G  +M R+NR T+ G+FLAG+ M+W P+GASLFASNIGS HF+G+AG+ AA GI  G FE NA I++ +LGW+F+P++I +G  T+PEY+ KRFGG R++ YL+++SL++Y+FTKIS +++S ++FI +AL LNI+++V  LL +T + TVTGGLAAV+YTDT Q IIMV+GS IL   +F ++GG       Y QA+        P+I  + +  CY P   +F +FR     D+PW G + G T  + WYWCTDQ++VQR LSAK+LSH KGG I  G LKLLP+F+MV PGMISRIL+PD VAC   ++C   C    GCSN+AYPKLV+ L+P+GLRGLMLSVMLA+L+S LTSIFNSASTLFT+DIY  IRP A  RELMI GR+F+L +IG+SI W+P++Q  Q GQLF YIQ+I+ YL+PP+AA +++AIF+ R NE GA   LI GL IG  RMI +FV+    C      P      H++YF +  F   C+++I ISL+T+P+      R  +                   LR ++    ++ +DLE ++ VGG    + +  +  +K  G          G  D+    ++ E+   L RK
Sbjct:   29 PADISVIVIYFVVVLAVGVWAMVRTNRSTVGGFFLAGRSMVWWPIGASLFASNIGSGHFVGIAGTAAAAGIATGGFEWNALIVVVILGWLFVPIYIKAGVVTMPEYLKKRFGGSRIRIYLSILSLILYVFTKISADMFSGAIFINQALGLNIYVAVIALLLITAIYTVTGGLAAVIYTDTLQTIIMVVGSFILMGFAFNEVGGYENFERLYMQAV--------PSITGNISAECYKPRPDSFHIFRDAITGDLPWPGLVFGLTIQATWYWCTDQVIVQRCLSAKSLSHVKGGCILCGYLKLLPMFLMVFPGMISRILYPDVVACVDPDECKSFCDSGVGCSNIAYPKLVVDLMPNGLRGLMLSVMLASLMSSLTSIFNSASTLFTMDIYTKIRPRAKERELMIAGRVFILGLIGVSIAWIPIVQTAQSGQLFDYIQSITSYLAPPVAAVFMLAIFYKRVNEPGAFYGLIIGLPIGLSRMIAEFVYGTGSCASPSDCPTIICGVHYLYFGIILFVLSCIIIIGISLMTKPIEDKHLYRLCF------------------SLRNRT----EERVDLEQDDWVGGDDDNESIDDKDSHKEPGACKKALMCFCGLEDNKAPKLSAEEEAELKRK 628          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Medaka
Match: slc5a2 (solute carrier family 5 member 2 [Source:NCBI gene;Acc:101155288])

HSP 1 Score: 564.688 bits (1454), Expect = 0.000e+0
Identity = 302/627 (48.17%), Postives = 417/627 (66.51%), Query Frame = 2
Query:  236 DISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTYWNYWKQDSITPEDIIFSVPLREKSIVVPKKEIDLELENVGGRHKCKMMLLRYWNKFLGISNTGETDSSVLPITEEQSESLFRKSILNRL 2116
            DISVIV YFV ++  GF SM R+NR T+ GYFLAG+ M W PVGASLFASNIGS HF+GLAG+GAA GI VG FE NA   + LLGW+F+PV++ +G  T+PEY+ KRFGG R+  YL+VVSL++YIFTKISV+++S ++FI +AL  NI+LSV  LL +T + TVTGGLAA++YTDT Q  +++ G+  LT  SFA+IGG SAL  KYG A+     +  P   N S+  CY P + AF + R     D+PW G + G + + IWYWC+DQ++VQR L+A++L+H K G I  G LKLLP+F+MV PGMISRIL+PDEV C   EDC R+C    GCSN+AYPKLV+ ++P GLRGLML+VMLAAL+S L SIFNS+STLFT+DI+  IRP A  REL+I+GR++VL ++ +SI W+PV+Q  Q GQLF YIQ++S YLSPPIAA +++A+F  R NE GA   LI GL +G  RM+ +F +    C      PF     H+++FA+  F    V+++++S+ +EP+    ++R  Y             ++FS+   ++     ++++D E +  G R K                   E  ++   + EE+     +KS++NR+
Sbjct:   15 DISVIVGYFVMVLGVGFWSMFRTNRGTVGGYFLAGRSMSWWPVGASLFASNIGSGHFVGLAGTGAASGIAVGGFEWNALFTVLLLGWLFVPVYLTAGVITMPEYLKKRFGGTRISLYLSVVSLLLYIFTKISVDMFSGAVFIQQALGWNIYLSVIALLIITAVYTVTGGLAALMYTDTVQTFVIIAGAFALTGFSFAEIGGYSALLAKYGSAVPHNYTSLDPQRYNISS-QCYTPRQDAFTLLRNPTTGDLPWPGVLFGISVSGIWYWCSDQVIVQRCLAARSLTHVKAGCILCGYLKLLPMFLMVFPGMISRILYPDEVGCVVPEDCKRICETEVGCSNIAYPKLVVSVMPSGLRGLMLAVMLAALMSSLASIFNSSSTLFTMDIWTRIRPQAFERELIIVGRVWVLCIVAISICWIPVVQAAQSGQLFDYIQSVSSYLSPPIAAIFLLAVFVKRVNETGAFWGLIGGLAMGLCRMLPEFWFGTGSCVFPSDCPFLLCGIHYLHFAIILFLCTSVLVLIVSICSEPI----HDRHLY------------RLVFSLRHSKED----REDLDWEQQEHGRRAK-----------------ETERQNNAAAVIEER-----KKSVINRM 598          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Medaka
