LIM/homeobox protein Lhx2

Overview
NameLIM/homeobox protein Lhx2
Smed IDSMED30029242
Length (bp)2061
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of LIM/homeobox protein Lhx2 (SMED30029242) t-SNE clustered cells

Violin plots show distribution of expression levels for LIM/homeobox protein Lhx2 (SMED30029242) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of LIM/homeobox protein Lhx2 (SMED30029242) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for LIM/homeobox protein Lhx2 (SMED30029242) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029242

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30029242SMESG000057112.1 SmedASXL_014324SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30029242SMESG000057112.1 SmedASXL_014323SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
cephalic gangliaSMED30029242SMESG000057112.1 dd_Smed_v4_13343_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30029242SMESG000057112.1 dd_Smed_v4_13343_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30029242SMESG000057112.1 dd_Smed_v4_13343_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30029242SMESG000057112.1 dd_Smed_v6_13343_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30029242SMESG000057112.1 OX_Smed_1.0.05848ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
body wall musculatureSMED30029242SMESG000057112.1 dd_Smed_v4_13343_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029242SMESG000057112.1 dd_Smed_v4_13343_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Human
Match: LHX2 (LIM homeobox 2 [Source:HGNC Symbol;Acc:HGNC:6594])

HSP 1 Score: 122.479 bits (306), Expect = 2.654e-29
Identity = 67/118 (56.78%), Postives = 85/118 (72.03%), Query Frame = 2
Query: 1304 NSLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSLCRQ--TGVMCGPSANQIQMPNVFDDTSLISIDKNGNYSTKTTMTTFSDISSSIL 1651
            +S + KR+RTSFKH QLRTMK+YF++NHNPD+KDL+QL+QKTGL+KRVLQVWFQNARAKFRR+L RQ  TGV     A  +Q        S +S   N + S  +T TT +D++S  L
Sbjct:  268 SSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQENTGVDKSTDA-ALQTGTPSGPASELS---NASLSPSSTPTTLTDLTSPTL 381          

HSP 2 Score: 89.3521 bits (220), Expect = 2.790e-18
Identity = 41/131 (31.30%), Postives = 72/131 (54.96%), Query Frame = 2
Query:  287 ESAVCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDY--------DRQF---KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDF 646
             +A+C  C   I D++Y       WH  CL+C  C+++L +  +CF+K+   +C++DY         R+F   +C +C   + +S+++MR  +  L YH+ CF C  CN +L  GD +G  +S ++C+  F
Sbjct:   47 RAALCAGCGGKISDRYYLLAVDKQWHMRCLKCCECKLNLESELTCFSKDGSIYCKEDYYSPSLHGPYRRFSVQRCARCHLGISASEMVMR--ARDLVYHLNCFTCTTCNKMLTTGDHFGMKDSLVYCRLHF 175          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Human
Match: LHX2 (LIM homeobox 2 [Source:HGNC Symbol;Acc:HGNC:6594])

HSP 1 Score: 122.094 bits (305), Expect = 3.367e-29
Identity = 67/118 (56.78%), Postives = 85/118 (72.03%), Query Frame = 2
Query: 1304 NSLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSLCRQ--TGVMCGPSANQIQMPNVFDDTSLISIDKNGNYSTKTTMTTFSDISSSIL 1651
            +S + KR+RTSFKH QLRTMK+YF++NHNPD+KDL+QL+QKTGL+KRVLQVWFQNARAKFRR+L RQ  TGV     A  +Q        S +S   N + S  +T TT +D++S  L
Sbjct:  262 SSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQENTGVDKSTDA-ALQTGTPSGPASELS---NASLSPSSTPTTLTDLTSPTL 375          

HSP 2 Score: 96.2857 bits (238), Expect = 1.229e-20
Identity = 41/123 (33.33%), Postives = 72/123 (58.54%), Query Frame = 2
Query:  287 ESAVCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQF---KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDF 646
             +A+C  C   I D++Y       WH  CL+C  C+++L +  +CF+K+   +C++DY R+F   +C +C   + +S+++MR  +  L YH+ CF C  CN +L  GD +G  +S ++C+  F
Sbjct:   49 RAALCAGCGGKISDRYYLLAVDKQWHMRCLKCCECKLNLESELTCFSKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMR--ARDLVYHLNCFTCTTCNKMLTTGDHFGMKDSLVYCRLHF 169          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Human
Match: LHX9 (LIM homeobox 9 [Source:HGNC Symbol;Acc:HGNC:14222])

HSP 1 Score: 119.013 bits (297), Expect = 2.544e-28
Identity = 63/127 (49.61%), Postives = 85/127 (66.93%), Query Frame = 2
Query: 1307 SLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSLCRQ----------TGVMCGPSANQIQMPNVFDDTSLISIDKNGNYSTKTTMTTFSDISSSILNH 1657
            S + KR+RTSFKH QLRTMK+YF++NHNPD+KDL+QL+QKTGL+KRVLQVWFQNARAKFRR+L RQ          T +   PSA+   +      T+L  +       T  T+T  + ++S++ +H
Sbjct:  255 SQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQENGGVDKADGTSLPAPPSADSGALTPPGTATTLTDL-------TNPTITVVTSVTSNMDSH 374          

HSP 2 Score: 96.6709 bits (239), Expect = 8.814e-21
Identity = 49/166 (29.52%), Postives = 85/166 (51.20%), Query Frame = 2
Query:  278 PEMESAVCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQF---KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDF-LVTQRDVNNRSENWRYSTETGSLNTTDVNGNSSTVTDNP 763
            PE + A+C  C   I D++Y       WH  CL+C  C+++L +  +CF K+   +C++DY R+F   +C +C   + +S+++MR+  S   YH+ CF C  CN  L  GD +G  +S ++C+  F  + Q +   +      + ++G L     NG  +     P
Sbjct:   56 PE-KPALCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDS--VYHLSCFTCSTCNKTLTTGDHFGMKDSLVYCRAHFETLLQGEYPPQLSYTELAAKSGGLALPYFNGTGTVQKGRP 218          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Human
Match: LHX9 (LIM homeobox 9 [Source:HGNC Symbol;Acc:HGNC:14222])

HSP 1 Score: 119.013 bits (297), Expect = 3.006e-28
Identity = 63/127 (49.61%), Postives = 85/127 (66.93%), Query Frame = 2
Query: 1307 SLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSLCRQ----------TGVMCGPSANQIQMPNVFDDTSLISIDKNGNYSTKTTMTTFSDISSSILNH 1657
            S + KR+RTSFKH QLRTMK+YF++NHNPD+KDL+QL+QKTGL+KRVLQVWFQNARAKFRR+L RQ          T +   PSA+   +      T+L  +       T  T+T  + ++S++ +H
Sbjct:  264 SQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQENGGVDKADGTSLPAPPSADSGALTPPGTATTLTDL-------TNPTITVVTSVTSNMDSH 383          

HSP 2 Score: 95.9005 bits (237), Expect = 1.498e-20
Identity = 49/166 (29.52%), Postives = 85/166 (51.20%), Query Frame = 2
Query:  278 PEMESAVCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQF---KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDF-LVTQRDVNNRSENWRYSTETGSLNTTDVNGNSSTVTDNP 763
            PE + A+C  C   I D++Y       WH  CL+C  C+++L +  +CF K+   +C++DY R+F   +C +C   + +S+++MR+  S   YH+ CF C  CN  L  GD +G  +S ++C+  F  + Q +   +      + ++G L     NG  +     P
Sbjct:   65 PE-KPALCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDS--VYHLSCFTCSTCNKTLTTGDHFGMKDSLVYCRAHFETLLQGEYPPQLSYTELAAKSGGLALPYFNGTGTVQKGRP 227          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Human
Match: LHX9 (LIM homeobox 9 [Source:HGNC Symbol;Acc:HGNC:14222])

HSP 1 Score: 96.6709 bits (239), Expect = 3.817e-21
Identity = 49/166 (29.52%), Postives = 85/166 (51.20%), Query Frame = 2
Query:  278 PEMESAVCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQF---KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDF-LVTQRDVNNRSENWRYSTETGSLNTTDVNGNSSTVTDNP 763
            PE + A+C  C   I D++Y       WH  CL+C  C+++L +  +CF K+   +C++DY R+F   +C +C   + +S+++MR+  S   YH+ CF C  CN  L  GD +G  +S ++C+  F  + Q +   +      + ++G L     NG  +     P
Sbjct:   71 PE-KPALCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDS--VYHLSCFTCSTCNKTLTTGDHFGMKDSLVYCRAHFETLLQGEYPPQLSYTELAAKSGGLALPYFNGTGTVQKGRP 233          

HSP 2 Score: 83.9593 bits (206), Expect = 7.318e-17
Identity = 37/49 (75.51%), Postives = 46/49 (93.88%), Query Frame = 2
Query: 1307 SLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQ 1453
            S + KR+RTSFKH QLRTMK+YF++NHNPD+KDL+QL+QKTGL+KRVLQ
Sbjct:  270 SQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQ 318          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Celegans
Match: ttx-3 (LIM/homeobox protein ttx-3 [Source:UniProtKB/Swiss-Prot;Acc:G5EE86])

HSP 1 Score: 111.694 bits (278), Expect = 2.464e-26
Identity = 49/66 (74.24%), Postives = 57/66 (86.36%), Query Frame = 2
Query: 1298 GSNSLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSL 1495
            GS S R KR+RTSFKH QLR MK YF++NHNPD+KDL+QL+ KT L+KRVLQVWFQNARAK+RR L
Sbjct:  258 GSGSQRSKRMRTSFKHHQLRAMKTYFALNHNPDAKDLKQLAAKTNLTKRVLQVWFQNARAKYRREL 323          

HSP 2 Score: 85.8853 bits (211), Expect = 1.238e-17
Identity = 42/135 (31.11%), Postives = 74/135 (54.81%), Query Frame = 2
Query:  260 IQQSKQPEMESAV---CNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQFK--CQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCS-NSQLFCKNDF 646
            ++Q + P++E A+   C  C+  I+DK    VDG  +H++CLRC  C +       C+ ++  F CR D+ ++++  C+KC  PL   D++M++    + +H  CF C +C + L  GD+Y  S    L+C   +
Sbjct:   66 LRQIQIPKIEPALLNQCCLCTFAIVDKEISVVDGKYYHNNCLRCQMCDIPFEYSDKCYVRDGVFLCRADHAKRYQKCCRKCEIPLNREDMVMKAKE--MIFHHACFVCFICGIKLNPGDYYTMSPQGHLYCHAHY 198          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Celegans
Match: ttx-3 (LIM/homeobox protein ttx-3 [Source:UniProtKB/Swiss-Prot;Acc:G5EE86])

HSP 1 Score: 112.079 bits (279), Expect = 3.511e-26
Identity = 49/66 (74.24%), Postives = 57/66 (86.36%), Query Frame = 2
Query: 1298 GSNSLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSL 1495
            GS S R KR+RTSFKH QLR MK YF++NHNPD+KDL+QL+ KT L+KRVLQVWFQNARAK+RR L
Sbjct:  286 GSGSQRSKRMRTSFKHHQLRAMKTYFALNHNPDAKDLKQLAAKTNLTKRVLQVWFQNARAKYRREL 351          

