Peptidase_M48 domain-containing protein

Overview
NamePeptidase_M48 domain-containing protein
Smed IDSMED30029254
Length (bp)1193
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Peptidase_M48 domain-containing protein (SMED30029254) t-SNE clustered cells

Violin plots show distribution of expression levels for Peptidase_M48 domain-containing protein (SMED30029254) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Peptidase_M48 domain-containing protein (SMED30029254) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Peptidase_M48 domain-containing protein (SMED30029254) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029254

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neoblastSMED30029254h1SMcG0015033 dd_Smed_v4_5459_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
vitelline glandSMED30029254h1SMcG0012904 Contig1125uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
vitelline glandSMED30029254h1SMcG0012904 Contig1125newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
vitelline glandSMED30029254h1SMcG0015033 Contig1125uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
vitelline glandSMED30029254h1SMcG0015033 Contig1125newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
vitelline glandSMED30029254h1SMcG0012906 Contig1125uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
vitelline glandSMED30029254h1SMcG0012906 Contig1125newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
vitelline glandSMED30029254h1SMcG0012903 Contig1125uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
vitelline glandSMED30029254h1SMcG0012903 Contig1125newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Peptidase_M48 domain-containing protein vs. Ensembl Human
Match: OMA1 (OMA1 zinc metallopeptidase [Source:HGNC Symbol;Acc:HGNC:29661])

HSP 1 Score: 166.007 bits (419), Expect = 1.219e-45
Identity = 97/304 (31.91%), Postives = 163/304 (53.62%), Query Frame = 1
Query:  181 GRLLNRWWRNLSHEEKSRIIKKYKHHTKLLAFFGTSLVGYETWVYYRS-IEICPYTGRKRFMILTKEDMKEILGEPADNELLQ--KSSVLSSNHPYYKSVKSIVDTIIVKNKEVFPELSG-NWKLLIYDDDSIINAACLPNGEIIVYTGLIKFVENHHQLAVVISHELSHVILEHGRETLGRMSILSIIVTVCGFALWTFIQGDFMAFLSNWLKNRIFRVCLELPYNRMLESEADVLGLQMLARSCYDVNEAKKFWDIMSIFEK-KTEISLPNWLCTHPLSELRAKHLERLTPSASKLSKECGC 1077
            GR + +WW+ L    K  ++K+     K   F G S  G    V+Y + +E+ P TGR + ++L KE  + +L E      ++  K+ +L+     Y +VK ++  +I  NK+V P +S  NW + + D   IINA  LPNG++ V+TG +  V + HQL+ ++ HE++H +L H  E  G + +L  +  +    +W     D +A L  W+++++       PY+R LE+EAD +GL + A++C D+  +  FW  M   +    +  +P WL THP    R ++L+RL P A K+ + C C
Sbjct:  166 GRGIRKWWQALP-PNKKEVVKENIRKNKWKLFLGLSSFGLLFVVFYFTHLEVSPITGRSKLLLLGKEQFR-LLSELEYEAWMEEFKNDMLTEKDARYLAVKEVLCHLIECNKDV-PGISQINWVIHVVDS-PIINAFVLPNGQMFVFTGFLNSVTDIHQLSFLLGHEIAHAVLGHAAEKAGMVHLLDFLGMIFLTMIWAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACADIRASSVFWQQMEFVDSLHGQPKMPEWLSTHPSHGNRVEYLDRLIPQALKIREMCNC 465          
BLAST of Peptidase_M48 domain-containing protein vs. Ensembl Human
Match: OMA1 (OMA1 zinc metallopeptidase [Source:HGNC Symbol;Acc:HGNC:29661])

HSP 1 Score: 157.147 bits (396), Expect = 4.517e-44
Identity = 94/300 (31.33%), Postives = 159/300 (53.00%), Query Frame = 1
Query:  181 GRLLNRWWRNLSHEEKSRIIKKYKHHTKLLAFFGTSLVGYETWVYYRS-IEICPYTGRKRFMILTKEDMKEILGEPADNELLQ--KSSVLSSNHPYYKSVKSIVDTIIVKNKEVFPELSG-NWKLLIYDDDSIINAACLPNGEIIVYTGLIKFVENHHQLAVVISHELSHVILEHGRETLGRMSILSIIVTVCGFALWTFIQGDFMAFLSNWLKNRIFRVCLELPYNRMLESEADVLGLQMLARSCYDVNEAKKFWDIMSIFEK-KTEISLPNWLCTHPLSELRAKHLERLTPSASKLSK 1065
            GR + +WW+ L    K  ++K+     K   F G S  G    V+Y + +E+ P TGR + ++L KE  + +L E      ++  K+ +L+     Y +VK ++  +I  NK+V P +S  NW + + D   IINA  LPNG++ V+TG +  V + HQL+ ++ HE++H +L H  E  G + +L  +  +    +W     D +A L  W+++++       PY+R LE+EAD +GL + A++C D+  +  FW  M   +    +  +P WL THP    R ++L+RL P   +  K
Sbjct:    8 GRGIRKWWQALP-PNKKEVVKENIRKNKWKLFLGLSSFGLLFVVFYFTHLEVSPITGRSKLLLLGKEQFR-LLSELEYEAWMEEFKNDMLTEKDARYLAVKEVLCHLIECNKDV-PGISQINWVIHVVDS-PIINAFVLPNGQMFVFTGFLNSVTDIHQLSFLLGHEIAHAVLGHAAEKAGMVHLLDFLGMIFLTMIWAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACADIRASSVFWQQMEFVDSLHGQPKMPEWLSTHPSHGNRVEYLDRLIPQLVREEK 303          
BLAST of Peptidase_M48 domain-containing protein vs. Ensembl Human
Match: OMA1 (OMA1 zinc metallopeptidase [Source:HGNC Symbol;Acc:HGNC:29661])

HSP 1 Score: 74.3294 bits (181), Expect = 3.342e-14
Identity = 53/164 (32.32%), Postives = 90/164 (54.88%), Query Frame = 1
Query:  181 GRLLNRWWRNLSHEEKSRIIKKYKHHTKLLAFFGTSLVGYETWVYYRS-IEICPYTGRKRFMILTKEDMKEILGEPADNELLQ--KSSVLSSNHPYYKSVKSIVDTIIVKNKEVFPELSG-NWKLLIYDDDSIINAACLPNGEIIVYTGLIKFVENHHQLAVVI 660
            GR + +WW+ L   +K  ++K+     K   F G S  G    V+Y + +E+ P TGR + ++L KE  + +L E      ++  K+ +L+     Y +VK ++  +I  NK+V P +S  NW + + D   IINA  LPNG++ V+TG +  V + HQL+ ++
Sbjct:  166 GRGIRKWWQALPPNKK-EVVKENIRKNKWKLFLGLSSFGLLFVVFYFTHLEVSPITGRSKLLLLGKEQFR-LLSELEYEAWMEEFKNDMLTEKDARYLAVKEVLCHLIECNKDV-PGISQINWVIHVVDSP-IINAFVLPNGQMFVFTGFLNSVTDIHQLSFLL 325          
BLAST of Peptidase_M48 domain-containing protein vs. Ensembl Zebrafish
Match: oma1 (OMA1 zinc metallopeptidase [Source:NCBI gene;Acc:100331186])