Match: slc5a1 (sodium/glucose cotransporter 1-like [Source:NCBI gene;Acc:101175176])

HSP 1 Score: 559.296 bits (1440), Expect = 0.000e+0
Identity = 290/530 (54.72%), Postives = 381/530 (71.89%), Query Frame = 2
Query:  230 PLDISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPL 1819
            P DISVIVIYF+ ++A G  +M R+NR T+ G+FLAG+ M+W P+GASLFASNIGS HF+GLAGSGAA GI  G FE N  I++ LLGW+F+P++I +G  T+PEY+ KRFGG R++ YL+V+SL++YIFTKIS +++S ++FI +AL LNI+++V  LL +T + TVTGGLAAV+YTDT Q  IM+IGS IL   +F ++GG +   E Y QA+        P I  + +  C+ P   +F +FR     D+PW G + G T  +IWY+C DQ++VQR LSAKNLSH KGG +  G LKLLP+F+MV PGMISRIL+PD VAC   E+C   C  + GCSN+AYPKLV+ L+P+GLRGLMLSVMLA+L+S LTSIFNSASTLFT+D+Y  IRP A  RELMI GRLF L +IG+SI W+PV+Q  Q GQLF Y Q+I+ YL+PPIAA +++AIF  R NE GA   L+ GL IG  RMI +FV+    C      P      H++YF +  F   C+++I ISL+T+P+
Sbjct:   29 PADISVIVIYFLVVLAVGIWAMVRTNRSTVGGFFLAGRSMVWWPIGASLFASNIGSGHFVGLAGSGAAAGIATGGFEWNVLIVIVLLGWIFVPIYIKAGVVTMPEYLKKRFGGSRIRIYLSVLSLILYIFTKISTDMFSGAIFINQALGLNIYVAVIALLLITAVYTVTGGLAAVIYTDTLQTFIMLIGSFILMGFAFNEVGGYARFEELYMQAV--------PTIKGNFSAECFEPRPDSFHLFRDPVTGDLPWPGMVFGLTIQAIWYFCNDQVIVQRCLSAKNLSHVKGGCVLCGYLKLLPMFLMVFPGMISRILYPDVVACVDPEECQSYCGSSVGCSNIAYPKLVVDLMPNGLRGLMLSVMLASLMSSLTSIFNSASTLFTMDMYTKIRPRAKERELMIAGRLFTLGLIGVSIAWIPVVQTAQSGQLFDYAQSITSYLAPPIAAVFILAIFCKRVNEPGAFYGLMIGLPIGLSRMITEFVYGTGSCANPSDCPTIICGVHYLYFGIILFVLSCIIIIGISLMTKPI 550          
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Medaka
Match: slc5a11 (solute carrier family 5 member 11 [Source:NCBI gene;Acc:101160661])

HSP 1 Score: 529.635 bits (1363), Expect = 8.254e-179
Identity = 305/653 (46.71%), Postives = 440/653 (67.38%), Query Frame = 2
Query:  233 LDISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFA-LFSFSSCCVVMIVISLLTEPLPKVFNERTTYWNYWKQDSITPEDIIFSVPLREKSIVVPKKEIDLELEN--------VGGRHKCKMMLLRYWNKFLGISNTGETDSSVLPITEEQSESLFRKSILNRLYQRKRDRYILNVLMVL 2164
            +DI V+VIYF+ ++A GF SM R+ R T+ GYFLAG+ M W PVGASLFASNIGS HFIGLAGSGAA GIG  A+E N  +++ LLGW+FLP++I+SG  T+PEY+ +RFGGKR    LAV+SL +YIFTKISV++Y+ +LFI  AL+ NI+L++ +LL +T L TV GGLAAV+YTD  Q  IM+ G++ L   SF ++GG  AL E Y QA+       L  + NS+   C +P + AF +FR   ++D+PW G I+G +  S+WYWC+DQ++VQR L+AKNLSHAKGG++ A  LK+LP F +++PGMISRIL+ DEVACA  + C ++C  + GCS++AY KLV++LLP GLRGLM++VM+AAL+S LTSIFNS+ST+FT+D+++  R  A+  ELMI+GR+FVL+++ +S+LW+PV+Q  QGGQLFIYIQ+IS YL PPI+  +++  FW R NEKGA   L+ GL +G +RM++DF++   PC + DTRP   +  H++YF+ L S  +  VV++V     EP P+  +  T +  +   D++ P++ +  V + + +   P++  +   E+             + + M + YW   +     G+      P  E+   SL  K  L         +YI+NV +++
Sbjct:   28 VDIVVLVIYFILVLAVGFWSMWRTKRSTVDGYFLAGKSMTWWPVGASLFASNIGSGHFIGLAGSGAAAGIGAIAYEWNGMLMVLLLGWLFLPIYISSGVTTMPEYLQRRFGGKRTHLSLAVLSLFIYIFTKISVDMYAGALFIQLALQWNIYLAIVLLLVITALYTVAGGLAAVIYTDAAQTAIMLAGALTLMGFSFVEVGGWGALMEGYSQAVP------LFRVPNST---CGIPREDAFHIFRDPVNSDLPWPGVIIGMSIPSMWYWCSDQVIVQRSLAAKNLSHAKGGSLLASYLKILPFFAVMLPGMISRILYTDEVACADPDLCNQICGNSVGCSDIAYAKLVMELLPSGLRGLMMAVMIAALMSSLTSIFNSSSTIFTLDLWKSFRSEASEWELMIVGRVFVLVLVVVSVLWIPVVQASQGGQLFIYIQSISTYLQPPISIIFLMGCFWKRANEKGAFWGLVIGLAVGCLRMLLDFIYPTPPCYEEDTRPGVLKYVHYLYFSILLSVITLSVVVVVSLATEEPRPEQISRLTWFTRF---DAVKPKEKLEEV-ISQSNAKEPERSNEHTAEHRPSSASSMSSTSSQSRGMAVLYWLCGMERRRQGDNKPVTPPALEKNICSLEEKPTL---------QYIMNVNLII 658          