HSP 2 Score: 86.2705 bits (212), Expect = 1.151e-17
Identity = 42/135 (31.11%), Postives = 74/135 (54.81%), Query Frame = 2
Query:  260 IQQSKQPEMESAV---CNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQFK--CQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCS-NSQLFCKNDF 646
            ++Q + P++E A+   C  C+  I+DK    VDG  +H++CLRC  C +       C+ ++  F CR D+ ++++  C+KC  PL   D++M++    + +H  CF C +C + L  GD+Y  S    L+C   +
Sbjct:   94 LRQIQIPKIEPALLNQCCLCTFAIVDKEISVVDGKYYHNNCLRCQMCDIPFEYSDKCYVRDGVFLCRADHAKRYQKCCRKCEIPLNREDMVMKAKE--MIFHHACFVCFICGIKLNPGDYYTMSPQGHLYCHAHY 226          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Celegans
Match: lim-4 (LIM domain family [Source:UniProtKB/TrEMBL;Acc:A0A1X7RC92])

HSP 1 Score: 88.5817 bits (218), Expect = 9.946e-19
Identity = 44/127 (34.65%), Postives = 67/127 (52.76%), Query Frame = 2
Query:  275 QPEMESAVCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQF--KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDFL 649
            +P+    +C  C   I DKF+  +DG  +H +CL+C+ C+  LSN   CF K+K F+C+  Y R+   KC  C   ++++D + R  +    YH+ CF C+ C   L  G+ Y      L CK  FL
Sbjct:   90 KPDAVIVICTQCQHQIQDKFFLSIDGRNYHENCLQCSTCENPLSN--KCFYKDKTFYCKGCYFRELGPKCASCDRTIQATDWVRR--ARNYVYHLACFSCNQCKRQLSTGEEYALQEGNLLCKQHFL 212          

HSP 2 Score: 74.3294 bits (181), Expect = 4.819e-14
Identity = 33/70 (47.14%), Postives = 47/70 (67.14%), Query Frame = 2
Query: 1280 QGISKKGSNSLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRR 1489
            +G S   S   + KRVRT+F   QL  ++ YF+ + NPD  DL +++  TGLSKRV QVWFQN+RA+ ++
Sbjct:  216 EGDSGVSSQKAKTKRVRTTFAEDQLSVLQTYFNRDSNPDGADLEKIASMTGLSKRVTQVWFQNSRARQKK 285          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Celegans
Match: lim-7 (CeLIM-7; LIM domain family [Source:UniProtKB/TrEMBL;Acc:G5EC36])

HSP 1 Score: 87.4261 bits (215), Expect = 6.694e-18
Identity = 45/130 (34.62%), Postives = 71/130 (54.62%), Query Frame = 2
Query:  263 QQSKQPEMESAVCNFCSQIILDKFYFEVD-GLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQF--KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKND 643
            Q+  QP M  AVC  C   I D+++  V+  L +H+ CL+C  C   L   ++ F KN + +CR DY R F  +C +C      +DL+MR+G   + +H+ CF C  C   L  G+ +   N+ L+C++D
Sbjct:   46 QRQHQPPM--AVCAGCRLEISDRYFLRVNPNLEFHAQCLKCVQCSRPLDENQTAFVKNGQTYCRDDYRRLFTTRCSRCHGDFDKTDLVMRAGPQNV-FHLNCFACVACEKRLQTGEEFQIKNNSLYCRSD 172          

HSP 2 Score: 53.5286 bits (127), Expect = 3.444e-7
Identity = 24/53 (45.28%), Postives = 34/53 (64.15%), Query Frame = 2
Query: 1322 RVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAK 1480
            RVRT     QL+ ++  +S+N  PD+    +L + TGLS RV++VWFQN R K
Sbjct:  267 RVRTVLNENQLKILRDCYSINSRPDATLKERLVEMTGLSARVIRVWFQNKRCK 319          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Celegans
Match: lin-11 (pep chromosome:WBcel235:I:10248256:10255327:1 gene:WBGene00003000.1 transcript:ZC247.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-11)

HSP 1 Score: 86.6557 bits (213), Expect = 7.021e-18
Identity = 43/125 (34.40%), Postives = 69/125 (55.20%), Query Frame = 2
Query:  281 EMESAVCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQF--KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGD-FYGCSNSQLFCKNDF 646
            E+    C  C+Q ILD++ F V G  WH SCLRC  C+  +S   +CF+++    C+ D+ R++  +C  C   L+  DL+ R+      +H+ CF+C +C  LL  GD  Y    ++  C++DF
Sbjct:   62 EISGNECAACAQPILDRYVFTVLGKCWHQSCLRCCDCRAPMS--MTCFSRDGLILCKTDFSRRYSQRCAGCDGKLEKEDLVRRARDKV--FHIRCFQCSVCQRLLDTGDQLYIMEGNRFVCQSDF 182          

HSP 2 Score: 60.4622 bits (145), Expect = 2.080e-9
Identity = 29/63 (46.03%), Postives = 41/63 (65.08%), Query Frame = 2
Query: 1301 SNSLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRR 1489
            SNS +++  RT+ K +QL T+K  F+    P      QL+ +TGL+ RV+QVWFQN R+K RR
Sbjct:  236 SNSAKRRGPRTTIKAKQLETLKNAFAATPKPTRHIREQLAAETGLNMRVIQVWFQNRRSKERR 298          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Fly
Match: ap (gene:FBgn0267978 transcript:FBtr0086059)

HSP 1 Score: 119.013 bits (297), Expect = 8.739e-30
Identity = 53/70 (75.71%), Postives = 63/70 (90.00%), Query Frame = 2
Query: 1301 SNSLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSLCRQTG 1510
            S+S R KR+RTSFKH QLRTMK+YF++NHNPD+KDL+QLSQKTGL KRVLQVWFQNARAK+RR + +Q G
Sbjct:  139 SSSSRTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLSQKTGLPKRVLQVWFQNARAKWRRMMMKQDG 208          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Fly
Match: ap (gene:FBgn0267978 transcript:FBtr0335274)

HSP 1 Score: 119.013 bits (297), Expect = 8.739e-30
Identity = 53/70 (75.71%), Postives = 63/70 (90.00%), Query Frame = 2
Query: 1301 SNSLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSLCRQTG 1510
            S+S R KR+RTSFKH QLRTMK+YF++NHNPD+KDL+QLSQKTGL KRVLQVWFQNARAK+RR + +Q G
Sbjct:  139 SSSSRTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLSQKTGLPKRVLQVWFQNARAKWRRMMMKQDG 208          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Fly
Match: ap (gene:FBgn0267978 transcript:FBtr0300504)

HSP 1 Score: 117.472 bits (293), Expect = 1.269e-27
Identity = 53/70 (75.71%), Postives = 63/70 (90.00%), Query Frame = 2
Query: 1301 SNSLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSLCRQTG 1510
            S+S R KR+RTSFKH QLRTMK+YF++NHNPD+KDL+QLSQKTGL KRVLQVWFQNARAK+RR + +Q G
Sbjct:  361 SSSSRTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLSQKTGLPKRVLQVWFQNARAKWRRMMMKQDG 430          

HSP 2 Score: 93.2041 bits (230), Expect = 1.058e-19
Identity = 45/144 (31.25%), Postives = 79/144 (54.86%), Query Frame = 2
Query:  299 CNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQF---KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDFLVTQRD---VNNRSENWRYSTETGS 712
            C+ C + I D+FY       WH+SCL+C AC+  L    SC++++   +C+ DY   F   +C +C   + S++L+MR  +  L +HV CF C +C+  L  GD YG  ++ ++C+  + + +      ++ S  + YS + GS
Sbjct:  147 CSGCGRQIQDRFYLSAVEKRWHASCLQCYACRQPLERESSCYSRDGNIYCKNDYYSFFGTRRCSRCLASISSNELVMR--ARNLVFHVNCFCCTVCHTPLTKGDQYGIIDALIYCRTHYSIAREGDTASSSMSATYPYSAQFGS 288          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Fly
Match: ap (gene:FBgn0267978 transcript:FBtr0086058)

HSP 1 Score: 117.472 bits (293), Expect = 1.294e-27
Identity = 53/70 (75.71%), Postives = 63/70 (90.00%), Query Frame = 2
Query: 1301 SNSLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSLCRQTG 1510
            S+S R KR+RTSFKH QLRTMK+YF++NHNPD+KDL+QLSQKTGL KRVLQVWFQNARAK+RR + +Q G
Sbjct:  362 SSSSRTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLSQKTGLPKRVLQVWFQNARAKWRRMMMKQDG 431          

HSP 2 Score: 93.2041 bits (230), Expect = 1.084e-19
Identity = 45/144 (31.25%), Postives = 79/144 (54.86%), Query Frame = 2
Query:  299 CNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQF---KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDFLVTQRD---VNNRSENWRYSTETGS 712
            C+ C + I D+FY       WH+SCL+C AC+  L    SC++++   +C+ DY   F   +C +C   + S++L+MR  +  L +HV CF C +C+  L  GD YG  ++ ++C+  + + +      ++ S  + YS + GS
Sbjct:  148 CSGCGRQIQDRFYLSAVEKRWHASCLQCYACRQPLERESSCYSRDGNIYCKNDYYSFFGTRRCSRCLASISSNELVMR--ARNLVFHVNCFCCTVCHTPLTKGDQYGIIDALIYCRTHYSIAREGDTASSSMSATYPYSAQFGS 289          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Fly
Match: Awh (gene:FBgn0013751 transcript:FBtr0073155)

HSP 1 Score: 98.2117 bits (243), Expect = 5.790e-23
Identity = 44/121 (36.36%), Postives = 67/121 (55.37%), Query Frame = 2
Query:  299 CNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQF--KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDFLVT 655
            C  C + I D+F+ EV G  WH+ CLRC  C   L   +SCF + ++ +C+ DY + F  KC KCC  + +SD + R+    L +H+ CF CD C   L  G+ +   + ++ CK  +L T
Sbjct:    8 CAACGEPISDRFFLEVGGCSWHAHCLRCCMCMCPLDRQQSCFIRERQVYCKADYSKNFGAKCSKCCRGISASDWVRRARE--LVFHLACFACDQCGRQLSTGEQFALMDDRVLCKAHYLET 126          

HSP 2 Score: 74.3294 bits (181), Expect = 9.365e-15
Identity = 33/75 (44.00%), Postives = 53/75 (70.67%), Query Frame = 2
Query: 1271 STKQGISKKGSNSLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSL 1495
            S+ +G    G +  + KRVRT+F  +QL+ ++A F ++ NPD +DL +++  TGLSKRV QVWFQN+RA+ ++ +
Sbjct:  133 SSDEGCDGDGYHKSKTKRVRTTFTEEQLQVLQANFQIDSNPDGQDLERIASVTGLSKRVTQVWFQNSRARQKKHI 207          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Zebrafish
Match: lhx2b (LIM homeobox 2b [Source:ZFIN;Acc:ZDB-GENE-051220-1])

HSP 1 Score: 122.865 bits (307), Expect = 1.645e-29
Identity = 65/119 (54.62%), Postives = 85/119 (71.43%), Query Frame = 2
Query: 1301 SNSLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSLCRQ--TGVMCGPSANQIQMPNVFDDTSLISIDKNGNYSTKTTMTTFSDISSSIL 1651
            S+S + KR+RTSFKH QLRTMK+YF++NHNPD+KDL+QL+QKTGL+KRVLQVWFQNARAKFRR+L RQ  TGV      + +         S IS   N + S  +T TT +D+++  +
Sbjct:  281 SSSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQENTGVDKASDGSNLAGGTPSGPASEIS---NASMSPSSTPTTLTDLTNPTM 396          