HSP 1 Score: 174.481 bits (441), Expect = 4.828e-49
Identity = 90/302 (29.80%), Postives = 168/302 (55.63%), Query Frame = 1
Query:  181 GRLLNRWWRNLSHEEKSRIIK-KYKHHTKLLAFFGTSLVGYETWVYYRSIEICPYTGRKRFMILTKEDMKEILGEPADNELLQ-KSSVLSSNHPYYKSVKSIVDTIIVKNKEVFPELSGNWKLLIYDDDSIINAACLPNGEIIVYTGLIKFVENHHQLAVVISHELSHVILEHGRETLGRMSILSIIVTVCGFALWTFIQGDFMAFLSNWLKNRIFRVCLELPYNRMLESEADVLGLQMLARSCYDVNEAKKFWDIMSIFEK-KTEISLPNWLCTHPLSELRAKHLERLTPSASKLSKECGC 1077
            GR + +WW  L   +K    +  ++     L   GT L+   +  ++  ++  P TGR R ++ ++++ +E+    AD  + + K S+++S+ P +K V+ +V  +  +N+++    +  W + + D  ++ NA  LPNGEI V+TG++  V + HQL  ++ HE++H ++ H  E      ++ ++  V   A+W     D +A L +W++ ++ +   + P++R LE+EAD +GLQM A++C DV     FW+ M IF++   + ++P WL THP  + R + L+RL P A +L   C C
Sbjct:  135 GRSIRKWWVALPANKKQLFREWSWRRRWHFLGA-GTGLLFIASLFFFTHLDESPITGRTRLLVFSRKNFRELAQFNADAFMEEFKDSLIASSDPRHKVVEQVVQILAQRNQDIAEISAVPWTVHVVDSPTM-NAFVLPNGEIFVFTGMLNAVTDIHQLTFILGHEMAHALIGHAAEQASLSHVVELLSLVLLTAIWAVCPRDSLAALGHWIQGKLVQFLFDRPFSRKLEAEADQVGLQMAAKACADVRAGPVFWEQMEIFDQLSGQPTMPEWLSTHPSHQNRVRQLDRLIPEALELRARCNC 434          
BLAST of Peptidase_M48 domain-containing protein vs. Ensembl Xenopus
Match: tmem19 (transmembrane protein 19 [Source:Xenbase;Acc:XB-GENE-1013693])

HSP 1 Score: 162.54 bits (410), Expect = 9.471e-45
Identity = 99/302 (32.78%), Postives = 155/302 (51.32%), Query Frame = 1
Query:  181 GRLLNRWWRNLSHEEKSRIIKKYKHHTKLLAFFGTSLVGYETWVYYRS-IEICPYTGRKRFMILTKEDMKEILGEPADNELLQ-KSSVLSSNHPYYKSVKSIVDTIIVKNKEVFPELSGNWKLLIYDDDSIINAACLPNGEIIVYTGLIKFVENHHQLAVVISHELSHVILEHGRETLGRMSILSIIVTVCGFALWTFIQGDFMAFLSNWLKNRIFRVCLELPYNRMLESEADVLGLQMLARSCYDVNEAKKFWDIMSIFEK-KTEISLPNWLCTHPLSELRAKHLERLTPSASKLSKECGC 1077
            GR L +WWR L    K  + K+     KL        VG    ++Y + +E  P TGR R +    E  + +     +N + + K  +L      Y+ V+ IVD +I  N ++ P +S    ++     S INA  LPNG+I V+TG+++ V + HQL+ ++ HEL+H IL+H  E       L  ++ +    +W     D +A    W+++ +       P++R LE+EAD +GLQ+ A++C DV  +  FW  M I E  + +   P WL THP  + RA HL+RL P A KL ++C C
Sbjct:  147 GRSLRKWWRALP-ANKQELFKEKVKKNKLRLSLSIGAVGIIFILFYFTHLEENPITGRSRLLFFKNEHYELLTNVEYENLIEEFKDIMLPKEDLRYQLVQMIVDHLISCNGDL-PGVSKIEWVVHVVQKSDINAFVLPNGQIFVFTGMLEAVTDVHQLSFILGHELAHAILDHTAEMHSLTHFLDFLLLISIAMIWAICPMDSLAVFGQWIQSTLKDFVFNRPFSRSLEAEADKVGLQLAAKACVDVRASSVFWKQMEILESLQGQARTPEWLSTHPSHQNRADHLDRLIPEAIKLREKCNC 446          
BLAST of Peptidase_M48 domain-containing protein vs. Ensembl Mouse
Match: Oma1 (OMA1 zinc metallopeptidase [Source:MGI Symbol;Acc:MGI:1914263])

HSP 1 Score: 164.081 bits (414), Expect = 3.820e-45
Identity = 97/308 (31.49%), Postives = 158/308 (51.30%), Query Frame = 1
Query:  181 GRLLNRWWRNLSHEEKSRIIKKYKHHTKLLAFFGTSLVGYETWVYYRS-IEICPYTGRKRFMILTKEDMK-------EILGEPADNELLQKSSVLSSNHPYYKSVKSIVDTIIVKNKEVFPELSGNWKLLIYDDDSIINAACLPNGEIIVYTGLIKFVENHHQLAVVISHELSHVILEHGRETLGRMSILSIIVTVCGFALWTFIQGDFMAFLSNWLKNRIFRVCLELPYNRMLESEADVLGLQMLARSCYDVNEAKKFWDIMSIFEK-KTEISLPNWLCTHPLSELRAKHLERLTPSASKLSKECGC 1077
            GR + +WW+ L   +K  + K      K     G S  G    V+Y + +E+ P TGR + +++ KE  +       E+  E   N+LL +        P Y +VK +V  +   N++V      NW + + D  ++ NA  LPNG++ ++TGL+  V + HQL+ ++ HE++H +L H  E    + +L  +  +    +W     D +A L  W+++++     + PY+R LE+EAD +GLQ+ A++C DV  +  FW  M   E       LP WL THP    RA++L+RL P A KL + C C
Sbjct:  162 GRGIRKWWQALPPNKKE-LFKDSVRKNKWRLLLGLSAFGLLFVVFYFTHLEVSPVTGRSKLLLVGKEHFRLLSDLEYEVWMEEFKNDLLPE------RDPRYLTVKEMVYHLTQCNRDVPGISETNWVVHVVDSPAV-NAFVLPNGQVFIFTGLLNSVTDVHQLSFLLGHEIAHAVLGHAAEKASLVHLLDFLGMIFLTMIWAICPRDSLAVLGQWIQSKLQEYMFDRPYSRTLEAEADKVGLQLAAKACADVRASSVFWQQMEFSESLHGYPKLPEWLSTHPSHGNRAEYLDRLIPQALKLREVCNC 461          
BLAST of Peptidase_M48 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q3SZN3|OMA1_BOVIN (Metalloendopeptidase OMA1, mitochondrial OS=Bos taurus OX=9913 GN=OMA1 PE=2 SV=2)