BLAST of Sodium/myo-inositol cotransporter vs. Planmine SMEST
Match: SMESG000051963.1 (SMESG000051963.1)

HSP 1 Score: 848.966 bits (2192), Expect = 0.000e+0
Identity = 431/468 (92.09%), Postives = 432/468 (92.31%), Query Frame = 2
Query:  212 MLKNIGPLDISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEK 1615
            MLKNIGPLDISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFP                                    GLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVL+MIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEK
Sbjct:    1 MLKNIGPLDISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFP------------------------------------GLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLIMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEK 432          
BLAST of Sodium/myo-inositol cotransporter vs. Planmine SMEST
Match: SMESG000051963.1 (SMESG000051963.1)

HSP 1 Score: 571.622 bits (1472), Expect = 0.000e+0
Identity = 280/280 (100.00%), Postives = 280/280 (100.00%), Query Frame = 2
Query:  212 MLKNIGPLDISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQ 1051
            MLKNIGPLDISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQ
Sbjct:    1 MLKNIGPLDISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQ 280          

HSP 2 Score: 247.284 bits (630), Expect = 7.248e-73
Identity = 115/127 (90.55%), Postives = 118/127 (92.91%), Query Frame = 2
Query: 1586 AIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTYWNYWKQDSITPEDIIFSVPLREKSIVVPKKEIDLELENV 1966
            A  W    ++GAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTYWNYWKQDSITPEDIIFSVPLREKSIVVPKKEIDL L  +
Sbjct:  271 ASIWYWCTDQGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTYWNYWKQDSITPEDIIFSVPLREKSIVVPKKEIDLGLRGL 397          

HSP 3 Score: 211.075 bits (536), Expect = 1.153e-59
Identity = 110/121 (90.91%), Postives = 113/121 (93.39%), Query Frame = 2
Query: 1253 NLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEK 1615
            ++  PK  I L   GLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVL+MIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEK
Sbjct:  382 SIVVPKKEIDL---GLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLIMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEK 499          
BLAST of Sodium/myo-inositol cotransporter vs. Planmine SMEST
Match: SMESG000051963.1 (SMESG000051963.1)

HSP 1 Score: 570.852 bits (1470), Expect = 0.000e+0
Identity = 280/280 (100.00%), Postives = 280/280 (100.00%), Query Frame = 2
Query:  212 MLKNIGPLDISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQ 1051
            MLKNIGPLDISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQ
Sbjct:    1 MLKNIGPLDISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQ 280          

HSP 2 Score: 436.032 bits (1120), Expect = 4.830e-145
Identity = 221/230 (96.09%), Postives = 223/230 (96.96%), Query Frame = 2