HSP 2 Score: 95.5153 bits (236), Expect = 2.094e-20
Identity = 41/121 (33.88%), Postives = 71/121 (58.68%), Query Frame = 2
Query:  293 AVCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQF---KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDF 646
            A+C  C   I D++Y       WH  CL+C  C+++L +  +CF+K+   +C++DY R+F   +C +C   + +S+++MR  +  L YH+ CF C  CN +L  GD +G  +S ++C+  F
Sbjct:   82 ALCAGCGGKISDRYYLLAVDKQWHMRCLKCCECKLNLESELTCFSKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMR--ARDLVYHLNCFTCTTCNKMLTTGDHFGMKDSLVYCRLHF 200          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Zebrafish
Match: lhx9 (LIM homeobox 9 [Source:NCBI gene;Acc:550405])

HSP 1 Score: 118.627 bits (296), Expect = 2.472e-28
Identity = 62/117 (52.99%), Postives = 84/117 (71.79%), Query Frame = 2
Query: 1307 SLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSLCRQ--TGVMCGPSANQIQMPNVFDDTSLISIDKNGNYSTKTTMTTFSDISSSIL 1651
            S + KR+RTSFKH QLRTMK+YF++NHNPD+KDL+QL+QKTGL+KRVLQVWFQNARAKFRR++ RQ   GV     A+   +P    D+  ++       ST TT+T  ++ S +++
Sbjct:  264 SQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNVLRQENGGV---DKADGTSLPPPSSDSGALTPP-----STATTLTDLTNPSITVV 372          

HSP 2 Score: 96.6709 bits (239), Expect = 6.537e-21
Identity = 52/195 (26.67%), Postives = 97/195 (49.74%), Query Frame = 2
Query:  212 KQFESNSFNKKKLINEIQ----QSKQPEM---ESAVCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQF---KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDF-LVTQRDVNNRSENWRYSTETGSLNTTDVNGNSSTVTDNP 763
            ++ E  S ++ +L   +Q    ++  P M   + A+C  C   I D++Y       WH  CL+C  C+++L +  +CF K+   +C++DY R+F   +C +C   + +S+++MR+  S   YH+ CF C  CN  L  GD +G  ++ ++C+  F  + Q + + +      + + G L     NG  +     P
Sbjct:   35 EEMERRSKSESRLAKTVQMNGRETTMPSMSPEKPALCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDS--VYHLSCFTCTTCNKTLTTGDHFGMKDNLVYCRVHFETLIQGEYHPQLNYAELAAKGGGLALPYFNGTGTVQKGRP 227          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Zebrafish
Match: lhx2a (LIM homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-091118-109])

HSP 1 Score: 107.071 bits (266), Expect = 6.916e-25
Identity = 51/89 (57.30%), Postives = 68/89 (76.40%), Query Frame = 2
Query: 1313 RQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSLCRQTGVMCGPSANQIQMPNVFDDTSLIS 1579
            + KR+RTSFKH QLR+M+++F+ NHNPD+KDL++L+QKTGL+KRVLQVWFQNARAKFRR+   Q           I + NV D+++L S
Sbjct:  199 KSKRMRTSFKHHQLRSMQSFFTHNHNPDAKDLKELAQKTGLTKRVLQVWFQNARAKFRRNCLYQ---------ESIGVDNVSDNSTLTS 278          

HSP 2 Score: 97.4413 bits (241), Expect = 1.195e-21
Identity = 42/121 (34.71%), Postives = 72/121 (59.50%), Query Frame = 2
Query:  287 ESAVCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQD-YDRQF---KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCK 637
            ++ VC  C  +I D+FY       WH  CL+C+ACQ  L +  +CF+K+   +C++D Y R+F   +C +C   + +++++MR  +  L YH+ CF C  C+ +LL GD YG   + ++C+
Sbjct:    9 DAPVCAGCGALISDRFYLLAAERRWHERCLKCSACQTDLESELTCFSKHGDIYCKEDYYSRRFSSQRCARCHLGISATEIVMR--ARDLVYHLSCFSCATCHKVLLTGDHYGMKETSVYCR 127          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Zebrafish
Match: lhx2a (LIM homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-091118-109])

HSP 1 Score: 107.071 bits (266), Expect = 8.361e-25
Identity = 51/89 (57.30%), Postives = 68/89 (76.40%), Query Frame = 2
Query: 1313 RQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSLCRQTGVMCGPSANQIQMPNVFDDTSLIS 1579
            + KR+RTSFKH QLR+M+++F+ NHNPD+KDL++L+QKTGL+KRVLQVWFQNARAKFRR+   Q           I + NV D+++L S
Sbjct:  198 KSKRMRTSFKHHQLRSMQSFFTHNHNPDAKDLKELAQKTGLTKRVLQVWFQNARAKFRRNCLYQ---------ESIGVDNVSDNSTLTS 277          

HSP 2 Score: 101.293 bits (251), Expect = 6.714e-23
Identity = 42/120 (35.00%), Postives = 72/120 (60.00%), Query Frame = 2
Query:  287 ESAVCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQF---KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCK 637
            ++ VC  C  +I D+FY       WH  CL+C+ACQ  L +  +CF+K+   +C++DY R+F   +C +C   + +++++MR  +  L YH+ CF C  C+ +LL GD YG   + ++C+
Sbjct:    9 DAPVCAGCGALISDRFYLLAAERRWHERCLKCSACQTDLESELTCFSKHGDIYCKEDYYRRFSSQRCARCHLGISATEIVMR--ARDLVYHLSCFSCATCHKVLLTGDHYGMKETSVYCR 126          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Zebrafish
Match: si:ch211-236k19.2 (si:ch211-236k19.2 [Source:ZFIN;Acc:ZDB-GENE-060531-41])

HSP 1 Score: 104.375 bits (259), Expect = 1.387e-24
Identity = 65/212 (30.66%), Postives = 107/212 (50.47%), Query Frame = 2
Query:  296 VCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQF--KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDFLVTQRDVNNRSENWRYSTETGSLNTTDVNGNSSTVTDNPLSALCQLNVDEYLRNKTSTSVVVP-LIDKINLSSKLI---LQSTDER-KNIPYN 910
            +C  CS  I D++  +V+GL WH  CL+C+ C VSL +  SCF +NK+ +CR DY+  F  KC +C   + ++D I R+G+    YH+ CF C  C   L  G+ +G   +Q+ C+  + +T  ++   S+N       G+L    +   S     +  S   Q+    ++R+K   +  +  L D   LS ++I    Q+   R K IP +
Sbjct:    1 ICTGCSTEIFDRYVLKVNGLTWHLRCLQCSVCAVSLGHQNSCFIRNKEIFCRTDYNSTFGIKCARCGHQVSANDWIRRAGND--IYHLACFACFFCKRQLSTGEEFGLMENQVLCRVHYDITLLNLQQLSDNGNLIHLDGALPIQYLPKASKRPRTSFTSEQIQIMQTHFIRDKNPDAATLQRLADTTGLSRRVIQVWFQNCRARQKRIPLH 210          

HSP 2 Score: 67.3958 bits (163), Expect = 5.768e-12
Identity = 29/57 (50.88%), Postives = 43/57 (75.44%), Query Frame = 2
Query: 1319 KRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRR 1489
            KR RTSF  +Q++ M+ +F  + NPD+  L++L+  TGLS+RV+QVWFQN RA+ +R
Sbjct:  150 KRPRTSFTSEQIQIMQTHFIRDKNPDAATLQRLADTTGLSRRVIQVWFQNCRARQKR 206          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Xenopus
Match: zfp36l2 (ZFP36 ring finger protein-like 2 [Source:Xenbase;Acc:XB-GENE-971012])

HSP 1 Score: 117.857 bits (294), Expect = 7.065e-28
Identity = 52/66 (78.79%), Postives = 62/66 (93.94%), Query Frame = 2
Query: 1307 SLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSLCRQ 1504
            S + KR+RTSFKH QLRTMK+YF++NHNPD+KDL+QL+QKTGL+KRVLQVWFQNARAKFRR+L RQ
Sbjct:  254 SQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQ 319          

HSP 2 Score: 95.9005 bits (237), Expect = 1.573e-20
Identity = 51/168 (30.36%), Postives = 86/168 (51.19%), Query Frame = 2
Query:  278 PEMESAVCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQF---KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDF-LVTQRDVNNRSENWRYSTETGSLNTTDV--NGNSSTVTDNP 763
            PE + A+C  C   I D++Y       WH  CL+C  C+++L +  +CF K+   +C++DY R+F   +C +C   + +S+++MR+  S   YH+ CF C  CN  L  GD +G   + ++C+  F L+ Q D + +      S + G + T     NG  +     P
Sbjct:   55 PE-KPALCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARES--VYHLSCFTCTTCNKTLSTGDHFGMKENLVYCRIHFELLVQGDFHQQLNYTELSAKGGGIATLPYFSNGTGTVQKGRP 219          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Xenopus
Match: LHX2 (LIM homeobox 2 [Source:NCBI gene;Acc:100486746])

HSP 1 Score: 117.857 bits (294), Expect = 7.486e-28
Identity = 51/64 (79.69%), Postives = 61/64 (95.31%), Query Frame = 2
Query: 1313 RQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSLCRQ 1504
            + KR+RTSFKH QLRTMK+YF++NHNPD+KDL+QL+QKTGL+KRVLQVWFQNARAKFRR+L RQ
Sbjct:  257 KTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQ 320          

HSP 2 Score: 95.5153 bits (236), Expect = 2.046e-20
Identity = 40/123 (32.52%), Postives = 73/123 (59.35%), Query Frame = 2
Query:  287 ESAVCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQF---KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDF 646
             +A+C  C   I D++Y       WH  CL+C  C+++L +  +CF+K+   +C++DY R+F   +C +C   + +S+++MR  +  L YH+ CF C+ CN +L  GD +G  ++ ++C+  F
Sbjct:   49 RAALCAGCGGKISDRYYLLAVDKQWHMRCLKCCECKLNLESELTCFSKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMR--ARDLVYHLNCFTCNTCNKMLTTGDHFGMKDNLVYCRLHF 169          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Xenopus
Match: zfp36l2 (ZFP36 ring finger protein-like 2 [Source:Xenbase;Acc:XB-GENE-971012])

HSP 1 Score: 117.472 bits (293), Expect = 8.832e-28
Identity = 52/66 (78.79%), Postives = 62/66 (93.94%), Query Frame = 2
Query: 1307 SLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSLCRQ 1504
            S + KR+RTSFKH QLRTMK+YF++NHNPD+KDL+QL+QKTGL+KRVLQVWFQNARAKFRR+L RQ
Sbjct:  265 SQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQ 330          

HSP 2 Score: 95.5153 bits (236), Expect = 2.210e-20
Identity = 50/176 (28.41%), Postives = 90/176 (51.14%), Query Frame = 2
Query:  263 QQSKQPEM---ESAVCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQF---KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDF-LVTQRDVNNRSENWRYSTETGSLNTTDV--NGNSSTVTDNP 763
            ++++ P +   + A+C  C   I D++Y       WH  CL+C  C+++L +  +CF K+   +C++DY R+F   +C +C   + +S+++MR+  S   YH+ CF C  CN  L  GD +G   + ++C+  F L+ Q D + +      S + G + T     NG  +     P
Sbjct:   57 RETRMPSLSPEKPALCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARES--VYHLSCFTCTTCNKTLSTGDHFGMKENLVYCRIHFELLVQGDFHQQLNYTELSAKGGGIATLPYFSNGTGTVQKGRP 230          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Xenopus
Match: LHX2 (LIM homeobox 2 [Source:NCBI gene;Acc:100486746])