HSP 1 Score: 176.407 bits (446), Expect = 7.509e-49
Identity = 105/315 (33.33%), Postives = 169/315 (53.65%), Query Frame = 1
Query:  181 GRLLNRWWRNLSHEEKSRIIKKYKHHTKLLAFFGTSLVGYETWVYYRS-IEICPYTGRKRFMILTKEDMKEILGEPADNELLQ--KSSVLSSNHPYYKSVKSIVDTIIVKNKEVFPELSG-NWKLLIYDDDSIINAACLPNGEIIVYTGLIKFVENHHQLAVVISHELSHVILEHGRETLGRMSILSIIVTVCGFALWTFIQGDFMAFLSNWLKNRIFRVCLELPYNRMLESEADVLGLQMLARSCYDVNEAKKFWDIMSIFEK-KTEISLPNWLCTHPLSELRAKHLERLTPSASKLSKECGCLVESSVYQKIL 1110
            GR + +WW+ L    K  + K+     K   F G S  G    V+Y + +E+ P TGR + +IL KE  + +L E      ++  K+ +L+     Y +VK++V  +I  N+++ P +S  NW + + D   I NA  LPNG++ V+TGL+  V + HQL+ ++ HE++H +LEH  E    + +L  +  +    +W     D +A L  W+++++     + PY+R LE+EAD +GLQ+ A++C DV  +  FW  M   E       LP WL THP    RA+HL+RL P A K+ + C C   S    ++L
Sbjct:  166 GRGIRKWWQALP-PNKKELFKESLRKNKWKLFLGLSSFGLLFVVFYFTHLEVSPVTGRSKLLILGKEHFR-LLSELEYEAWMEEFKNDMLTEKDARYVAVKAVVHHLIECNQDI-PGISEINWIIHVVDSPDI-NAFVLPNGQVFVFTGLLNSVTDIHQLSFLLGHEIAHAVLEHAAEKASLVHLLDFLGLIFLTTIWAICPRDSLALLGQWIQSKLQEFLFDRPYSRTLEAEADRIGLQLAAKACVDVRASSVFWQQMEFAESLHGHPKLPEWLSTHPSHGNRAEHLDRLIPQALKIRETCNCPPLSGPDPRLL 476          
BLAST of Peptidase_M48 domain-containing protein vs. UniProt/SwissProt
Match: sp|E9QBI7|OMA1_DANRE (Metalloendopeptidase OMA1, mitochondrial OS=Danio rerio OX=7955 GN=oma1 PE=3 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 1.942e-48
Identity = 90/302 (29.80%), Postives = 168/302 (55.63%), Query Frame = 1
Query:  181 GRLLNRWWRNLSHEEKSRIIK-KYKHHTKLLAFFGTSLVGYETWVYYRSIEICPYTGRKRFMILTKEDMKEILGEPADNELLQ-KSSVLSSNHPYYKSVKSIVDTIIVKNKEVFPELSGNWKLLIYDDDSIINAACLPNGEIIVYTGLIKFVENHHQLAVVISHELSHVILEHGRETLGRMSILSIIVTVCGFALWTFIQGDFMAFLSNWLKNRIFRVCLELPYNRMLESEADVLGLQMLARSCYDVNEAKKFWDIMSIFEK-KTEISLPNWLCTHPLSELRAKHLERLTPSASKLSKECGC 1077
            GR + +WW  L   +K    +  ++     L   GT L+   +  ++  ++  P TGR R ++ ++++ +E+    AD  + + K S+++S+ P +K V+ +V  +  +N+++    +  W + + D  ++ NA  LPNGEI V+TG++  V + HQL  ++ HE++H ++ H  E      ++ ++  V   A+W     D +A L +W++ ++ +   + P++R LE+EAD +GLQM A++C DV     FW+ M IF++   + ++P WL THP  + R + L+RL P A +L   C C
Sbjct:  135 GRSIRKWWVALPANKKQLFREWSWRRRWHFLGA-GTGLLFIASLFFFTHLDESPITGRTRLLVFSRKNFRELAQFNADAFMEEFKDSLIASSDPRHKVVEQVVQILAQRNQDIAEISAVPWTVHVVDSPTM-NAFVLPNGEIFVFTGMLNAVTDIHQLTFILGHEMAHALIGHAAEQASLSHVVELLSLVLLTAIWAVCPRDSLAALGHWIQGKLVQFLFDRPFSRKLEAEADQVGLQMAAKACADVRAGPVFWEQMEIFDQLSGQPTMPEWLSTHPSHQNRVRQLDRLIPEALELRARCNC 434          
BLAST of Peptidase_M48 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q96E52|OMA1_HUMAN (Metalloendopeptidase OMA1, mitochondrial OS=Homo sapiens OX=9606 GN=OMA1 PE=1 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 5.854e-45
Identity = 97/304 (31.91%), Postives = 163/304 (53.62%), Query Frame = 1
Query:  181 GRLLNRWWRNLSHEEKSRIIKKYKHHTKLLAFFGTSLVGYETWVYYRS-IEICPYTGRKRFMILTKEDMKEILGEPADNELLQ--KSSVLSSNHPYYKSVKSIVDTIIVKNKEVFPELSG-NWKLLIYDDDSIINAACLPNGEIIVYTGLIKFVENHHQLAVVISHELSHVILEHGRETLGRMSILSIIVTVCGFALWTFIQGDFMAFLSNWLKNRIFRVCLELPYNRMLESEADVLGLQMLARSCYDVNEAKKFWDIMSIFEK-KTEISLPNWLCTHPLSELRAKHLERLTPSASKLSKECGC 1077
            GR + +WW+ L    K  ++K+     K   F G S  G    V+Y + +E+ P TGR + ++L KE  + +L E      ++  K+ +L+     Y +VK ++  +I  NK+V P +S  NW + + D   IINA  LPNG++ V+TG +  V + HQL+ ++ HE++H +L H  E  G + +L  +  +    +W     D +A L  W+++++       PY+R LE+EAD +GL + A++C D+  +  FW  M   +    +  +P WL THP    R ++L+RL P A K+ + C C
Sbjct:  166 GRGIRKWWQALP-PNKKEVVKENIRKNKWKLFLGLSSFGLLFVVFYFTHLEVSPITGRSKLLLLGKEQFR-LLSELEYEAWMEEFKNDMLTEKDARYLAVKEVLCHLIECNKDV-PGISQINWVIHVVDS-PIINAFVLPNGQMFVFTGFLNSVTDIHQLSFLLGHEIAHAVLGHAAEKAGMVHLLDFLGMIFLTMIWAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACADIRASSVFWQQMEFVDSLHGQPKMPEWLSTHPSHGNRVEYLDRLIPQALKIREMCNC 465          
BLAST of Peptidase_M48 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9D8H7|OMA1_MOUSE (Metalloendopeptidase OMA1, mitochondrial OS=Mus musculus OX=10090 GN=Oma1 PE=1 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 2.672e-44
Identity = 97/308 (31.49%), Postives = 158/308 (51.30%), Query Frame = 1
Query:  181 GRLLNRWWRNLSHEEKSRIIKKYKHHTKLLAFFGTSLVGYETWVYYRS-IEICPYTGRKRFMILTKEDMK-------EILGEPADNELLQKSSVLSSNHPYYKSVKSIVDTIIVKNKEVFPELSGNWKLLIYDDDSIINAACLPNGEIIVYTGLIKFVENHHQLAVVISHELSHVILEHGRETLGRMSILSIIVTVCGFALWTFIQGDFMAFLSNWLKNRIFRVCLELPYNRMLESEADVLGLQMLARSCYDVNEAKKFWDIMSIFEK-KTEISLPNWLCTHPLSELRAKHLERLTPSASKLSKECGC 1077
            GR + +WW+ L   +K  + K      K     G S  G    V+Y + +E+ P TGR + +++ KE  +       E+  E   N+LL +        P Y +VK +V  +   N++V      NW + + D  ++ NA  LPNG++ ++TGL+  V + HQL+ ++ HE++H +L H  E    + +L  +  +    +W     D +A L  W+++++     + PY+R LE+EAD +GLQ+ A++C DV  +  FW  M   E       LP WL THP    RA++L+RL P A KL + C C
Sbjct:  162 GRGIRKWWQALPPNKKE-LFKDSVRKNKWRLLLGLSAFGLLFVVFYFTHLEVSPVTGRSKLLLVGKEHFRLLSDLEYEVWMEEFKNDLLPE------RDPRYLTVKEMVYHLTQCNRDVPGISETNWVVHVVDSPAV-NAFVLPNGQVFIFTGLLNSVTDVHQLSFLLGHEIAHAVLGHAAEKASLVHLLDFLGMIFLTMIWAICPRDSLAVLGQWIQSKLQEYMFDRPYSRTLEAEADKVGLQLAAKACADVRASSVFWQQMEFSESLHGYPKLPEWLSTHPSHGNRAEYLDRLIPQALKLREVCNC 461          
BLAST of Peptidase_M48 domain-containing protein vs. UniProt/SwissProt
Match: sp|D3ZS74|OMA1_RAT (Metalloendopeptidase OMA1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Oma1 PE=3 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 2.913e-44
Identity = 97/308 (31.49%), Postives = 158/308 (51.30%), Query Frame = 1
Query:  181 GRLLNRWWRNLSHEEKSRIIKKYKHHTKLLAFFGTSLVGYETWVYYRS-IEICPYTGRKRFMILTKEDMK-------EILGEPADNELLQKSSVLSSNHPYYKSVKSIVDTIIVKNKEVFPELSGNWKLLIYDDDSIINAACLPNGEIIVYTGLIKFVENHHQLAVVISHELSHVILEHGRETLGRMSILSIIVTVCGFALWTFIQGDFMAFLSNWLKNRIFRVCLELPYNRMLESEADVLGLQMLARSCYDVNEAKKFWDIMSIFEK-KTEISLPNWLCTHPLSELRAKHLERLTPSASKLSKECGC 1077
            GR + +WW+ L  ++K+ + K      K     G S  G    V+Y + +E+ P TGR + +++ KE  +       E+  E   N+LL +        P Y +VK +V  +   N++V      NW + +     + NA  LPNG++ V+TGL+  V + HQL+ ++ HE++H +L H  E    + +L  +  +    +W     D +A L  W+++++     + PY+R LE+EAD +GLQ+ A++C DV  +  FW  M   E       LP WL THP    RA++L+RL P A KL + C C
Sbjct:  145 GRGIRKWWQALPPDKKA-LFKDSVKRNKWRLLLGLSAFGLLFVVFYFTHLEVSPVTGRSKLLLVGKEHFRLLSDLEYEVWMEEFKNDLLPEED------PRYLTVKKVVYHLTQCNQDVPGVSEINWVVHVVHSPKV-NAFVLPNGQVFVFTGLLNSVTDMHQLSFLLGHEIAHAVLGHAAEKASLVHLLDFLGMIFLTMIWAICPRDSLAVLGQWIQSKLQEYMFDRPYSRTLEAEADKIGLQLAAKACVDVRASSVFWQQMEFSESLHGYPKLPEWLSTHPSHGNRAEYLDRLIPQALKLREVCNC 444          
BLAST of Peptidase_M48 domain-containing protein vs. TrEMBL
Match: A0A443SQT4 (Metalloendopeptidase OMA1-like protein (Fragment) OS=Leptotrombidium deliense OX=299467 GN=B4U80_02338 PE=3 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 2.669e-57
Identity = 118/329 (35.87%), Postives = 180/329 (54.71%), Query Frame = 1
Query:  181 GRLLNRWWRNLSHEEKSRIIKK--YKHHTKLLAFFGTSLVGYETWVYYRSIEICPYTGRKRFMILTKEDMKEILGEPADNELLQ-KSSVLSSNHPYYKSVKSIVDTIIVKNKEVFPELSGNWKLLIYDDDSIINAACLPNGEIIVYTGLIKFVENHHQLAVVISHELSHVILEHGRETLGRMSILSIIVTVCGFALWTFIQGDFMAFLSNWLKNRIFRVCLELPYNRMLESEADVLGLQMLARSCYDVNEAKKFWDIMSIFEK--------KTEISLPNWLCTHPLSELRAKHLERLTPSASKLSKECGCLVESSVYQKIL-HQYKNLV 1131
            GR +  WW+NL  E+K  ++K   YK+ T LL +F   L  +  + YY  ++  P TGR+RF+  T +  ++I+     + L Q    +L S+H   K V++I + +++ NK++       W + + +   I NA  LPNG+I V+TG++  V N  QL +VI+HE+SH +L HG E L    IL + +      LW  I  D  A    WL ++I  V   LPYNRMLE+EAD +GL++ A++C+DV EA  FW  MS+ EK        +++I    +L THP  E RA+++E L P A ++   C C        +IL  Q K +V
Sbjct:   49 GRRIRLWWKNLP-EDKRLVLKAWIYKNRTTLLLYFSAVLALFYVY-YYSHLQETPLTGRRRFIAFTDKQYEQIVDFEYKSLLQQFGGRLLPSSHSVCKKVENIANRLLLANKDIHQIYDKKWSVCVVEAPDIKNAFVLPNGQIFVFTGILSAVSNDDQLGIVIAHEMSHALLGHGAELLSHAHILDVFIISTLCLLWAVIPFDTYAAFLTWLYHKIVSVIFNLPYNRMLETEADEIGLKLAAKACFDVREAVVFWRKMSLTEKEEIQAIYGESDIPQMEFLSTHPSHESRAENIESLLPKAMEIRNACNCPKLPQTDPRILFEQMKRIV 375          
BLAST of Peptidase_M48 domain-containing protein vs. TrEMBL
Match: E0VKN7 (Metalloendopeptidase OMA1, putative OS=Pediculus humanus subsp. corporis OX=121224 GN=8235564 PE=3 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 7.933e-57
Identity = 104/303 (34.32%), Postives = 172/303 (56.77%), Query Frame = 1
Query:  178 SGRLLNRWWRNLSHEEKSRIIKK-YKHHTKLLAFFGTSLVGYETWVYYRSIEICPYTGRKRFMILTKEDMKEILGEPADNELLQ--KSSVLSSNHPYYKSVKSIVDTIIVKNKEVFPELSGNWKLLIYDDDSIINAACLPNGEIIVYTGLIKFVENHHQLAVVISHELSHVILEHGRETLGRMSILSIIVTVCGFALWTFIQGDFMAFLSNWLKNRIFRVCLELPYNRMLESEADVLGLQMLARSCYDVNEAKKFWDIMSIFEKKTEISLPNWLCTHPLSELRAKHLERLTPSASKLSKECGC 1077
            SGR++ RWW+ L  EEK +I+++ Y   TK+ A  GT  +G     Y  +I   P T RKRFM+L ++ + +I  E   N+ ++  K +++ + HP Y+ V  + + +++ N+++       W +++ D   I NA  LP+G+I V+TG++    N HQLA+V++HE+SH IL H  E++ ++ ++  I+ +     W+ I  D  A  S W+   I  V + LP++R +E EAD +GLQ+ A+SCYD+ EA  FW  + +      +    WL THP  E R   L+ L P A +L ++  C
Sbjct:   58 SGRIIRRWWQKLPQEEKEKILQQIYSKKTKI-ACCGTIFIGALYLYYLENITEEPLTKRKRFMVLNQKQLYQI-AEFEYNQQMRTYKQNIVPAWHPLYRRVTRVANNLLLSNRDLKEIRDKTWTVIVVDRPDITNAFALPHGKIFVFTGMLNLCTNDHQLAIVLAHEISHSILSHTAESMSKIFLMEFILIIPSLIFWS-ILSDAWALFSEWITANIASVLIHLPFSRAIEKEADFVGLQLAAKSCYDIREAPIFWGKLKVLSSDAVL---EWLSTHPRHESRQSELKELLPQALELREKSNC 354          
BLAST of Peptidase_M48 domain-containing protein vs. TrEMBL
Match: A0A2J7Q0V1 (Peptidase_M48 domain-containing protein OS=Cryptotermes secundus OX=105785 GN=B7P43_G04940 PE=3 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 3.021e-55
Identity = 106/301 (35.22%), Postives = 165/301 (54.82%), Query Frame = 1
Query:  181 GRLLNRWWRNLSHEEKSRIIKKYKHHTKLLAFFGTSLVGYETWVYYRSIEICPYTGRKRFMILTKEDMKEILG-EPADNELLQKSSVLSSNHPYYKSVKSIVDTIIVKNKEVFPEL-SGNWKLLIYDDDSIINAACLPNGEIIVYTGLIKFVENHHQLAVVISHELSHVILEHGRETLGRMSILSIIVTVCGFALWTFIQGDFMAFLSNWLKNRIFRVCLELPYNRMLESEADVLGLQMLARSCYDVNEAKKFWDIMSIFEKKTEISLPNWLCTHPLSELRAKHLERLTPSASKLSKECGC 1077
            GR   +WWR L  + K  +I + K +   L   G  +     W YY  +E  P TGR +F+ + KE + ++   E      L K   L   HP YK V  + + ++  N+E+ P+L   NW + + ++ S+ NA  LPNG I V+TG++    N  QL V+++HE+SHV+L H  E    + ++ ++V V    +W  +  +  A +++WL     +V  +LP++R LE+EAD +GLQ+ A++CYDV EA  FW  MS  + + E     WL THP SE R   LE L P+A +L ++C C
Sbjct:   95 GRTFRKWWRALPPDRKQDLILRLKKNKTALLASGALVSTGVVWYYYSHLEEDPITGRSKFIAINKEQILQLAQIELVMQRELHKDHFLPPAHPAYKRVVKVANQLLRSNREI-PQLRETNWIVTVVNEPSVTNAFVLPNGHIFVFTGILSLCTNDDQLCVILAHEISHVLLSHMAEQFSSLHLMDLLVLVPLALIWAVL-PEAAAVIAHWLSGYFTKVLFQLPFSRALEAEADEIGLQLTAKACYDVREASVFWAKMSSLDSEFE-----WLSTHPNSETRQFVLESLMPTAIQLREKCKC 388          
BLAST of Peptidase_M48 domain-containing protein vs. TrEMBL
Match: A0A3M7Q6W4 (Metalloendopeptidase mitochondrial-like OS=Brachionus plicatilis OX=10195 GN=BpHYR1_019342 PE=3 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 3.312e-55
Identity = 108/307 (35.18%), Postives = 171/307 (55.70%), Query Frame = 1
Query:  178 SGRLLNRWWRNLSHEEKSRIIKKYKHHTKLLAFFGTSL--VGYETWVYYRS-IEICPYTGRKRFMILTKEDMKEILGEPADNE---LLQKSSVLSSNHPYYKSVKSIVDTIIVKNKEVFPELSG-NWKLLIYDDDSIINAACLPNGEIIVYTGLIKFVENHHQLAVVISHELSHVILEHGRETLGRMSILSIIVTVCGFALWTFIQGDFMAFLSNWLKNRIFRVCLELPYNRMLESEADVLGLQMLARSCYDVNEAKKFWDIMSIFEKKTEISLPNWLCTHPLSELRAKHLERLTPSASKLSKECGC 1077
            +GR   +WW  L   ++   +   + H      +G+S+    +  +VYY S I+  P TGRKRF+I T E + EI  E  + E   ++ +  +L    PY      + + +   N+E FPE+   +WKL + D   IINA   P+G+++V++GL+ FVEN  +LA++++HE+SH +L+H  E +    +L +I       +W  +  D  A ++  + +R+ +  LELPY+R LE EAD +GL   A++C+DV  +  FW  M       EI LP +L THP +E RA+ LE L P+A +L KEC C
Sbjct:   55 AGRGFRKWWTALPKMKRKIFLAHLRRHR---VRYGSSIGITTFTGFVYYDSHIQETPLTGRKRFIIFTNEQLAEI--EKLEQEQIFMIYEKDILDPYSPYVNRAMRVANRLFTANRE-FPEVDKIDWKLTVIDS-RIINAVAFPSGDLVVFSGLLDFVENDDELAIIMAHEMSHAVLQHAAEEISHTRLLDVISIGLVLVVWALLPTDLTAAIAQLVADRLLKFALELPYSRDLEREADHVGLMFAAKACFDVRYSPVFWRRMG--HVNPEI-LPEFLSTHPANESRAQELETLIPAALRLRKECNC 351          
BLAST of Peptidase_M48 domain-containing protein vs. TrEMBL
Match: A0A2J7Q0V3 (Peptidase_M48 domain-containing protein OS=Cryptotermes secundus OX=105785 GN=B7P43_G04940 PE=3 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 1.729e-54
Identity = 109/315 (34.60%), Postives = 170/315 (53.97%), Query Frame = 1
Query:  181 GRLLNRWWRNLSHEEKSRIIKKYKHHTKLLAFFGTSLVGYETWVYYRSIEICPYTGRKRFMILTKEDMKEILG-EPADNELLQKSSVLSSNHPYYKSVKSIVDTIIVKNKEVFPEL-SGNWKLLIYDDDSIINAACLPNGEIIVYTGLIKFVENHHQLAVVISHELSHVILEHGRETLGRMSILSIIVTVCGFALWTFIQGDFMAFLSNWLKNRIFRVCLELPYNRMLESEADVLGLQMLARSCYDVNEAKKFWDIMSIFEKKTEISLPNWLCTHPLSELRAKHLERLTPSASKLSKECGCLVESSVYQKILHQY 1119
            GR   +WWR L  + K  +I + K +   L   G  +     W YY  +E  P TGR +F+ + KE + ++   E      L K   L   HP YK V  + + ++  N+E+ P+L   NW + + ++ S+ NA  LPNG I V+TG++    N  QL V+++HE+SHV+L H  E    + ++ ++V V    +W  +  +  A +++WL     +V  +LP++R LE+EAD +GLQ+ A++CYDV EA  FW  MS  + + E     WL THP SE R   LE L P+A +L ++C        Y +IL+ Y
Sbjct:   95 GRTFRKWWRALPPDRKQDLILRLKKNKTALLASGALVSTGVVWYYYSHLEEDPITGRSKFIAINKEQILQLAQIELVMQRELHKDHFLPPAHPAYKRVVKVANQLLRSNREI-PQLRETNWIVTVVNEPSVTNAFVLPNGHIFVFTGILSLCTNDDQLCVILAHEISHVLLSHMAEQFSSLHLMDLLVLVPLALIWAVL-PEAAAVIAHWLSGYFTKVLFQLPFSRALEAEADEIGLQLTAKACYDVREASVFWAKMSSLDSEFE-----WLSTHPNSETRQFVLESLMPTAIQLREKCKV---RHTYGRILNTY 399          
BLAST of Peptidase_M48 domain-containing protein vs. Ensembl Cavefish
Match: oma1 (OMA1 zinc metallopeptidase [Source:NCBI gene;Acc:103027560])