Query: 1586 AIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTYWNYWKQDSITPEDIIFSVPLREKSIVVPKKEIDLELENVGGRHKCKMMLLRYWNKFLGISNTGETDSSVLPITEEQSESLFRKSILNRLYQRKRDRYILNVLMVLQXXXXXXXXXXXSVAFPEIEIGKVPVFNSTDNLRKIS 2275
            A  W    ++GAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTYWNYWKQDSITPEDIIFSVPLREKSIVVPKKEIDLELENVGGRHKCKMMLLRYWNKFLGISNTGE DSSVLPITEEQSESLFRKSILNRLYQRKRDRYILNVLMVLQIIFVCVCFIVFSVAFPEIEIGKVPVFNSTDNLRKIS
Sbjct:  271 ASIWYWCTDQGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTYWNYWKQDSITPEDIIFSVPLREKSIVVPKKEIDLELENVGGRHKCKMMLLRYWNKFLGISNTGEVDSSVLPITEEQSESLFRKSILNRLYQRKRDRYILNVLMVLQIIFVCVCFIVFSVAFPEIEIGKVPVFNSTDNLRKIS 500          
BLAST of Sodium/myo-inositol cotransporter vs. Planmine SMEST
Match: SMESG000013622.1 (SMESG000013622.1)

HSP 1 Score: 545.043 bits (1403), Expect = 0.000e+0
Identity = 269/577 (46.62%), Postives = 392/577 (67.94%), Query Frame = 2
Query:  236 DISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIAR----VNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTYWNYWKQDSITPEDIIFSVPLREKSIVV-PKKEIDL 1951
            DI V++ YFV ++  G  + CR NR ++ GYFLAG+ M W+PVGASLFASNIGS HFIGLAGSGA+ GI +  FELNA  +L +LGW+FLPV+I++G +T+PEY+ KRFGG R++ YLAV++L++YIFTKIS +LY+ ++FI ++++L ++ SV +LL    +  + GGL AV++TD  Q +IM+IG+  L + SF ++GG   L  +Y Q++ +    +N +     + +    C +P K A    R   D ++PW G I G T +SIWYWCTDQ++VQR L+AKNL+ AK G +    LK+LP++++V PGM SR+LF DEVAC   E+C R+C +  GCS++AYPKLV+++LP G RGLML+VMLA+LVS LTSIFNSAST+FT DI++ +R  A++ ELMI+GR+FVL+M+ + I W+P++Q+    +LF YIQ+++ YLSPPI A Y++A+FW R NEKGA   L+ GL+IG  R   +  +   PC + +  P    K H+++F +  F    ++ +  SL+T P+ +   +   +WN  K+ S    D     P  E    V  KK+ID+
Sbjct:   11 DIGVVIGYFVLVLGVGLWASCR-NRGSVGGYFLAGRQMHWIPVGASLFASNIGSGHFIGLAGSGASSGIAIAVFELNAIFILLILGWIFLPVYISTGIFTMPEYLKKRFGGVRIRIYLAVIALLLYIFTKISADLYAGAIFIEQSVQLPLYPSVIILLLFAAVFNILGGLTAVIWTDFIQTVIMLIGASYLMITSFVELGGYENLVTRYFQSLPKTGRYLNFSIFQNPVPNKYFDCGIPDKNAMHFMRSSSDTNLPWPGVIFGLTISSIWYWCTDQVIVQRALAAKNLTFAKSGILLCAWLKMLPMWLIVFPGMASRVLFTDEVACNIPEECKRICGKEKGCSDVAYPKLVLEILPTGARGLMLAVMLASLVSSLTSIFNSASTIFTFDIWQRLRKSASDVELMIVGRVFVLVMVAIGIAWIPIVQS--SNELFHYIQSVTSYLSPPICAVYLLALFWKRCNEKGAFIGLMSGLVIGLSRFFTEVAYPPKPCGEENIIPSVLSKVHYLHFGILLFGITLIISVTSSLITAPMDRRHTDGLLFWNCRKEYSKREVDKGTENPCYENDFEVDAKKDIDV 584          
BLAST of Sodium/myo-inositol cotransporter vs. Planmine SMEST
Match: SMESG000047775.1 (SMESG000047775.1)

HSP 1 Score: 92.4337 bits (228), Expect = 3.498e-19
Identity = 139/605 (22.98%), Postives = 251/605 (41.49%), Query Frame = 2
Query:  242 SVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLPVGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPVFINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFIYEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILTVISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQMFRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTIFAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLAYPKLVIKLLPD--GLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIY----RLIRPVANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSPPIAASYVVAIFWSRGNEKGAITSLIYGLIIG-----GVRMIMDFVWKEVPCE--------------QTDTRPFFFQKFHFMYFALFSFSSCCVVMIVISLLT-----EPLPK-----VFNERTTYWNYWKQDSITPEDIIFSVPLREKSIVVPKKEIDL 1951