HSP 1 Score: 117.857 bits (294), Expect = 8.923e-28
Identity = 64/115 (55.65%), Postives = 83/115 (72.17%), Query Frame = 2
Query: 1313 RQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSLCRQ--TGVMCGPSANQIQMPNVFDDTSLISIDKNGNYSTKTTMTTFSDISSSIL 1651
            + KR+RTSFKH QLRTMK+YF++NHNPD+KDL+QL+QKTGL+KRVLQVWFQNARAKFRR+L RQ   GV    S + +Q        S IS   N + S  +T TT +D+++  +
Sbjct:  278 KTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQENNGVD-KTSDSTLQAGTPSGPASEIS---NASMSPSSTPTTLTDLTNPTM 388          

HSP 2 Score: 95.5153 bits (236), Expect = 2.312e-20
Identity = 40/123 (32.52%), Postives = 73/123 (59.35%), Query Frame = 2
Query:  287 ESAVCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQF---KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDF 646
             +A+C  C   I D++Y       WH  CL+C  C+++L +  +CF+K+   +C++DY R+F   +C +C   + +S+++MR  +  L YH+ CF C+ CN +L  GD +G  ++ ++C+  F
Sbjct:   70 RAALCAGCGGKISDRYYLLAVDKQWHMRCLKCCECKLNLESELTCFSKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMR--ARDLVYHLNCFTCNTCNKMLTTGDHFGMKDNLVYCRLHF 190          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Xenopus
Match: zfp36l2 (ZFP36 ring finger protein-like 2 [Source:Xenbase;Acc:XB-GENE-971012])

HSP 1 Score: 94.7449 bits (234), Expect = 1.552e-20
Identity = 51/168 (30.36%), Postives = 86/168 (51.19%), Query Frame = 2
Query:  278 PEMESAVCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQF---KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDF-LVTQRDVNNRSENWRYSTETGSLNTTDV--NGNSSTVTDNP 763
            PE + A+C  C   I D++Y       WH  CL+C  C+++L +  +CF K+   +C++DY R+F   +C +C   + +S+++MR+  S   YH+ CF C  CN  L  GD +G   + ++C+  F L+ Q D + +      S + G + T     NG  +     P
Sbjct:   66 PE-KPALCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARES--VYHLSCFTCTTCNKTLSTGDHFGMKENLVYCRIHFELLVQGDFHQQLNYTELSAKGGGIATLPYFSNGTGTVQKGRP 230          

HSP 2 Score: 84.3445 bits (207), Expect = 5.097e-17
Identity = 37/49 (75.51%), Postives = 46/49 (93.88%), Query Frame = 2
Query: 1307 SLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQ 1453
            S + KR+RTSFKH QLRTMK+YF++NHNPD+KDL+QL+QKTGL+KRVLQ
Sbjct:  265 SQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQ 313          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Mouse
Match: Lhx2 (LIM homeobox protein 2 [Source:MGI Symbol;Acc:MGI:96785])

HSP 1 Score: 121.324 bits (303), Expect = 1.951e-29
Identity = 67/118 (56.78%), Postives = 85/118 (72.03%), Query Frame = 2
Query: 1304 NSLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSLCRQ--TGVMCGPSANQIQMPNVFDDTSLISIDKNGNYSTKTTMTTFSDISSSIL 1651
            +S + KR+RTSFKH QLRTMK+YF++NHNPD+KDL+QL+QKTGL+KRVLQVWFQNARAKFRR+L RQ  TGV     A  +Q        S +S   N + S  +T TT +D++S  L
Sbjct:  221 SSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQENTGVDKTSDAT-LQTGTPSGPASELS---NASLSPSSTPTTLTDLTSPTL 334          

HSP 2 Score: 95.5153 bits (236), Expect = 9.591e-21
Identity = 41/123 (33.33%), Postives = 72/123 (58.54%), Query Frame = 2
Query:  287 ESAVCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQF---KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDF 646
             +A+C  C   I D++Y       WH  CL+C  C+++L +  +CF+K+   +C++DY R+F   +C +C   + +S+++MR  +  L YH+ CF C  CN +L  GD +G  +S ++C+  F
Sbjct:    8 RAALCAGCGGKISDRYYLLAVDKQWHMRCLKCCECKLNLESELTCFSKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMR--ARDLVYHLNCFTCTTCNKMLTTGDHFGMKDSLVYCRLHF 128          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Mouse
Match: Lhx2 (LIM homeobox protein 2 [Source:MGI Symbol;Acc:MGI:96785])

HSP 1 Score: 122.094 bits (305), Expect = 2.290e-29
Identity = 67/118 (56.78%), Postives = 85/118 (72.03%), Query Frame = 2
Query: 1304 NSLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSLCRQ--TGVMCGPSANQIQMPNVFDDTSLISIDKNGNYSTKTTMTTFSDISSSIL 1651
            +S + KR+RTSFKH QLRTMK+YF++NHNPD+KDL+QL+QKTGL+KRVLQVWFQNARAKFRR+L RQ  TGV     A  +Q        S +S   N + S  +T TT +D++S  L
Sbjct:  262 SSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQENTGVDKTSDAT-LQTGTPSGPASELS---NASLSPSSTPTTLTDLTSPTL 375          

HSP 2 Score: 96.6709 bits (239), Expect = 7.562e-21
Identity = 41/123 (33.33%), Postives = 72/123 (58.54%), Query Frame = 2
Query:  287 ESAVCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQF---KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDF 646
             +A+C  C   I D++Y       WH  CL+C  C+++L +  +CF+K+   +C++DY R+F   +C +C   + +S+++MR  +  L YH+ CF C  CN +L  GD +G  +S ++C+  F
Sbjct:   49 RAALCAGCGGKISDRYYLLAVDKQWHMRCLKCCECKLNLESELTCFSKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMR--ARDLVYHLNCFTCTTCNKMLTTGDHFGMKDSLVYCRLHF 169          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Mouse
Match: Lhx9 (LIM homeobox protein 9 [Source:MGI Symbol;Acc:MGI:1316721])

HSP 1 Score: 117.857 bits (294), Expect = 4.634e-28
Identity = 52/66 (78.79%), Postives = 62/66 (93.94%), Query Frame = 2
Query: 1307 SLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSLCRQ 1504
            S + KR+RTSFKH QLRTMK+YF++NHNPD+KDL+QL+QKTGL+KRVLQVWFQNARAKFRR+L RQ
Sbjct:  255 SQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQ 320          

HSP 2 Score: 96.6709 bits (239), Expect = 6.633e-21
Identity = 49/166 (29.52%), Postives = 85/166 (51.20%), Query Frame = 2
Query:  278 PEMESAVCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQF---KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDF-LVTQRDVNNRSENWRYSTETGSLNTTDVNGNSSTVTDNP 763
            PE + A+C  C   I D++Y       WH  CL+C  C+++L +  +CF K+   +C++DY R+F   +C +C   + +S+++MR+  S   YH+ CF C  CN  L  GD +G  +S ++C+  F  + Q +   +      + ++G L     NG  +     P
Sbjct:   56 PE-KPALCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDS--VYHLSCFTCSTCNKTLTTGDHFGMKDSLVYCRAHFETLLQGEYPPQLSYTELAAKSGGLALPYFNGTGTVQKGRP 218          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Mouse
Match: Lhx9 (LIM homeobox protein 9 [Source:MGI Symbol;Acc:MGI:1316721])

HSP 1 Score: 117.472 bits (293), Expect = 7.036e-28
Identity = 63/115 (54.78%), Postives = 80/115 (69.57%), Query Frame = 2
Query: 1307 SLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSLCRQ--TGVMCGPSANQIQMPNVFDDTSLISIDK--NGNYSTKTTMTTFSDIS 1639
            S + KR+RTSFKH QLRTMK+YF++NHNPD+KDL+QL+QKTGL+KRVLQVWFQNARAKFRR+L RQ   GV            +  D TSL +     +G  +   T TT +D++
Sbjct:  264 SQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQENGGV------------DKADGTSLPAPPSADSGALTPPGTATTLTDLT 366          

HSP 2 Score: 95.9005 bits (237), Expect = 1.191e-20
Identity = 49/166 (29.52%), Postives = 85/166 (51.20%), Query Frame = 2
Query:  278 PEMESAVCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQF---KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDF-LVTQRDVNNRSENWRYSTETGSLNTTDVNGNSSTVTDNP 763
            PE + A+C  C   I D++Y       WH  CL+C  C+++L +  +CF K+   +C++DY R+F   +C +C   + +S+++MR+  S   YH+ CF C  CN  L  GD +G  +S ++C+  F  + Q +   +      + ++G L     NG  +     P
Sbjct:   65 PE-KPALCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDS--VYHLSCFTCSTCNKTLTTGDHFGMKDSLVYCRAHFETLLQGEYPPQLSYTELAAKSGGLALPYFNGTGTVQKGRP 227          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Mouse
Match: Lhx9 (LIM homeobox protein 9 [Source:MGI Symbol;Acc:MGI:1316721])

HSP 1 Score: 96.2857 bits (238), Expect = 3.356e-21
Identity = 49/166 (29.52%), Postives = 85/166 (51.20%), Query Frame = 2
Query:  278 PEMESAVCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQF---KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDF-LVTQRDVNNRSENWRYSTETGSLNTTDVNGNSSTVTDNP 763
            PE + A+C  C   I D++Y       WH  CL+C  C+++L +  +CF K+   +C++DY R+F   +C +C   + +S+++MR+  S   YH+ CF C  CN  L  GD +G  +S ++C+  F  + Q +   +      + ++G L     NG  +     P
Sbjct:   56 PE-KPALCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDS--VYHLSCFTCSTCNKTLTTGDHFGMKDSLVYCRAHFETLLQGEYPPQLSYTELAAKSGGLALPYFNGTGTVQKGRP 218          

HSP 2 Score: 84.3445 bits (207), Expect = 3.528e-17
Identity = 37/49 (75.51%), Postives = 46/49 (93.88%), Query Frame = 2
Query: 1307 SLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQ 1453
            S + KR+RTSFKH QLRTMK+YF++NHNPD+KDL+QL+QKTGL+KRVLQ
Sbjct:  255 SQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQ 303          
BLAST of LIM/homeobox protein Lhx2 vs. UniProt/SwissProt
Match: sp|Q9Z0S2|LHX2_MOUSE (LIM/homeobox protein Lhx2 OS=Mus musculus OX=10090 GN=Lhx2 PE=1 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 1.602e-28
Identity = 67/118 (56.78%), Postives = 85/118 (72.03%), Query Frame = 2
Query: 1304 NSLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSLCRQ--TGVMCGPSANQIQMPNVFDDTSLISIDKNGNYSTKTTMTTFSDISSSIL 1651
            +S + KR+RTSFKH QLRTMK+YF++NHNPD+KDL+QL+QKTGL+KRVLQVWFQNARAKFRR+L RQ  TGV     A  +Q        S +S   N + S  +T TT +D++S  L
Sbjct:  262 SSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQENTGVDKTSDAT-LQTGTPSGPASELS---NASLSPSSTPTTLTDLTSPTL 375          

HSP 2 Score: 96.6709 bits (239), Expect = 5.290e-20
Identity = 41/123 (33.33%), Postives = 72/123 (58.54%), Query Frame = 2
Query:  287 ESAVCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQF---KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDF 646
             +A+C  C   I D++Y       WH  CL+C  C+++L +  +CF+K+   +C++DY R+F   +C +C   + +S+++MR  +  L YH+ CF C  CN +L  GD +G  +S ++C+  F
Sbjct:   49 RAALCAGCGGKISDRYYLLAVDKQWHMRCLKCCECKLNLESELTCFSKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMR--ARDLVYHLNCFTCTTCNKMLTTGDHFGMKDSLVYCRLHF 169          
BLAST of LIM/homeobox protein Lhx2 vs. UniProt/SwissProt
Match: sp|P50458|LHX2_HUMAN (LIM/homeobox protein Lhx2 OS=Homo sapiens OX=9606 GN=LHX2 PE=1 SV=2)