HSP 1 Score: 161.384 bits (407), Expect = 1.876e-44
Identity = 97/327 (29.66%), Postives = 168/327 (51.38%), Query Frame = 1
Query:  181 GRLLNRWWRNLSHEEKSRIIKKYKHHTKLLAFFGTSLVGYETWVYYRSIEICPYTGRKRFMILTKEDMKEILGEPADNELLQKSSVL--SSNHPYYKSVKSIVDTIIVKNKEVFPELSGNWKLLIYDDDSIINAACLPNGEIIVYTGLIKFVENHHQLAVVISHELSHVILEHGRETLGRMSILSIIVTVCGFALWTFIQGDFMAFLSNWLKNRIFRVCLELPYNRMLESEADVLGLQMLARSCYDVNEAKKFWDIMSIFEK-KTEISLPNWLCTHPLSELRAKHLERLTPSASKLSKECGC---------LVESSVYQKILHQYKN 1125
            GR + +WW+ L   +K    +        L   G  L+   +   +  +E  P TGR R ++ +KE   E L + A NE +++   L    + P  + V+ +V  ++ +N+++       WK+ + +   ++NA  LP+G++ V+TG+++ V + HQL+ V+ HE++H ++ H  E      ++ ++  +   A+W     D +A L  W+++++ +     PY+R LESEAD +GLQ+ A++C DV     FW  M + E+ K E ++P WL THP    R  HL+RL P A +L  +C C          V S   QK+L   K 
Sbjct:  123 GRSIRKWWKALPPNKKQLFREWVWQRRWHLVAAGAGLMLITSLFLFTHLEESPITGRTRLLVFSKESFME-LAQHASNEYMEEFEKLFIPVSDPRQQVVEQVVQHLVQRNQDMDGINYLPWKVHVVESP-VVNAFVLPDGKVFVFTGMLEAVADIHQLSFVLGHEMAHALIGHAAEQASLSHVVDLLSLILLTAIWAICPRDSLAVLGQWIQSKLVQFMFNRPYSRKLESEADQVGLQLAAKACADVRSGPVFWQQMELAEQLKGEPTIPEWLSTHPSHRNRITHLDRLIPEALELRSKCECPHLPAVDPRAVFSKTVQKLLEDAKK 447          
BLAST of Peptidase_M48 domain-containing protein vs. Ensembl Sea Lamprey
Match: oma1 (OMA1 zinc metallopeptidase [Source:NCBI gene;Acc:100331186])