            +VI +YF      GF    + N+  IK YFLA + M  +PV AS+  S + +   +G        GI       +  I   L  +V+LP F      +  EY+  RFG + ++  +++V ++  IF  ISV LY+ +L   +   L++W+S+     +    T  GG+ AV++TD  Q +IM+ G + + ++   ++GG+SA++E   +   R+N      + N                F P   +   +     G T   +  + T+Q  VQR LS +    A G  +    L    L++++  G+++   F     C    D +       G  +  +P  VI+LL     L GL LS + AA +S ++S  NS S++   DI     R    +AN      +    + L +G   +    + ++    +     ++ G    PI + + + +     N KGAI  LI  +++      G  +    V   +P                    + F      ++Y+ L +   C ++ I +S +T     + + K     +  + + YW     D IT  D++  VP    + ++   E+ L
Sbjct:   20 AVIGLYFKFKYDYGF----KRNKTVIKEYFLANRKMGLIPVTASILVSFMSAISILGTVSEVYVSGIEYAVIGFSYFIAFPLAAYVYLPTFYRLKIVSAHEYLELRFG-RLIRICVSIVFIIQMIF-YISVVLYAPALAFSQVSGLSLWISILSTGIVCTFYTALGGMRAVIWTDLMQFVIMLCGMLTVVIVGVIRVGGVSAVWE-ISKKNGRIN------LFN----------------FNPDPFSRHSFWSLFFGGTGMCMSIYATNQAQVQRYLSCRTEKIAIGSLMINTPLTFGFLWLLIGAGLVT---FSSLATC----DPLTSGEINKG--DQIFPYFVIRLLHQYSPLPGLFLSTIFAAGLSTISSGINSLSSVIMEDILSVCPRNDVDIANRVNRTALYAKIIALTLGAITITFAFLFSLASSTVLQIALSLFGMAGGPILSVFTMGLIIPCVNAKGAICGLIGSILVTFWIGIGAIVTGSGVSNRLPVNVSGCLNNTNNATVINVTNKGFSIYNLSYLYYTLVAIVVCTILSIFVSAITGFNSQKKISKNLFFVLVPKLSKYWPVQFPDQIT--DVVEIVPKETTNFIIASSEVQL 584          
The following BLAST results are available for this feature:
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC5A30.000e+052.91solute carrier family 5 member 3 [Source:HGNC Symb... [more]
SLC5A10.000e+048.60solute carrier family 5 member 1 [Source:HGNC Symb... [more]
SLC5A110.000e+050.17solute carrier family 5 member 11 [Source:HGNC Sym... [more]
SLC5A110.000e+050.17solute carrier family 5 member 11 [Source:HGNC Sym... [more]
SLC5A20.000e+052.04solute carrier family 5 member 2 [Source:HGNC Symb... [more]
back to top
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ZK822.55.895e-1023.04pep chromosome:WBcel235:IV:11937418:11940604:1 gen... [more]
ZK822.55.895e-1023.04pep chromosome:WBcel235:IV:11937384:11940604:1 gen... [more]
cho-14.743e-621.66High-affinity choline transporter 1 [Source:UniPr... [more]
ZK822.57.431e-623.28pep chromosome:WBcel235:IV:11938574:11940604:1 gen... [more]
back to top
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG104442.047e-1523.33gene:FBgn0034494 transcript:FBtr0086305[more]
Smvt1.549e-1223.66gene:FBgn0039873 transcript:FBtr0085860[more]
CG422357.388e-1223.48gene:FBgn0250757 transcript:FBtr0290141[more]
CG422351.619e-1023.14gene:FBgn0250757 transcript:FBtr0290137[more]
CG67231.510e-922.75gene:FBgn0037895 transcript:FBtr0082405[more]
back to top
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc5a3b0.000e+053.27solute carrier family 5 member 3b [Source:ZFIN;Acc... [more]
slc5a3a0.000e+053.39solute carrier family 5 member 3a [Source:ZFIN;Acc... [more]
slc5a10.000e+048.58solute carrier family 5 member 1 [Source:ZFIN;Acc:... [more]
slc5a20.000e+050.56solute carrier family 5 member 2 [Source:ZFIN;Acc:... [more]