HSP 1 Score: 122.094 bits (305), Expect = 1.617e-28
Identity = 67/118 (56.78%), Postives = 85/118 (72.03%), Query Frame = 2
Query: 1304 NSLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSLCRQ--TGVMCGPSANQIQMPNVFDDTSLISIDKNGNYSTKTTMTTFSDISSSIL 1651
            +S + KR+RTSFKH QLRTMK+YF++NHNPD+KDL+QL+QKTGL+KRVLQVWFQNARAKFRR+L RQ  TGV     A  +Q        S +S   N + S  +T TT +D++S  L
Sbjct:  262 SSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQENTGVDKSTDA-ALQTGTPSGPASELS---NASLSPSSTPTTLTDLTSPTL 375          

HSP 2 Score: 96.2857 bits (238), Expect = 5.903e-20
Identity = 41/123 (33.33%), Postives = 72/123 (58.54%), Query Frame = 2
Query:  287 ESAVCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQF---KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDF 646
             +A+C  C   I D++Y       WH  CL+C  C+++L +  +CF+K+   +C++DY R+F   +C +C   + +S+++MR  +  L YH+ CF C  CN +L  GD +G  +S ++C+  F
Sbjct:   49 RAALCAGCGGKISDRYYLLAVDKQWHMRCLKCCECKLNLESELTCFSKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMR--ARDLVYHLNCFTCTTCNKMLTTGDHFGMKDSLVYCRLHF 169          
BLAST of LIM/homeobox protein Lhx2 vs. UniProt/SwissProt
Match: sp|P36198|LHX2_RAT (LIM/homeobox protein Lhx2 OS=Rattus norvegicus OX=10116 GN=Lhx2 PE=2 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 4.613e-28
Identity = 67/118 (56.78%), Postives = 85/118 (72.03%), Query Frame = 2
Query: 1304 NSLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSLCRQ--TGVMCGPSANQIQMPNVFDDTSLISIDKNGNYSTKTTMTTFSDISSSIL 1651
            +S + KR+RTSFKH QLRTMK+YF++NHNPD+KDL+QL+QKTGL+KRVLQVWFQNARAKFRR+L RQ  TGV     A  +Q        S +S   N + S  +T TT +D++S  L
Sbjct:  260 SSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQENTGVDKTSDAT-LQTGTPSGPASELS---NASLSPSSTPTTLTDLTSPTL 373          

HSP 2 Score: 95.1301 bits (235), Expect = 1.700e-19
Identity = 41/123 (33.33%), Postives = 71/123 (57.72%), Query Frame = 2
Query:  287 ESAVCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQF---KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDF 646
             +A+C  C   I D++Y       WH  CL+C  C+++L +  +CF+K+   +C++DY R+F   +C +C   +  S+++MR  +  L YH+ CF C  CN +L  GD +G  +S ++C+  F
Sbjct:   48 RAALCAGCGGKISDRYYLLAVDKQWHMRCLKCCECKLNLESELTCFSKDGSIYCKEDYYRRFSVQRCARCHLGISESEMVMR--ARDLVYHLNCFTCTTCNKMLTTGDHFGMKDSLVYCRLHF 168          
BLAST of LIM/homeobox protein Lhx2 vs. UniProt/SwissProt
Match: sp|Q9NQ69|LHX9_HUMAN (LIM/homeobox protein Lhx9 OS=Homo sapiens OX=9606 GN=LHX9 PE=1 SV=3)

HSP 1 Score: 119.013 bits (297), Expect = 1.444e-27
Identity = 63/127 (49.61%), Postives = 85/127 (66.93%), Query Frame = 2
Query: 1307 SLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSLCRQ----------TGVMCGPSANQIQMPNVFDDTSLISIDKNGNYSTKTTMTTFSDISSSILNH 1657
            S + KR+RTSFKH QLRTMK+YF++NHNPD+KDL+QL+QKTGL+KRVLQVWFQNARAKFRR+L RQ          T +   PSA+   +      T+L  +       T  T+T  + ++S++ +H
Sbjct:  264 SQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQENGGVDKADGTSLPAPPSADSGALTPPGTATTLTDL-------TNPTITVVTSVTSNMDSH 383          

HSP 2 Score: 95.9005 bits (237), Expect = 7.196e-20
Identity = 49/166 (29.52%), Postives = 85/166 (51.20%), Query Frame = 2
Query:  278 PEMESAVCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQF---KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDF-LVTQRDVNNRSENWRYSTETGSLNTTDVNGNSSTVTDNP 763
            PE + A+C  C   I D++Y       WH  CL+C  C+++L +  +CF K+   +C++DY R+F   +C +C   + +S+++MR+  S   YH+ CF C  CN  L  GD +G  +S ++C+  F  + Q +   +      + ++G L     NG  +     P
Sbjct:   65 PE-KPALCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDS--VYHLSCFTCSTCNKTLTTGDHFGMKDSLVYCRAHFETLLQGEYPPQLSYTELAAKSGGLALPYFNGTGTVQKGRP 227          
BLAST of LIM/homeobox protein Lhx2 vs. UniProt/SwissProt
Match: sp|A0JNI8|LHX9_BOVIN (LIM/homeobox protein Lhx9 OS=Bos taurus OX=9913 GN=LHX9 PE=2 SV=2)

HSP 1 Score: 119.013 bits (297), Expect = 1.774e-27
Identity = 64/115 (55.65%), Postives = 80/115 (69.57%), Query Frame = 2
Query: 1307 SLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSLCRQ--TGVMCGPSANQIQMPNVFDDTSLISIDK--NGNYSTKTTMTTFSDIS 1639
            S + KR+RTSFKH QLRTMK+YF++NHNPD+KDL+QL+QKTGL+KRVLQVWFQNARAKFRR+L RQ   GV            +  D TSL +     +G  S   T TT +D++
Sbjct:  264 SQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQENGGV------------DKADGTSLPAPPSADSGALSPPGTATTLTDLT 366          