HSP 1 Score: 185.652 bits (470), Expect = 4.546e-56
Identity = 95/311 (30.55%), Postives = 172/311 (55.31%), Query Frame = 1
Query:  184 RLLNRWWRNLSHEEKSRIIKKYKHHTKLLAFFGTSLVGYETWVYYRSIEICPYTGRKRFMILTKEDMKEILGEPADNELLQ--KSSVLSSNHPYYKSVKSIVDTIIVKNKEVFPELSGNWKLLIYDDDSIINAACLPNGEIIVYTGLIKFVENHHQLAVVISHELSHVILEHGRETLGRMSILSIIVTVCGFALWTFIQGDFMAFLSNWLKNRIFRVCLELPYNRMLESEADVLGLQMLARSCYDVNEAKKFWDIMSIFEKKTEISLPNWLCTHPLSELRAKHLERLTPSASKLSKECGCLVESSVYQKIL 1110
            R L +WW+ L  ++++ + +    +   +A     + G     Y   ++  P TGR+R +I + E +   L E   NE ++  K ++L  +H  +++V   V  ++ +N++V    S  W + + D     NA  LPNG+I V+TG+++ V N  QL +V+ HE++H +L H  E    +  + +   V    +W  +  D+++ L +W  ++  ++ L++PY+R LE EAD +GL++ A++C+DV  +  FW+ M   E++  ++LP WL THP  E RA HL+RL P A KL + C C   +S+  +++
Sbjct:    5 RSLRKWWQGLPQDKRALLREWASRNRGRIAMVVLGIGGLSVAFYVTHLDETPLTGRRRLLIFSSEQLT-WLSEMEYNETMEEYKDNILPKSHAAHRAVALAVQQLVERNQDVAQVASTPWTVSVVDLPKA-NAYVLPNGQIFVFTGMLEKVANADQLGIVLGHEMAHAVLGHAAEKASFLHFIDVFSLVFITIIWAVLPRDWLSALGHWAHSQAMQLLLDMPYSRQLEREADEVGLKLAAKACFDVRASVAFWEQMHTSEEEG-VTLPEWLSTHPSHEQRAAHLQRLLPQAIKLREACNCPALASLDPRLM 312          
BLAST of Peptidase_M48 domain-containing protein vs. Ensembl Yeast
Match: OMA1 (Metalloendopeptidase of the mitochondrial inner membrane; important for adaptive responses to various homeostatic insults, preservation of normal mitochondrial function under damage-eliciting conditions, and stability of respiratory supercomplexes; involved in turnover of membrane-embedded proteins; mediates degradation of Cox1p in coa2 mutant cells; zebrafish ortholog has a role in organ development and mouse ortholog is also required for respiratory supercomplex stability [Source:SGD;Acc:S000001795])