slc5a90.000e+046.56solute carrier family 5 member 9 [Source:NCBI gene... [more]
back to top
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC5A110.000e+051.59solute carrier family 5 (sodium/inositol cotranspo... [more]
SLC5A110.000e+052.21solute carrier family 5 (sodium/inositol cotranspo... [more]
SLC5A110.000e+047.99solute carrier family 5 (sodium/inositol cotranspo... [more]
SLC5A110.000e+054.67solute carrier family 5 (sodium/inositol cotranspo... [more]
SLC5A110.000e+054.67solute carrier family 5 (sodium/inositol cotranspo... [more]
back to top
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc5a30.000e+053.09solute carrier family 5 (inositol transporters), m... [more]
Slc5a110.000e+048.30solute carrier family 5 (sodium/glucose cotranspor... [more]
Slc5a110.000e+048.30solute carrier family 5 (sodium/glucose cotranspor... [more]
Slc5a20.000e+047.36solute carrier family 5 (sodium/glucose cotranspor... [more]
Slc5a4b0.000e+046.60solute carrier family 5 (neutral amino acid transp... [more]
back to top
BLAST of Sodium/myo-inositol cotransporter vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P31637|SC5A3_CANLF0.000e+052.56Sodium/myo-inositol cotransporter OS=Canis lupus f... [more]
sp|Q9JKZ2|SC5A3_MOUSE0.000e+053.09Sodium/myo-inositol cotransporter OS=Mus musculus ... [more]
sp|P53794|SC5A3_HUMAN0.000e+052.91Sodium/myo-inositol cotransporter OS=Homo sapiens ... [more]
sp|P53793|SC5A3_BOVIN0.000e+052.73Sodium/myo-inositol cotransporter OS=Bos taurus OX... [more]
sp|Q8K0E3|SC5AB_MOUSE0.000e+048.30Sodium/myo-inositol cotransporter 2 OS=Mus musculu... [more]
back to top
BLAST of Sodium/myo-inositol cotransporter vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A564Z9A50.000e+060.45Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A564Z7G30.000e+060.45Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A4Z2CNW90.000e+049.73Sodium/myo-inositol cotransporter OS=Schistosoma j... [more]
A0A068XTY20.000e+054.34Sodium:myo inositol cotransporter OS=Echinococcus ... [more]
W6U3C30.000e+053.98Sodium/myo-inositol cotransporter OS=Echinococcus ... [more]
back to top
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc5a3b0.000e+052.17solute carrier family 5 member 3 [Source:NCBI gene... [more]
slc5a10.000e+048.10sodium/glucose cotransporter 1-like [Source:NCBI g... [more]
slc5a20.000e+046.78solute carrier family 5 member 2 [Source:NCBI gene... [more]
slc5a110.000e+049.83solute carrier family 5 member 11 [Source:NCBI gen... [more]
slc5a18.132e-18049.46solute carrier family 5 member 1 [Source:ZFIN;Acc:... [more]
back to top
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc5a10.000e+053.98solute carrier family 5 member 1 [Source:ZFIN;Acc:... [more]
slc5a3a8.147e-16150.00solute carrier family 5 member 3a [Source:ZFIN;Acc... [more]
slc5a94.981e-16047.15solute carrier family 5 member 9 [Source:NCBI gene... [more]
ENSPMAT00000003316.11.079e-11445.35pep scaffold:Pmarinus_7.0:GL476336:129493:160966:1... [more]
slc5a51.357e-1724.80solute carrier family 5 member 5 [Source:ZFIN;Acc:... [more]
back to top