HSP 2 Score: 97.0561 bits (240), Expect = 3.426e-20
Identity = 49/166 (29.52%), Postives = 85/166 (51.20%), Query Frame = 2
Query:  278 PEMESAVCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQF---KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDF-LVTQRDVNNRSENWRYSTETGSLNTTDVNGNSSTVTDNP 763
            PE + A+C  C   I D++Y       WH  CL+C  C+++L +  +CF K+   +C++DY R+F   +C +C   + +S+++MR+  S   YH+ CF C  CN  L  GD +G  +S ++C+  F  + Q +   +      + ++G L     NG  +     P
Sbjct:   65 PE-KPALCAGCGGKIADRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDS--VYHLSCFTCSTCNKTLTTGDHFGMKDSLVYCRAHFETLLQGEYPPQLSYTELAAKSGGLALPYFNGTGTVQKGRP 227          
BLAST of LIM/homeobox protein Lhx2 vs. TrEMBL
Match: A0A5J4NSB0 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0010391 PE=4 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 1.637e-41
Identity = 135/480 (28.12%), Postives = 215/480 (44.79%), Query Frame = 2
Query:  227 NSFNKKKLINEIQQSKQPEMESAVCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQFKCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDFLVTQRDVNN-----RSENWRYSTETGSLNTTDVNGNSSTVTDNPLSALCQLNVDEY-LRNKTSTSVVVPLIDKINLSSKLILQSTDERKNIPYNSLLETESPNTKEYTSLTSC-----KIIPEPNLN----------YDDQEFSEESLPDKTHGVNQIKLENT--------SSP---NSNYE---PDEKNIDETVESNEMSSETDMG-------KELIDHSSMH---------EASTLGTEDDDGSGGSCCESEDKIVISTKQGISKKG------SNSLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSL 1495
            N  +K           +P + S  C  C + I ++ Y  V G  WH +CL CN C  +L   R+C+    K +CR+ Y+R   C++C +     D++ R     + YH  C  CD+C+ +L+ GD Y   N  ++C     V   D N      R+  WR  T++  L +      ++T TD         NV+   +     TSV+  + + +      +  ST +    PYN++ +T  P  +   S++        I  EP L+          +   + S    PD+     +I   N+         SP   N N++   P    ++  V  N +    DM        + +++   ++         E + L ++++        +  D+ +      I++         +S + KR+RTSF HQQL  MKAYF ++ NPDSKDL+QLSQ TGLSKRVLQVWFQNARAK+RRS+
Sbjct:  194 NYLSKSTWFAPGDSQAEPHITSTTCEGCHEWITERSYLSVGGRPWHLACLHCNVCGRNLQWDRTCYIHAGKIFCRKHYERMLHCRRCGDKFHELDIVYRLDLH-MAYHRTCLTCDVCSRVLIHGDAYVMHNGAIYC-----VAYTDTNGTKSLKRAFCWRQVTDSCPLTS------TTTATD--------FNVETIDMGGLQRTSVMNEVSESVGTCISPLRVSTPDIS--PYNAV-DTVHPELQGRVSISVADHPLDAIFIEPKLSPSFPMPVGCEFQPSDRSPLQPPDRQTPEIRITTSNSFANCDTSGVSPKVTNHNFQANVPQGGMLETLVNENSVHGAVDMADSYMFPSQPMLESVGVYDQQYAQNHRETTELFSDENSERAFKMGQPGDRKLDGPPPAIARPANKGKKSKDSGKSKRIRTSFSHQQLNVMKAYFGVSQNPDSKDLKQLSQATGLSKRVLQVWFQNARAKYRRSI 650          
BLAST of LIM/homeobox protein Lhx2 vs. TrEMBL
Match: A0A4E0RRD9 (LIM/homeobox protein Lhx2 OS=Fasciola hepatica OX=6192 GN=D915_005766 PE=4 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 2.865e-36
Identity = 134/420 (31.90%), Postives = 193/420 (45.95%), Query Frame = 2
Query:  296 VCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQFKCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDFLVTQRDVN-------NRSE-NWRYSTETG---SLNTTDVNGNSSTVTDNPLSALCQLNVDEYLRNKTSTSVVVPLIDKINLSSKLILQSTDERKNIPYNSLLETESPNTKEYTSLTSCKIIPEPNLNYDDQEFSEESLPDKTHGVNQIKLENTSSPNSNYEPDEKNIDETVESNEMSSETDMGKELIDHS-SMHEASTLGTEDDDGSGGSCCESEDKIVISTKQGISKKGSNSL---------RQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRS 1492
            VC+ C + I D+ Y  V    WH +CL+C+ C  +L   R+CF ++   +CR  Y+R   C  C E L+ +D I +   +   YH  C +C  C+ LL +GD +    +  +C      T    N        RSE N  Y  E G   + N+  V  N S    NP+       V+  +R  +S  ++         ++ +  +  + R + P   L ++   N    TS+ S        L++       + +P       Q  + +  SP S    D      +VE N +   T     L+  S S  +     T  D+   G   E  D    ST  G  K+ SNS          + KR+RTSFKHQQL+ MKA+F +  NPDSKDL+QLS KTGLSKRVLQVWFQNARAK+RR+
Sbjct:  220 VCDGCKRPIHDQVYLCVGTKPWHMTCLQCHVCGKNLQWERTCFLRSGSVFCRAHYERMLYCLYCDERLQENDSIHKI-DAFFAYHRDCLQCAHCSRLLQSGDAFILDGAAAYCVTKRTQTGHSRNASCWLQITRSESNLVYLAERGQTCAPNSDAVGENLSKQILNPIPD----PVERRIRTDSSGVMLRGSRASEQCTNAVEREIQELRISHPPTDLTDS---NDCSNTSIASSTCEYSCPLDFLKSCVDSDLMPTSDTAGFQPAVRHLLSP-SGAIADSMLFSSSVEENHIDQLTPKQSGLLQESESPVDNPDFSTTTDNDFAGQHHEPCDGCASST--GSVKRVSNSCGREKLTRDSKGKRIRTSFKHQQLQMMKAFFEITRNPDSKDLKQLSNKTGLSKRVLQVWFQNARAKYRRT 628          
BLAST of LIM/homeobox protein Lhx2 vs. TrEMBL
Match: A0A504YGM1 (LIM/homeobox protein Lhx2 (Fragment) OS=Fasciola gigantica OX=46835 GN=FGIG_07274 PE=4 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 1.166e-35
Identity = 130/423 (30.73%), Postives = 191/423 (45.15%), Query Frame = 2
Query:  296 VCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQFKCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDFLVTQRDVNNRSEN---WRYSTETGSLNTTDVNGNSSTVTDNPLSALCQLNVDEYLRNKTSTSVVVPLIDKINLSSKLILQSTDERKNIPYNSL------LETESPNTK-------EYTSLTSCKIIPEPNLNYDDQEFSEESLPDKTHGVNQIKLENTSSPNSNYEPDEKNIDETVESNEMSSETDMGKELI--DHSSMHEASTLGTEDDDGSGG--SCCESEDKIVISTKQGISKKGSNSL----RQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRS 1492
            VC+ C + I D+ Y  V    WH +CL+C+ C  +L   R+CF ++   +CR  Y+R   C  C E L+ +D I +   +   YH  C +C  C+ LL +GD +    +  +C     VT+R     S N   W   T + S N   +     T   N  +      VDE L  +    +  P+  +I   S  ++           N++      L    P+T          TS+ S        L++       +  P       Q  + +  SP S    D      +V+ N++   T    +L+    SS+       T D+D +      C+  D    S K+  +  G   L    + KR+RTSFKHQQL+ MKA+F +  NPDSKDL+QLS KTGLSKRVLQVWFQNARAK+RR+
Sbjct:  107 VCDGCKRPIHDQVYLCVGTKPWHMTCLQCHVCGKNLQWERTCFLRSGSVFCRAHYERMLYCLYCDERLQENDSIHKI-DAFFAYHRDCLQCAHCSRLLQSGDAFILDGAAAYC-----VTKRTQTGHSRNASCWLQITRSES-NLVHLAECGQTCAPNSDA------VDESLSKQILNPIPDPVQRRIRTDSSGVMLRGSSASEQCTNAVEREIQELRISHPSTDLTDGKDCSSTSIASSTCEYSCPLDFLKSCIDSDLTPASDTVGFQPAVRHLLSP-SGAPADSMLFSSSVKENQIDQLTPKQSDLLHESESSVDNPDFSTTTDNDFAAPHHEPCDGCDSSTGSVKRVSNSCGREKLTRDSKGKRIRTSFKHQQLQMMKAFFEITRNPDSKDLKQLSNKTGLSKRVLQVWFQNARAKYRRT 515          
BLAST of LIM/homeobox protein Lhx2 vs. TrEMBL
Match: G9K868 (LIM homeobox 2 (Fragment) OS=Mustela putorius furo OX=9669 PE=2 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 7.719e-30
Identity = 67/121 (55.37%), Postives = 85/121 (70.25%), Query Frame = 2
Query: 1307 SLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSLCRQ--TGV----MCGPSANQIQMPNVFDDTSLISIDKNGNYSTKTTMTTFSDISSSIL 1651
            S + KR+RTSFKH QLRTMK+YF++NHNPD+KDL+QL+QKTGL+KRVLQVWFQNARAKFRR+L RQ  TGV      G +   +Q        S +S   N + S  +T TT +D++S  L
Sbjct:   56 SQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQGNTGVDKSTEAGVATGXLQTGTPSGPASELS---NASLSPSSTPTTLTDLTSPAL 173          
BLAST of LIM/homeobox protein Lhx2 vs. TrEMBL
Match: A6MKB4 (LIM homeobox protein Lhx2-like protein (Fragment) OS=Callithrix jacchus OX=9483 PE=2 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 2.943e-29
Identity = 65/116 (56.03%), Postives = 83/116 (71.55%), Query Frame = 2
Query: 1307 SLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSLCRQTGVMCGPSAN-QIQMPNVFDDTSLISIDKNGNYSTKTTMTTFSDISSSIL 1651
            S + KR+RTSFKH QLRTMK+YF++NHNPD+KDL+QL+QKTGL+KRVLQVWFQNARAKFRR+L RQ       SA+  +Q        S +S   N + S  +T TT +D++S  L
Sbjct:   54 SQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQENTGVDKSADAALQTGTPSGPASELS---NASLSPSSTPTTLTDLTSPTL 166          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Cavefish
Match: lhx2b (LIM homeobox 2b [Source:ZFIN;Acc:ZDB-GENE-051220-1])

HSP 1 Score: 121.709 bits (304), Expect = 2.141e-29
Identity = 60/117 (51.28%), Postives = 82/117 (70.09%), Query Frame = 2
Query: 1301 SNSLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSLCRQTGVMCGPSANQIQMPNVFDDTSLISIDKNGNYSTKTTMTTFSDISSSIL 1651
            S+  + KR+RTSFKH QLRTMK+YF++NHNPD+KDL+QL+QKTGL+KRVLQVWFQNARAKFRR+L RQ       +++   +P          I  N + S  +T TT +D+++  +
Sbjct:  250 SSGQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQENTGVDKASDGSNLPGGTPSGPASEIS-NASMSPSSTPTTLTDLTNPTM 365          

HSP 2 Score: 93.5893 bits (231), Expect = 5.458e-20
Identity = 42/133 (31.58%), Postives = 75/133 (56.39%), Query Frame = 2
Query:  266 QSKQPEMES---AVCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQF---KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDF 646
            ++  P M     A+C  C   I D++Y       WH  CL+C  C+++L +  +CF+K+   +C++DY R+F   +C +C   + +S+++MR  +  L YH+ CF C  C+ +L  GD +G  +S ++C+  F
Sbjct:   39 ETSAPSMSGERVALCAGCGGRISDRYYLLAVDKQWHMRCLKCCECKLNLESELTCFSKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMR--ARDLVYHLNCFTCTTCSKMLTTGDHFGMKDSLVYCRLHF 169          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Cavefish
Match: lhx9 (LIM homeobox 9 [Source:NCBI gene;Acc:103038813])

HSP 1 Score: 118.242 bits (295), Expect = 1.546e-28
Identity = 62/117 (52.99%), Postives = 84/117 (71.79%), Query Frame = 2
Query: 1307 SLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSLCRQ--TGVMCGPSANQIQMPNVFDDTSLISIDKNGNYSTKTTMTTFSDISSSIL 1651
            S + KR+RTSFKH QLRTMK+YF++NHNPD+KDL+QL+QKTGL+KRVLQVWFQNARAKFRR++ RQ   GV     A+   +P    D+  ++       ST TT+T  ++ S +++
Sbjct:  223 SQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNVLRQENGGV---DKADGTSLPPPSSDSGALTPP-----STATTLTDLTNPSITVV 331          

HSP 2 Score: 91.6633 bits (226), Expect = 1.360e-19
Identity = 49/169 (28.99%), Postives = 84/169 (49.70%), Query Frame = 2
Query:  269 SKQPEMESAVCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQF---KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDF-LVTQRDVNNRSENWRYSTETGSLNTTDVNGNSSTVTDNP 763
            S  PE + A+C  C   I D++Y       WH  CL+C  C+++L +  +CF K+   +C++DY R+F   +C +C   + +S+++MR+  S   YH+ CF C  CN  L  GD +G   + ++C+  F  + Q + +        + + G L     NG  +     P
Sbjct:   21 SVSPE-KPALCAGCGSKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDS--VYHLSCFTCTSCNKTLTTGDHFGMRENLVYCRAHFESLVQGEYHAPLNYAELAAKGGGLALPYFNGAGAVQKGRP 186          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Cavefish
Match: ENSAMXT00000051669.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002054.1:401899:417880:1 gene:ENSAMXG00000041554.1 transcript:ENSAMXT00000051669.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.7525 bits (247), Expect = 3.066e-22
Identity = 61/163 (37.42%), Postives = 86/163 (52.76%), Query Frame = 2
Query: 1289 SKKGSNSLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSLCRQTGVMC------------------GP-----SANQIQMPNVFDDTSLISIDKNGNYSTKTTMTTFSDISSSILNHSVQNNHLLCSMNDINYQ 1708
            ++ G    R KR+RT F+ +QLR ++AYFS  HNPD KD   LS  TGL KRVLQVWFQNARAK RRSL   T V                     P     + +Q+++  +    S  S     N S+ T    + D+  + L+++ QN+HLL ++ DI+ +
Sbjct:  201 ARGGGACRRVKRMRTCFRREQLRALEAYFSQKHNPDGKDWVNLSNHTGLPKRVLQVWFQNARAKLRRSLSSDTAVSTFFSGDETMATVSMASSQDAPPHQTSTIDQLELSLLTAPISEASPHHAVNLSSPT--EPYKDL--AFLDYTTQNSHLLSALGDIDLE 359          

HSP 2 Score: 98.5969 bits (244), Expect = 7.462e-22
Identity = 44/128 (34.38%), Postives = 72/128 (56.25%), Query Frame = 2
Query:  278 PEMESA--VCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQF---KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDF 646
            P + +A  VC  C + + D+F     G  WH +CLRC++C   L +  S + ++   +C+QDY   F   +C +C +P+ SS L+MRSG   + +H+ CF C  C+V LL G+ Y      L+C++ +
Sbjct:   44 PSVAAAPPVCGGCGERVSDRFVLLAAGQAWHGACLRCSSCHCELQSHSSLYCRDGNIYCQQDYCSLFGVGRCARCSQPIPSSALVMRSGD--MTFHLHCFSCQECDVTLLPGNLYCVEGRSLYCQSHY 169          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Cavefish
Match: lmx1ba (LIM homeobox transcription factor 1, beta a [Source:NCBI gene;Acc:554361])

HSP 1 Score: 93.2041 bits (230), Expect = 2.793e-20
Identity = 46/119 (38.66%), Postives = 67/119 (56.30%), Query Frame = 2
Query:  296 VCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQF--KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDF 646
            VC  C + I D+F   V+   WH  CL+C  CQ  L+   SC+ +++K +C+ DY R F  KC  C E +  ++ +MR+  S   YH+GCF C +C   L  GD +   +SQL CK D+
Sbjct:   30 VCAGCQRPIADRFLLRVNESSWHEECLQCAVCQQPLTM--SCYCRDRKVYCKHDYQRLFATKCSGCLEKIAPTEFVMRALKS--VYHLGCFCCCVCERQLCKGDEFVLKDSQLLCKKDY 144          