HSP 1 Score: 100.523 bits (249), Expect = 2.838e-24
Identity = 74/306 (24.18%), Postives = 149/306 (48.69%), Query Frame = 1
Query:  226 KSRIIKKYKHHTKLLAFFGTSLVGYETWVYYRSIEICPYTGRKRFMILTKEDMKEILGEPADNELLQKSS--VLSSNHPYYKSVKSIVDTII---VKNKEVFPELSGN--WKLLIYDDDSI-INAACLPNGEIIVYTGLIKFVENHHQLAVVISHELSHVILEHGRETLGRMSILSIIVTVCGFALWTFIQGDFMAFLSNWLKNRIFRVCLELPYNRMLESEADVLGLQMLARSCYDVNEAKKFWDIMSIFEKKTE---ISLPNWLCTHPLSELRAKHLERLTPSASKLSKECGCLVESSVYQKIL 1110
            KS ++ K       L F G SL       YY  ++  P + R RF+ +++  ++  +G      + +++   +L   HP    +++I   I+    K+  V   L     W++ + +D +   NA  LP G++ +++ ++    N   +A V++HE +H +  H  E L +  I S++    G  L+T + G      ++ + N +    L +P +R +E+EAD +GL +++R+C+   E+ K W+ M+ FEK+     +    +L THP S  R +++ +  P A+++ ++  C    + Y+   
Sbjct:   56 KSILLDKSSRKYLALLFGGCSLF------YYTHLDKAPVSDRSRFIWVSRP-LELTIGNYTYKSIWRQTQQEILPPQHPLSIKIENIFMKIVEAAYKDPSVDNSLLDGIKWEIHVVNDPTASPNAFVLPGGKVFIFSSILPICANDDGIATVLAHEFAHQLARHTAENLSKAPIYSLL----GLVLYT-VTG------AHAINNILLDGFLRMPASRQMETEADYIGLMIMSRACFQPQESIKVWERMANFEKQMNRGGVVNMEFLSTHPASTRRIENMSKWLPKANEIYEQSDCSSMGNYYKSFF 343          
BLAST of Peptidase_M48 domain-containing protein vs. Ensembl Nematostella
Match: EDO36157 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJG2])

HSP 1 Score: 89.3521 bits (220), Expect = 2.282e-19
Identity = 66/256 (25.78%), Postives = 123/256 (48.05%), Query Frame = 1
Query:  178 SGRLLNRWWRNLSHEEKSRIIKKY----KHHTKLLAFFGTSLVGYETWVYYRSIEICPYTGRKRFMILTKEDMKEILGEPADNELLQ-KSSVLSSNHPYYKSVKSIVDTIIVKNKEVFPELSG-NWKLLIYDDDSIINAACLPNGEIIVYTGLIKFVENHHQLAVVISHELSHVILEH-GRETLGRMSIL---SIIVTVCGFALWTFIQGDFMAFLSNWLKNRIFRVC----LELPYNRMLESEADVLGLQMLARS 903
             GR   RWW+ L    K +++       +   KL+   G++ V +  +  Y  +E  P T R+RFM +    M++++ E     L Q    +L  NHPY++ V  +   +++ N+    E+ G  W++ + D D + NA  LPNG+I ++ G+++ + N   LA ++ HE++H IL H G    G ++ +    +   +   A+   I+G     L + + + I R      ++ P   +L  E   +G++ L R 
Sbjct:  107 GGRTFRRWWQKLPAHHKHKLLTLDLLKKRRTEKLILIGGSTGVFFLAYYVYH-LEETPITHRRRFMPVGNAQMRDVIEEEYRQVLEQCGEHILPVNHPYHRRVFEVAQRLVMANRS--EEIDGIKWQVNVVDTDDV-NAFVLPNGQIFMFVGILRMLPNEGALATILGHEMAHAILRHAGHVIKGPLATILGHEMAHAILRHAVGHVIKGMLATILGHEMAHAILRYAVGHVIKGPLATILGHE---MGMRFLCRG 355          
BLAST of Peptidase_M48 domain-containing protein vs. Planmine SMEST
Match: SMESG000011639.1 (SMESG000011639.1)

HSP 1 Score: 659.448 bits (1700), Expect = 0.000e+0
Identity = 319/320 (99.69%), Postives = 320/320 (100.00%), Query Frame = 1
Query:  178 SGRLLNRWWRNLSHEEKSRIIKKYKHHTKLLAFFGTSLVGYETWVYYRSIEICPYTGRKRFMILTKEDMKEILGEPADNELLQKSSVLSSNHPYYKSVKSIVDTIIVKNKEVFPELSGNWKLLIYDDDSIINAACLPNGEIIVYTGLIKFVENHHQLAVVISHELSHVILEHGRETLGRMSILSIIVTVCGFALWTFIQGDFMAFLSNWLKNRIFRVCLELPYNRMLESEADVLGLQMLARSCYDVNEAKKFWDIMSIFEKKTEISLPNWLCTHPLSELRAKHLERLTPSASKLSKECGCLVESSVYQKILHQYKNLVYF 1137
            SGRLLNRWWRNLSHEEKSRIIKKYKHHTKLLAFFGTSLVGYETWVYYRSIEICPYTGRKRFMILTKEDMKEILGEPADNELLQKSSVLSSNHPYYKSVKSIVDTIIVKNKEVFPELSGNWKLLIYDDDSIINAACLPNGEIIVYTGLIKFVENHHQLAVVISHELSHVILEHGRETLGRMSILSIIVTVCGFALWTF+QGDFMAFLSNWLKNRIFRVCLELPYNRMLESEADVLGLQMLARSCYDVNEAKKFWDIMSIFEKKTEISLPNWLCTHPLSELRAKHLERLTPSASKLSKECGCLVESSVYQKILHQYKNLVYF
Sbjct:    3 SGRLLNRWWRNLSHEEKSRIIKKYKHHTKLLAFFGTSLVGYETWVYYRSIEICPYTGRKRFMILTKEDMKEILGEPADNELLQKSSVLSSNHPYYKSVKSIVDTIIVKNKEVFPELSGNWKLLIYDDDSIINAACLPNGEIIVYTGLIKFVENHHQLAVVISHELSHVILEHGRETLGRMSILSIIVTVCGFALWTFVQGDFMAFLSNWLKNRIFRVCLELPYNRMLESEADVLGLQMLARSCYDVNEAKKFWDIMSIFEKKTEISLPNWLCTHPLSELRAKHLERLTPSASKLSKECGCLVESSVYQKILHQYKNLVYF 322          
BLAST of Peptidase_M48 domain-containing protein vs. Planmine SMEST
Match: SMESG000020868.1 (SMESG000020868.1)