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO448330.000e+056.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO435821.267e-18046.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461997.124e-16548.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO462002.927e-15550.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO363588.939e-1225.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Sodium/myo-inositol cotransporter vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc5a3b0.000e+050.09solute carrier family 5 member 3 [Source:NCBI gene... [more]
slc5a10.000e+048.25sodium/glucose cotransporter 1 [Source:NCBI gene;A... [more]
slc5a20.000e+048.17solute carrier family 5 member 2 [Source:NCBI gene... [more]
slc5a10.000e+054.72sodium/glucose cotransporter 1-like [Source:NCBI g... [more]
slc5a118.254e-17946.71solute carrier family 5 member 11 [Source:NCBI gen... [more]
back to top
BLAST of Sodium/myo-inositol cotransporter vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051963.10.000e+092.09SMESG000051963.1[more]
SMESG000051963.17.248e-73100.00SMESG000051963.1[more]
SMESG000051963.14.830e-145100.00SMESG000051963.1[more]
SMESG000013622.10.000e+046.62SMESG000013622.1[more]
SMESG000047775.13.498e-1922.98SMESG000047775.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029255 ID=SMED30029255|Name=Sodium/myo-inositol cotransporter|organism=Schmidtea mediterranea sexual|type=transcript|length=2394bp
CTAATGTAATCTATTTGACCTTCTCAGAAAATAAGTTATTTAAAGTATAT
TTTTAATATATTATTCTATTTTGAATTTCAATATATTTAATTTTACAAAC
TATAGAAATAAAATTGAAATTTCTTTAAATCTATTTGATTTGGAAGAATT
TTGAATAATCAATATAAACATATTTTATACTTGAATTTTATTGATAATTT
TTTATATAAAAATGTTAAAAAATATAGGCCCTCTAGATATATCTGTGATA
GTGATATATTTTGTATGTCTTATTGCAACTGGATTCATATCCATGTGTAG
ATCCAATAGAGATACAATTAAAGGGTATTTTCTAGCCGGGCAATTTATGA
TTTGGCTTCCAGTCGGAGCTTCGTTGTTTGCTAGTAATATTGGCAGTGAG
CATTTCATTGGTTTAGCGGGTTCCGGTGCCGCAAAAGGCATTGGAGTTGG
TGCATTTGAATTAAATGCTTCAATTTTGTTGCATTTGCTTGGATGGGTGT
TTCTTCCGGTGTTTATTAACAGTGGGGCGTACACTTTACCGGAGTACATG
CACAAGCGGTTTGGCGGCAAGCGCGTTCAATGCTACTTGGCCGTGGTATC
TCTTATGATGTACATTTTTACAAAGATCTCGGTGAATCTATATTCCGCAT
CGTTGTTTATTTACGAGGCCCTGGAACTCAATATTTGGCTCTCAGTTGGG
GTGCTTCTTGCACTGACTGGTTTAATTACTGTCACGGGTGGACTAGCAGC
TGTACTATATACCGACACGTTTCAATGTATAATCATGGTGATAGGGTCAA
TAATTCTTACAGTTATTAGTTTTGCTAAAATTGGTGGTATTAGTGCTCTG
TTTGAAAAATATGGGCAAGCAATTGCAAGAGTTAACGAAACGCAGCTTCC
CGCAATATTAAACTCTTCTACTCTTCATTGTTACTTACCATCGAAGAAAG
CCTTTCAAATGTTTCGGCCGTTGGATGATAATGATATGCCCTGGTTAGGT
TTTATTCTTGGGCAAACTCCAGCTTCGATTTGGTACTGGTGTACAGATCA
GATGATGGTTCAACGGGTGTTGTCGGCGAAAAATCTTTCCCATGCCAAAG
GTGGCACTATATTTGCCGGAATTTTGAAACTTCTGCCATTATTCATAATG
GTGATGCCCGGAATGATCAGTCGCATATTATTTCCCGACGAAGTGGCTTG
TGCCACCGCTGAAGACTGTATTCGAGTATGTCGACAGGCAAGTGGTTGTT
CAAATTTAGCATATCCAAAATTGGTTATCAAGCTTCTTCCTGATGGTTTA
CGGGGTTTGATGTTGTCAGTAATGCTAGCGGCTCTTGTGTCGGATTTGAC
TTCAATTTTCAATTCTGCCAGCACCCTATTTACAGTTGATATCTATCGGC
TGATCAGACCCGTGGCCAATAATCGAGAATTAATGATTATCGGACGACTA
TTTGTGCTCCTAATGATTGGATTGAGTATTCTTTGGTTGCCGGTTATCCA
GAATATGCAAGGAGGTCAACTGTTCATTTATATTCAAGCCATAAGTGGAT
ACCTTTCGCCGCCAATCGCCGCATCATATGTTGTGGCAATATTCTGGTCC