HSP 2 Score: 59.6918 bits (143), Expect = 3.489e-9
Identity = 39/86 (45.35%), Postives = 47/86 (54.65%), Query Frame = 2
Query: 1247 ESEDKIVISTK-QGISKKGSN----SLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRR 1489
            E ED  V   K  G   KGS+    S R KR RT    QQ R  KA F ++  P  K    L+ +TGLS RV+QVWFQN RAK ++
Sbjct:  164 EDEDVDVKPEKGSGGQNKGSDDSKDSRRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKK 249          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Cavefish
Match: lhx6 (LIM homeobox 6 [Source:NCBI gene;Acc:103041775])

HSP 1 Score: 94.3597 bits (233), Expect = 3.162e-20
Identity = 47/141 (33.33%), Postives = 75/141 (53.19%), Query Frame = 2
Query:  296 VCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQF--KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDFLVTQRDVNNRSENWRYSTETGS 712
            VC  C   ILD++  +V+ L+WH  CL C+ C+ SL    SC+ KNK+ +C+ DY  +F  KC +C   + +SD + R  + G  YH+ CF C  C   L  G+ +G    ++ C+  +       +   EN + + E+GS
Sbjct:  109 VCASCGLEILDRYLLKVNNLIWHVRCLECSVCRTSLRQHSSCYIKNKEIFCKMDYFSRFGTKCARCGRQIYASDWVRR--ARGNAYHLACFACFSCKRQLSTGEEFGLVEEKVLCRIHY-------DTMVENLKRAAESGS 240          

HSP 2 Score: 77.0258 bits (188), Expect = 1.397e-14
Identity = 46/131 (35.11%), Postives = 70/131 (53.44%), Query Frame = 2
Query: 1319 KRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSLCRQTGVMCGPSANQIQMPNVFDDTSLIS----------------IDKNGNYSTKTTMTTFSDISSSILNHSV 1663
            KR RTSF  +QL+ M+A F+ ++NPD++ L++L+  TGLS+RV+QVWFQN RA+ ++   + +G   G    Q +MP    D    S                ID   N+S+  T   FS +++  L H  
Sbjct:  260 KRARTSFTAEQLQVMQAQFAQDNNPDAQTLQKLADMTGLSRRVIQVWFQNCRARHKKHTPQHSGPPQG--HPQARMPPSLPDELHYSPFGSPERARMVALHGYIDSEWNFSSTRTCHPFSVLTTQSLPHQA 388          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Sea Lamprey
Match: lmo4b (LIM domain only 4b [Source:ZFIN;Acc:ZDB-GENE-030131-3570])

HSP 1 Score: 80.8777 bits (198), Expect = 4.639e-18
Identity = 45/137 (32.85%), Postives = 66/137 (48.18%), Query Frame = 2
Query:  248 LINEIQQSKQPEMESAVCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMR-SCFTKNKKFWCRQDYDRQF----KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKND 643
            ++N      Q       C  C   I D+F        WHS CL+C+ CQ  L ++  SC+T+     CR DY R F     C  C + + +S+L+M++   G  YH+ CF C  C   L+ GD +   N  LFC++D
Sbjct:    1 MVNSQCPEPQATGPPKRCAGCGGKIADRFLLYSMDCYWHSRCLKCSCCQAQLGDLGTSCYTRQGMILCRDDYIRMFGSSGACNACGQSIPASELVMKT--QGNVYHLKCFACATCRTRLVPGDRFHYVNGSLFCEHD 135          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Sea Lamprey
Match: lmo2 (LIM domain only 2 (rhombotin-like 1) [Source:NCBI gene;Acc:30332])

HSP 1 Score: 63.1586 bits (152), Expect = 5.887e-12
Identity = 39/130 (30.00%), Postives = 59/130 (45.38%), Query Frame = 2
Query:  272 KQPEMESAVCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNM-RSCFTKNKKFWCRQDYDRQF----KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDF 646
            + P M   +C  C Q I D++  +     WH  CL C+ C   L  + R  + K  +  CR+DY R F     C  C + +++ ++ MR       YH+ CF+C  C      GD Y   NS + C+ D 
Sbjct:   22 RMPPM-MLMCGGCRQPISDRYLLKAIEQFWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGHCASCGKRIRAFEMTMRVRDK--VYHLECFKCAACQKHFCVGDRYLLVNSDIICEQDI 148          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Sea Lamprey
Match: lmo2 (LIM domain only 2 (rhombotin-like 1) [Source:NCBI gene;Acc:30332])

HSP 1 Score: 60.8474 bits (146), Expect = 3.448e-11
Identity = 39/130 (30.00%), Postives = 59/130 (45.38%), Query Frame = 2
Query:  272 KQPEMESAVCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNM-RSCFTKNKKFWCRQDYDRQF----KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDF 646
            + P M   +C  C Q I D++  +     WH  CL C+ C   L  + R  + K  +  CR+DY R F     C  C + +++ ++ MR       YH+ CF+C  C      GD Y   NS + C+ D 
Sbjct:   21 RMPPM-MLMCGGCRQPISDRYLLKAIEQFWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGHCASCGKRIRAFEMTMRVRDK--VYHLECFKCAACQKHFCVGDRYLLVNSDIICEQDI 147          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009434.1 (pep scaffold:Pmarinus_7.0:GL476605:204971:209125:-1 gene:ENSPMAG00000008536.1 transcript:ENSPMAT00000009434.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.6178 bits (148), Expect = 4.993e-10
Identity = 33/82 (40.24%), Postives = 45/82 (54.88%), Query Frame = 2
Query: 1277 KQGISKK----GSNSLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSLCRQTG 1510
            K G SK     G    R KR+RT+   +QL  +   + ++ NP  K L  +S + GL KRV+QVWFQN RA+ R+   R  G
Sbjct: 1125 KAGASKSDTDGGEEPHRDKRLRTTITPEQLEILYRKYMLDSNPTRKMLDHISNEVGLKKRVVQVWFQNTRARERKGQFRSLG 1206          

HSP 2 Score: 53.9138 bits (128), Expect = 1.084e-7
Identity = 38/118 (32.20%), Postives = 54/118 (45.76%), Query Frame = 2
Query: 1304 NSLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSLCRQTGVMCGPSANQIQMPNVFDDTSLISIDKNGNYSTKTTMTTFSDISSSILNH 1657
            +S+ ++  RT F   QL+ ++ +F  N  P   +L QLS    L  RV+ VWFQNAR K R+S   Q     G    ++     +  TS      N NY  K     F  I   ++NH
Sbjct:  787 SSMSKRSSRTRFTDYQLKVLQDFFDTNAYPKDDELEQLSNLLNLPTRVIVVWFQNARQKARKSYESQVEGKEGGEKRELPTNERYIRTS------NLNYQCKKCSVVFQRI-FDLINH 897          

HSP 3 Score: 50.8322 bits (120), Expect = 1.167e-6
Identity = 20/57 (35.09%), Postives = 39/57 (68.42%), Query Frame = 2
Query: 1319 KRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRR 1489
            KR RT    +QL  ++AYF +N++P  + +++++ K+GL ++V++ WF+N   K R+
Sbjct:  694 KRPRTRITEEQLNILRAYFDINNSPGDEQIQEMADKSGLPQKVIKHWFRNTLFKERQ 750          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000489.1 (pep scaffold:Pmarinus_7.0:GL476379:43572:49059:-1 gene:ENSPMAG00000000440.1 transcript:ENSPMAT00000000489.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.8474 bits (146), Expect = 8.167e-10
Identity = 27/66 (40.91%), Postives = 40/66 (60.61%), Query Frame = 2
Query: 1313 RQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSLCRQTG 1510
            R KR+RT+   +QL  +   + ++ NP  K L  ++ + GL KRV+QVWFQN RA+ R+   R  G
Sbjct:  593 RDKRLRTTITPEQLEILYQKYLLDSNPTRKMLDHIAHEVGLKKRVVQVWFQNTRARERKGHFRAVG 658          

HSP 2 Score: 56.6102 bits (135), Expect = 1.925e-8
Identity = 29/68 (42.65%), Postives = 41/68 (60.29%), Query Frame = 2
Query: 1319 KRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRR---SLCRQTGV 1513
            KR RT   + QL+ +K  F+    P  ++   L  + GL KRV+QVWFQNARAK ++   SL +Q G+
Sbjct:  914 KRFRTQMSNLQLKVLKVCFNDYRTPTMQECEILGNEIGLPKRVVQVWFQNARAKEKKSKLSLAKQYGI 981          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Nematostella
Match: EDO43354 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYP5])

HSP 1 Score: 118.627 bits (296), Expect = 4.913e-30
Identity = 57/89 (64.04%), Postives = 69/89 (77.53%), Query Frame = 2
Query: 1268 ISTKQGISKKGSNSLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSLCRQTGVMCGPSAN 1534
            +S + G    G++  R KRVRTSFKH QLR MK YF+MNHNPD+KDL+QLSQKTGL+KRVLQVWFQNARAKFRR++C  +     PS +
Sbjct:  166 LSDRPGELTTGADG-RPKRVRTSFKHHQLRAMKTYFAMNHNPDAKDLKQLSQKTGLTKRVLQVWFQNARAKFRRTVCNTSQTPMSPSCD 253          

HSP 2 Score: 104.375 bits (259), Expect = 4.351e-25
Identity = 46/123 (37.40%), Postives = 72/123 (58.54%), Query Frame = 2
Query:  287 ESAVCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQF---KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDF 646
            + AVC  C   IL++FY       WH+ CL+C+ C++ L N  +CF+K+    CR+DY R+F   KC  C + + S +L+MR+      YHV CF CD C  +L  G+++G    +++CK D+
Sbjct:    5 QQAVCAGCGSRILERFYLMAVDQEWHADCLKCSDCELRLDNELTCFSKDGVILCREDYYRRFSVKKCSSCSQAISSKELVMRARDQ--VYHVNCFACDRCKRMLATGEYFGMRGIRIYCKEDY 125          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Nematostella
Match: EDO34370 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPK5])

HSP 1 Score: 89.3521 bits (220), Expect = 1.323e-19
Identity = 40/119 (33.61%), Postives = 63/119 (52.94%), Query Frame = 2
Query:  299 CNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQF--KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDFL 649
            C  C   I+D++  +V G  WH+ CL+C  C   L    +C+TK+ K +C+ DY RQF  KC +C   + ++D + R  +    YH+ CF CD C   L  G+ +   +  + CK  +L
Sbjct:   28 CVGCEAKIVDRYLVKVSGRAWHTKCLKCCLCSDELGREATCYTKDGKIYCKADYARQFGTKCARCGRSIHANDWVRR--AKNCVYHLACFACDNCKRQLSTGEEFALKDGHVLCKLHYL 144          

HSP 2 Score: 72.7886 bits (177), Expect = 6.086e-14
Identity = 32/63 (50.79%), Postives = 48/63 (76.19%), Query Frame = 2
Query: 1301 SNSLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRR 1489
            S   + KRVRT+F   QL+ ++A F+++ NPD +DL +++Q TGLSKRV QVWFQN+RA+ ++
Sbjct:  175 SGRHKAKRVRTTFTEDQLQILQANFNIDSNPDGQDLERIAQLTGLSKRVTQVWFQNSRARQKK 237          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Nematostella
Match: EDO46073 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR95])