HSP 1 Score: 108.227 bits (269), Expect = 2.013e-26
Identity = 78/306 (25.49%), Postives = 142/306 (46.41%), Query Frame = 1
Query:  202 WRNLSHEEKSRIIKKYKHHTKLLAFFGTSLVGYETWVYYRSIEICPYTGRKRFMILTKEDMKEILGEPADNE---LLQKSSVLSSNHPYYKSVKSIVDTIIVKNKEVFPELSGNWKLLIYDDDSIINAACLPNGEIIVYTGLIKFVENHHQLAVVISHELSHVILEHGRETLGRMSILSIIVTVCGFALWTFIQGDFMAFLSNWLKNRIFRVCLELPYNRMLESEADVLGLQMLARSCYDVNEAKKFWDIM--SIFEKKTEISLPNWLCTHPLSELRAKHLERLTPSASKLSKECGCLVESSVYQK 1104
            W N S ++   I+     +  ++      + G +TW+Y ++ + CP   R+   I   ++      E    E    + + +++S  HP+Y  +++I D II  NKE +PE+  NW+++I +DD   +A    +G II  T L+K + N  + A +I+HE+ H+I +H +     M      +T+  F +   +   F+A L+N      F     LP  R  E EAD +G ++  ++ YD  +  K  +    +IF             +HP    R + LE L    + +  E G ++++S+  K
Sbjct:   15 WPNFSDDDTFEIVSLLYDNHMVIGGLSILIFGIQTWIYLKNWQYCPRLKRRVLNIFQNDEKNVTKAELEIKEKEIWINELNIVSPYHPFYTFIRNIFDGIISANKEDYPEIIRNWQIIILNDDKF-SAGIKESGLIIYGTTLLKDL-NAEKTAFIIAHEMGHLICKHHKIHASEMLFFWFNLTMVQFIVAICVPDGFVALLTNLSLYYTFEFGFNLPNQRRSEYEADAIGFELSRKAGYDWKKVLKHVNDFPENIFAD---------FSSHPCRLNRVEKLESLA-QLNLIKCESGSMIQNSLLHK 308          
BLAST of Peptidase_M48 domain-containing protein vs. Planmine SMEST
Match: SMESG000020868.1 (SMESG000020868.1)

HSP 1 Score: 108.227 bits (269), Expect = 5.002e-26
Identity = 78/306 (25.49%), Postives = 142/306 (46.41%), Query Frame = 1
Query:  202 WRNLSHEEKSRIIKKYKHHTKLLAFFGTSLVGYETWVYYRSIEICPYTGRKRFMILTKEDMKEILGEPADNE---LLQKSSVLSSNHPYYKSVKSIVDTIIVKNKEVFPELSGNWKLLIYDDDSIINAACLPNGEIIVYTGLIKFVENHHQLAVVISHELSHVILEHGRETLGRMSILSIIVTVCGFALWTFIQGDFMAFLSNWLKNRIFRVCLELPYNRMLESEADVLGLQMLARSCYDVNEAKKFWDIM--SIFEKKTEISLPNWLCTHPLSELRAKHLERLTPSASKLSKECGCLVESSVYQK 1104
            W N S ++   I+     +  ++      + G +TW+Y ++ + CP   R+   I   ++      E    E    + + +++S  HP+Y  +++I D II  NKE +PE+  NW+++I +DD   +A    +G II  T L+K + N  + A +I+HE+ H+I +H +     M      +T+  F +   +   F+A L+N      F     LP  R  E EAD +G ++  ++ YD  +  K  +    +IF             +HP    R + LE L    + +  E G ++++S+  K
Sbjct:   72 WPNFSDDDTFEIVSLLYDNHMVIGGLSILIFGIQTWIYLKNWQYCPRLKRRVLNIFQNDEKNVTKAELEIKEKEIWINELNIVSPYHPFYTFIRNIFDGIISANKEDYPEIIRNWQIIILNDDKF-SAGIKESGLIIYGTTLLKDL-NAEKTAFIIAHEMGHLICKHHKIHASEMLFFWFNLTMVQFIVAICVPDGFVALLTNLSLYYTFEFGFNLPNQRRSEYEADAIGFELSRKAGYDWKKVLKHVNDFPENIFAD---------FSSHPCRLNRVEKLESLA-QLNLIKCESGSMIQNSLLHK 365          
BLAST of Peptidase_M48 domain-containing protein vs. Planmine SMEST
Match: SMESG000020868.1 (SMESG000020868.1)

HSP 1 Score: 107.842 bits (268), Expect = 6.741e-26
Identity = 78/306 (25.49%), Postives = 142/306 (46.41%), Query Frame = 1
Query:  202 WRNLSHEEKSRIIKKYKHHTKLLAFFGTSLVGYETWVYYRSIEICPYTGRKRFMILTKEDMKEILGEPADNE---LLQKSSVLSSNHPYYKSVKSIVDTIIVKNKEVFPELSGNWKLLIYDDDSIINAACLPNGEIIVYTGLIKFVENHHQLAVVISHELSHVILEHGRETLGRMSILSIIVTVCGFALWTFIQGDFMAFLSNWLKNRIFRVCLELPYNRMLESEADVLGLQMLARSCYDVNEAKKFWDIM--SIFEKKTEISLPNWLCTHPLSELRAKHLERLTPSASKLSKECGCLVESSVYQK 1104
            W N S ++   I+     +  ++      + G +TW+Y ++ + CP   R+   I   ++      E    E    + + +++S  HP+Y  +++I D II  NKE +PE+  NW+++I +DD   +A    +G II  T L+K + N  + A +I+HE+ H+I +H +     M      +T+  F +   +   F+A L+N      F     LP  R  E EAD +G ++  ++ YD  +  K  +    +IF             +HP    R + LE L    + +  E G ++++S+  K
Sbjct:   86 WPNFSDDDTFEIVSLLYDNHMVIGGLSILIFGIQTWIYLKNWQYCPRLKRRVLNIFQNDEKNVTKAELEIKEKEIWINELNIVSPYHPFYTFIRNIFDGIISANKEDYPEIIRNWQIIILNDDKF-SAGIKESGLIIYGTTLLKDL-NAEKTAFIIAHEMGHLICKHHKIHASEMLFFWFNLTMVQFIVAICVPDGFVALLTNLSLYYTFEFGFNLPNQRRSEYEADAIGFELSRKAGYDWKKVLKHVNDFPENIFAD---------FSSHPCRLNRVEKLESLA-QLNLIKCESGSMIQNSLLHK 379          
BLAST of Peptidase_M48 domain-containing protein vs. Planmine SMEST
Match: SMESG000011673.1 (SMESG000011673.1)