CGAGGAAATGAAAAGGGAGCAATTACTAGTCTTATTTACGGATTAATTAT
CGGCGGAGTGCGAATGATTATGGATTTTGTGTGGAAAGAAGTCCCTTGTG
AACAAACGGATACTAGACCTTTTTTCTTTCAAAAGTTTCATTTTATGTAT
TTTGCATTATTTTCATTTAGCTCTTGTTGCGTTGTCATGATAGTAATTTC
ATTGCTTACCGAACCGTTACCTAAAGTGTTTAATGAAAGGACAACATATT
GGAATTATTGGAAACAAGATAGCATCACTCCTGAAGATATTATTTTTTCG
GTTCCATTACGAGAAAAATCCATAGTTGTACCTAAAAAAGAAATAGATCT
AGAACTTGAAAACGTTGGAGGGCGCCATAAATGCAAAATGATGCTTTTGC
GTTACTGGAACAAATTCCTTGGGATAAGTAACACTGGTGAAACGGACTCG
AGTGTCCTGCCGATAACTGAGGAGCAATCTGAATCTTTATTTCGTAAATC
TATTTTAAACCGACTTTATCAACGGAAACGGGATAGATATATTCTAAATG
TTTTGATGGTTTTACAAATCATTTTTGTCTGTGTTTGTTTTATCGTGTTC
TCAGTTGCCTTTCCAGAAATCGAGATCGGAAAAGTTCCGGTTTTTAATTC
AACTGATAACTTGAGAAAAATATCATAATATTGTTTTTTGTAAGTTTTTG
CAAGAATTCTTATCGTATTGTTTCACTTGATATATGATTTTATAGCACGA
TAATAATATTCAAAAATTGTTTGATTTCTTTTTTTTGTCTTTGT
back to top

protein sequence of SMED30029255-orf-1

>SMED30029255-orf-1 ID=SMED30029255-orf-1|Name=SMED30029255-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=689bp
MLKNIGPLDISVIVIYFVCLIATGFISMCRSNRDTIKGYFLAGQFMIWLP
VGASLFASNIGSEHFIGLAGSGAAKGIGVGAFELNASILLHLLGWVFLPV
FINSGAYTLPEYMHKRFGGKRVQCYLAVVSLMMYIFTKISVNLYSASLFI
YEALELNIWLSVGVLLALTGLITVTGGLAAVLYTDTFQCIIMVIGSIILT
VISFAKIGGISALFEKYGQAIARVNETQLPAILNSSTLHCYLPSKKAFQM
FRPLDDNDMPWLGFILGQTPASIWYWCTDQMMVQRVLSAKNLSHAKGGTI
FAGILKLLPLFIMVMPGMISRILFPDEVACATAEDCIRVCRQASGCSNLA
YPKLVIKLLPDGLRGLMLSVMLAALVSDLTSIFNSASTLFTVDIYRLIRP
VANNRELMIIGRLFVLLMIGLSILWLPVIQNMQGGQLFIYIQAISGYLSP
PIAASYVVAIFWSRGNEKGAITSLIYGLIIGGVRMIMDFVWKEVPCEQTD
TRPFFFQKFHFMYFALFSFSSCCVVMIVISLLTEPLPKVFNERTTYWNYW
KQDSITPEDIIFSVPLREKSIVVPKKEIDLELENVGGRHKCKMMLLRYWN
KFLGISNTGETDSSVLPITEEQSESLFRKSILNRLYQRKRDRYILNVLMV
LQIIFVCVCFIVFSVAFPEIEIGKVPVFNSTDNLRKIS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
GO:0005215transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR038377Na/Glc_symporter_sf
IPR006665OmpA-like
IPR001734Na/solute_symporter
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0055085transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR038377Sodium/glucose symporter superfamilyGENE3DG3DSA:1.20.1730.10coord: 1..451
e-value: 2.1E-115
score: 388.1
IPR001734Sodium/solute symporterPFAMPF00474SSFcoord: 1..365
e-value: 2.0E-98
score: 330.0
IPR001734Sodium/solute symporterTIGRFAMTIGR00813TIGR00813coord: 2..365
e-value: 2.7E-104
score: 347.4
IPR001734Sodium/solute symporterPROSITEPS50283NA_SOLUT_SYMP_3coord: 1..379
score: 54.175
NoneNo IPR availablePANTHERPTHR11819:SF150SODIUM/MYO-INOSITOL COTRANSPORTERcoord: 1..551
NoneNo IPR availablePANTHERPTHR11819SODIUM/SOLUTE SYMPORTERcoord: 1..551
NoneNo IPR availableTMHMMTMhelixcoord: 49..71
NoneNo IPR availableTMHMMTMhelixcoord: 399..421
NoneNo IPR availableTMHMMTMhelixcoord: 12..34
NoneNo IPR availableTMHMMTMhelixcoord: 147..164
NoneNo IPR availableTMHMMTMhelixcoord: 357..379
NoneNo IPR availableTMHMMTMhelixcoord: 253..275
NoneNo IPR availableTMHMMTMhelixcoord: 78..100
NoneNo IPR availableTMHMMTMhelixcoord: 185..207
NoneNo IPR availableTMHMMTMhelixcoord: 531..553
NoneNo IPR availableTMHMMTMhelixcoord: 328..350
NoneNo IPR availableTMHMMTMhelixcoord: 296..318