HSP 1 Score: 107.071 bits (266), Expect = 1.854e-25
Identity = 68/270 (25.19%), Postives = 127/270 (47.04%), Query Frame = 1
Query:  181 GRLLNRWWRNLSHEEKSRIIKKYKHHTKLLAFFGTSLVGYETWVYYRSIEICPYTGRKRFMILTK-------------EDMKEILGEPADNELLQ-------KSSVLSSNHPYYKSVKSIVDTIIVKNKEVFPELSGNWKLLIYDDDSIINAACLPNGEIIVY---TGLIKFVENHHQLAVVISHELSHVILEHGRETLGRMSILSIIVTVCGFALWTFIQGDFMAFLSNWLKNRIFRVCLELPYNRMLESEADVLGLQMLARSCYDVNE 921
            GR  N  W+NLS + +  +I +    + +L     + +  + W++   ++   + GR++++   K             +++KEI  +    +  Q       K  +LS  HPYY+ +K+I+D I   N +V+P LS  W L I  +          N E++ +   +G+IK   N HQLA +I+ E +   L++ +E L R+  +S+   +  F +W+ +     AF  N     +    L  P+    + EA  L L +++R+ Y+V+E
Sbjct:   87 GRYCNDVWQNLSEDYRHDLIMEIADRSLILTLLAVTAIYTQAWIFNHQLKNFQFIGRRKYLFFEKYPKRCSCSLHKECDEIKEIKEDKYQVDFKQCYECYESKPRILSVYHPYYEVLKNIIDKIYRSNVKVYPNLSKRWFLTIEKNKGAAKVFSSSNSELLQFHITSGMIKIARNDHQLAFLIACEFARFHLKNEQEQLTRLLSISMGTNLFCFMIWSAVPAFHFAFFINLFTVFVVWARLVFPHKMFQDFEAKHLALAIMSRAGYNVDE 356          
The following BLAST results are available for this feature:
BLAST of Peptidase_M48 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
OMA11.219e-4531.91OMA1 zinc metallopeptidase [Source:HGNC Symbol;Acc... [more]
OMA14.517e-4431.33OMA1 zinc metallopeptidase [Source:HGNC Symbol;Acc... [more]
OMA13.342e-1432.32OMA1 zinc metallopeptidase [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Peptidase_M48 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase_M48 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase_M48 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
oma14.828e-4929.80OMA1 zinc metallopeptidase [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Peptidase_M48 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tmem199.471e-4532.78transmembrane protein 19 [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of Peptidase_M48 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Oma13.820e-4531.49OMA1 zinc metallopeptidase [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Peptidase_M48 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3SZN3|OMA1_BOVIN7.509e-4933.33Metalloendopeptidase OMA1, mitochondrial OS=Bos ta... [more]
sp|E9QBI7|OMA1_DANRE1.942e-4829.80Metalloendopeptidase OMA1, mitochondrial OS=Danio ... [more]
sp|Q96E52|OMA1_HUMAN5.854e-4531.91Metalloendopeptidase OMA1, mitochondrial OS=Homo s... [more]
sp|Q9D8H7|OMA1_MOUSE2.672e-4431.49Metalloendopeptidase OMA1, mitochondrial OS=Mus mu... [more]
sp|D3ZS74|OMA1_RAT2.913e-4431.49Metalloendopeptidase OMA1, mitochondrial OS=Rattus... [more]
back to top
BLAST of Peptidase_M48 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A443SQT42.669e-5735.87Metalloendopeptidase OMA1-like protein (Fragment) ... [more]
E0VKN77.933e-5734.32Metalloendopeptidase OMA1, putative OS=Pediculus h... [more]
A0A2J7Q0V13.021e-5535.22Peptidase_M48 domain-containing protein OS=Cryptot... [more]
A0A3M7Q6W43.312e-5535.18Metalloendopeptidase mitochondrial-like OS=Brachio... [more]
A0A2J7Q0V31.729e-5434.60Peptidase_M48 domain-containing protein OS=Cryptot... [more]
back to top
BLAST of Peptidase_M48 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
oma11.876e-4429.66OMA1 zinc metallopeptidase [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Peptidase_M48 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
oma14.546e-5630.55OMA1 zinc metallopeptidase [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Peptidase_M48 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
OMA12.838e-2424.18Metalloendopeptidase of the mitochondrial inner me... [more]
back to top
BLAST of Peptidase_M48 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO361572.282e-1925.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Peptidase_M48 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase_M48 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000011639.10.000e+099.69SMESG000011639.1[more]
SMESG000020868.12.013e-2625.49SMESG000020868.1[more]
SMESG000020868.15.002e-2625.49SMESG000020868.1[more]
SMESG000020868.16.741e-2625.49SMESG000020868.1[more]
SMESG000011673.11.854e-2525.19SMESG000011673.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029254 ID=SMED30029254|Name=Peptidase_M48 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1193bp
TAAAATTGAATGAACAGATTTCTAAATTTATTGAATTATTACAAAAGAAA
TAAATTATTGCGTAGTGGTAAACTGCTCAGATTTTGCAATTTTCGTCACG
ATGAAAACGTTTTTCTATATCAAGGTCTTCCATTTATTCCAATATTACAG
CAAATTTTAAGACCCATAATAATGATTTCGGGAAGGCTGTTAAATCGTTG
GTGGCGTAATCTTTCACACGAAGAAAAATCTCGAATTATAAAAAAATATA
AACATCATACTAAACTGCTTGCGTTTTTTGGAACTTCTTTAGTTGGATAT
GAAACTTGGGTGTATTATCGAAGTATCGAAATTTGTCCATATACTGGAAG
AAAGAGATTTATGATTTTGACCAAAGAAGATATGAAAGAAATTTTAGGAG
AACCAGCAGACAACGAATTATTACAGAAATCAAGTGTTTTGTCATCGAAT
CATCCTTACTATAAATCTGTTAAATCTATCGTTGATACTATTATTGTTAA
AAATAAAGAAGTATTTCCTGAATTATCAGGTAATTGGAAATTGCTGATAT
ATGATGATGATTCCATCATAAACGCTGCGTGCTTACCGAATGGTGAAATT
ATTGTTTATACCGGATTAATAAAATTTGTCGAGAATCACCATCAATTAGC
CGTTGTAATTTCCCATGAGTTGTCTCATGTTATTCTCGAACACGGGCGAG
AAACATTAGGTCGAATGTCCATACTTTCGATAATCGTAACGGTTTGCGGA
TTTGCTCTTTGGACATTTATACAAGGAGATTTTATGGCTTTTTTAAGTAA
TTGGTTAAAAAATAGAATTTTTAGAGTATGTTTAGAATTGCCATACAATC
GAATGTTGGAATCAGAAGCCGATGTATTGGGACTGCAAATGCTAGCTCGA
TCTTGCTATGACGTAAATGAAGCTAAAAAGTTCTGGGATATTATGTCGAT
CTTCGAAAAGAAAACTGAGATTTCTCTTCCAAATTGGTTATGTACTCATC
CTTTGAGTGAATTGCGCGCCAAGCACTTGGAACGTTTGACACCTTCTGCT
TCAAAACTAAGTAAAGAATGCGGATGTCTTGTAGAGTCATCAGTATACCA
GAAAATTTTACATCAATATAAAAATTTGGTTTATTTTTGATATGAAAAAT
TGATTTGAAAATTATTTTATTTGTTTTCTGTATTTTGGTGCTG
back to top

protein sequence of SMED30029254-orf-1

>SMED30029254-orf-1 ID=SMED30029254-orf-1|Name=SMED30029254-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=377bp
MNRFLNLLNYYKRNKLLRSGKLLRFCNFRHDENVFLYQGLPFIPILQQIL
RPIIMISGRLLNRWWRNLSHEEKSRIIKKYKHHTKLLAFFGTSLVGYETW
VYYRSIEICPYTGRKRFMILTKEDMKEILGEPADNELLQKSSVLSSNHPY
YKSVKSIVDTIIVKNKEVFPELSGNWKLLIYDDDSIINAACLPNGEIIVY
TGLIKFVENHHQLAVVISHELSHVILEHGRETLGRMSILSIIVTVCGFAL
WTFIQGDFMAFLSNWLKNRIFRVCLELPYNRMLESEADVLGLQMLARSCY
DVNEAKKFWDIMSIFEKKTEISLPNWLCTHPLSELRAKHLERLTPSASKL
SKECGCLVESSVYQKILHQYKNLVYF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: INTERPRO
TermDefinition
IPR001915Peptidase_M48
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
Vocabulary: molecular function
TermDefinition
GO:0004222metalloendopeptidase activity
GO:0008233peptidase activity
GO:0008237metallopeptidase activity
GO:0016787hydrolase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001915Peptidase M48PFAMPF01435Peptidase_M48coord: 174..341
e-value: 1.9E-24
score: 86.5
NoneNo IPR availablePANTHERPTHR22726:SF1METALLOENDOPEPTIDASE OMA1, MITOCHONDRIALcoord: 69..360
NoneNo IPR availablePANTHERPTHR22726OMA1 HOMOLOG, ZINC METALLOPEPTIDASEcoord: 69..360
NoneNo IPR availableCDDcd07331M48C_Oma1_likecoord: 153..346
e-value: 1.08088E-65
score: 204.733
NoneNo IPR availableTMHMMTMhelixcoord: 239..261