HSP 1 Score: 88.9669 bits (219), Expect = 2.840e-19
Identity = 72/239 (30.13%), Postives = 108/239 (45.19%), Query Frame = 2
Query:  293 AVCNFCSQIILDKFYFEV-DGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQF--KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDFLV------TQRDVNNRSENWRYSTETGSLN--TTDVNGNSSTVTDNPLSALCQLNVDEY--LRN------KTSTSVVVPLIDKINLSSKLIL------QSTDERKNIPYNSLLETESP 934
            ++C  C   I D++   V   L WH+SCL+C  C + L    +CF +  K +C++DY R F  KC KC      +D +MR+ +    YH+ CFRC  C+  L+ GD +      LFCK D  +      T +  + R+   R S   G  N  TT  +  S   TD P      LN  +   LR       +    +   L++   LS ++I       +  D++KN   NSL  T +P
Sbjct:   15 SMCVGCGSQIHDQYILRVAPDLEWHASCLKCADCHMYLDEKCTCFVREGKTYCKRDYVRLFGTKCAKCSLNFSKNDFVMRARNK--IYHIDCFRCVACSRQLVPGDEFALREDGLFCKADHEIVEKATATAQATHVRNNGQRSSQSGGQTNGQTTPDSTPSKRKTDRPTRVRTVLNEKQLHTLRTCYNANPRPDAMMKEQLVEMTGLSPRVIRVWFQNKRCKDKKKNP--NSLSPTGAP 249          

HSP 2 Score: 56.225 bits (134), Expect = 1.606e-8
Identity = 26/56 (46.43%), Postives = 35/56 (62.50%), Query Frame = 2
Query: 1313 RQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAK 1480
            R  RVRT    +QL T++  ++ N  PD+    QL + TGLS RV++VWFQN R K
Sbjct:  179 RPTRVRTVLNEKQLHTLRTCYNANPRPDAMMKEQLVEMTGLSPRVIRVWFQNKRCK 234          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Nematostella
Match: EDO37316 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG43])

HSP 1 Score: 77.7962 bits (190), Expect = 7.609e-17
Identity = 43/138 (31.16%), Postives = 74/138 (53.62%), Query Frame = 2
Query:  251 INEIQQSKQPEMESA--VCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNM-RSCFTKNKKFWCRQDYDRQF----KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKND 643
            + E Q + Q ++ ++  VC  C + I+D+F        WH +CL+C+ C+  L  +  SC++K     C+ DY R +     C  C + + +++L+M+    G  YH+ CF C  C+  L+ GD +   N +LFC+ND
Sbjct:    1 MEEQQLTSQSQVAASMRVCAGCGEKIIDRFLLLALDQYWHVNCLKCSCCEARLGEIGTSCYSKGGMILCKTDYVRLYGNSGACAVCAKLIPATELVMKV--LGKVYHLHCFTCTTCHNQLVPGDRFHVVNGRLFCEND 136          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Nematostella
Match: LHX1 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9E9])

HSP 1 Score: 73.9442 bits (180), Expect = 5.900e-15
Identity = 36/119 (30.25%), Postives = 63/119 (52.94%), Query Frame = 2
Query:  299 CNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQF--KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGD-FYGCSNSQLFCKNDF 646
            C  C   I DKF  +V   +WH+ C++C+ C+  L+    CF++  K +C+ D+ R++  KC  C + +  +D++ R  +  L +HV CF C  C   +  GD  Y   +    C++D+
Sbjct:    5 CAGCQLPIADKFLLKVLDGVWHAQCVQCSDCKCPLT--ERCFSREGKLFCKTDFYRRYGTKCSGCDQGISPNDMVRR--AKHLVFHVDCFVCSYCKRQITTGDELYYIGDGSFICRDDY 119          

HSP 2 Score: 54.6842 bits (130), Expect = 1.968e-8
Identity = 25/59 (42.37%), Postives = 39/59 (66.10%), Query Frame = 2
Query: 1313 RQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRR 1489
            +++  RT+ K +QL  +K+ F+    P      +L+Q+TGL+ RV+QVWFQN R+K RR
Sbjct:  152 KRRGPRTTIKAKQLEALKSTFAATPKPSRNIREKLAQETGLNMRVIQVWFQNRRSKERR 210          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Medaka
Match: lhx2b (LIM homeobox 2 [Source:NCBI gene;Acc:101154958])

HSP 1 Score: 124.02 bits (310), Expect = 4.698e-30
Identity = 66/119 (55.46%), Postives = 86/119 (72.27%), Query Frame = 2
Query: 1301 SNSLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSLCRQ--TGVMCGPSANQIQMPNVFDDTSLISIDKNGNYSTKTTMTTFSDISSSIL 1651
            S+S + KR+RTSFKH QLRTMK+YF++NHNPD+KDL+QL+QKTGL+KRVLQVWFQNARAKFRR+L RQ  TGV      + +Q        S IS   N + S  +T TT +D+++  +
Sbjct:  271 SSSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQETTGVDKTSEGSTLQGGTPSGPASEIS---NASMSPSSTPTTLTDLTNPTM 386          

HSP 2 Score: 95.5153 bits (236), Expect = 1.329e-20
Identity = 40/121 (33.06%), Postives = 71/121 (58.68%), Query Frame = 2
Query:  293 AVCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQF---KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDF 646
            A+C  C + I D++Y       WH  CL+C  C+++L +  +CF+K+   +C++DY R+F   +C +C   + +S+++MR  +  L YH+ CF C  C  +L  GD +G  +S ++C+  F
Sbjct:   72 ALCAGCGRKIADRYYLLAVDKQWHMRCLKCCECKLNLESELTCFSKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMR--ARDLVYHLNCFTCTTCGKMLTTGDHFGMKDSLVYCRLHF 190          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Medaka
Match: lhx9 (LIM homeobox 9 [Source:NCBI gene;Acc:100049461])

HSP 1 Score: 117.472 bits (293), Expect = 5.500e-28
Identity = 61/120 (50.83%), Postives = 84/120 (70.00%), Query Frame = 2
Query: 1313 RQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSLCRQ--TGVMCGPSANQIQMPNVFDDTSLISIDKNGNYSTKTT---MTTFSDISSSILNH 1657
            + KR+RTSFKH QLRTMK+YF++NHNPD+KDL+QL+QKTGL+KRVLQVWFQNARAKFRR++ RQ   GV     A+   +P    D+  ++   +    T  T   +T  + ++SS+ +H
Sbjct:  269 KTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNVLRQENGGV---DKADGTSLPPPSSDSGALTPPSSAATLTDLTNPSITVVTSVTSSLDSH 385          

HSP 2 Score: 99.3673 bits (246), Expect = 6.240e-22
Identity = 57/196 (29.08%), Postives = 97/196 (49.49%), Query Frame = 2
Query:  212 KQFESNSFNKKKLINEIQ----QSKQPEM---ESAVCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQF---KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDF--LVTQRDVNNRSENWRYSTETGSLNTTDVNGNSSTVTDNP 763
            ++ E  S ++ +L   +Q     S  P M   + A+C  C   I D++Y       WH  CL+C  C+++L +  +CF K+   +C++DY R+F   +C +C   + +S+++MR+  S   YH+ CF C  CN  L  GD +G  +S ++C+  F  LV   D + +      + + G L     NG  +T    P
Sbjct:   37 EEMERRSKSESRLAKGMQLNGRDSTLPSMSPEKPALCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDS--VYHLSCFTCTTCNKTLTTGDHFGMKDSLVYCRLHFETLVQGPDYHPQLNFAELAAKGGGLALPYFNGTGTTQKGRP 230          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Medaka
Match: ENSORLT00000039212.1 (LIM/homeobox protein Lhx2-like [Source:NCBI gene;Acc:101155206])

HSP 1 Score: 101.679 bits (252), Expect = 6.835e-23
Identity = 51/160 (31.87%), Postives = 82/160 (51.25%), Query Frame = 2
Query:  296 VCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQF---KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDFLVTQRDVNNRSENWRYS-TETGSLNTTDVNGNSSTVTDNP 763
            VC  C +++ D+F+    G +WH +CLRC+ C   L    S + ++   +C+QDY R F   +C +C +P+  S L+MRSG   L +H  CF C  C+V LL G+ Y    + L+C++ +      V++   + R S +E    N     G  S  +  P
Sbjct:    2 VCAGCGELVCDRFFLLAAGRVWHGACLRCSLCHCELQTHASLYWRDGNIYCQQDYCRIFGGGRCARCFQPIPPSALVMRSGD--LTFHPQCFSCQECDVKLLPGNLYCMQGANLYCESHYQEDGGSVSHHDPSMRLSLSEEPGQNHVSGEGEDSVSSPEP 159          

HSP 2 Score: 85.1149 bits (209), Expect = 1.979e-17
Identity = 68/206 (33.01%), Postives = 101/206 (49.03%), Query Frame = 2
Query: 1331 TSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSLCRQTGVMCGPSANQIQMPNVFDDTSLISIDKNGNYSTKTTMTTFSD----ISSSILNHSVQNNHLLCSMNDINYQNPANNGLLQQSTMSSLRDRYFPNGKQSFIPVTSYYSSTINPASQSSPSLFSMDVGNLAVNLGLAEFPRDTGDSFHL 1936
            T F+ +QLR +++YF+  HNPD KD   L+ KTGL KRVLQVWFQNARAK RRSL  +      P+A       VF   ++ +       S+  T    SD      +S ++H +Q + L   ++D + Q+PA N    QS    LR                  +  ++ +SQS+P   S+ +     N+GL     ++ D+F L
Sbjct:  179 TCFRREQLRALESYFAQKHNPDGKDWTCLAHKTGLPKRVLQVWFQNARAKLRRSLNSEYPQAQSPAA-------VFPSVAIAT-------SSSPTACAMSDQTQPFPASTIDH-LQLSLLTAPVSDRS-QSPAVN----QSAHQPLRS-----------------TDPLDYSSQSAPGCSSLSLQGNFENVGLEVDGGESSDAFRL 347          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Medaka
Match: lmx1ba (LIM/homeobox protein LMX-1.2-like [Source:NCBI gene;Acc:101158371])

HSP 1 Score: 100.138 bits (248), Expect = 1.591e-22
Identity = 48/120 (40.00%), Postives = 69/120 (57.50%), Query Frame = 2
Query:  293 AVCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQF--KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDF 646
            AVC  C ++I D+F   V+G  WH  CLRC AC+  L+   +C+  + K +CR+DY R F  KC  C E + ++DL++R+      YH+ CF C +C   L  GD +     QLFCK D+
Sbjct:   11 AVCQGCRRVICDRFLLWVNGACWHEECLRCAACRQPLAT--TCYVNDSKLYCRRDYRRLFSAKCSGCLERIAATDLVIRALER--VYHLSCFCCCICEHQLCKGDEFVLKEGQLFCKKDY 126          

HSP 2 Score: 61.2326 bits (147), Expect = 1.176e-9
Identity = 34/78 (43.59%), Postives = 45/78 (57.69%), Query Frame = 2
Query: 1247 ESEDKIVISTKQGISKKGSNSLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAK 1480
            E+E +  ++  +G S    +  R KR RT    QQ RT KA F ++  P  K    L+ +TGLS RV+QVWFQN RAK
Sbjct:  150 EAESEHFVTAVKG-SDDNKDPFRPKRPRTILTTQQRRTFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAK 226          
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Medaka
Match: lhx6 (LIM homeobox 6 [Source:NCBI gene;Acc:101170034])

HSP 1 Score: 94.3597 bits (233), Expect = 1.801e-20
Identity = 50/163 (30.67%), Postives = 81/163 (49.69%), Query Frame = 2
Query:  278 PEMESAVCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQF--KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDFLVTQRDVNNRSENWRYSTETGSLNTTDVNGNSSTVTDN 760
            P     +C  C   ILD++  +V+ L+WH  CL C+ C+ SL    SC+ KNK+ +C+ DY  +F  KC +C   + +SD + R  + G  YH+ CF C  C   L  G+ +G    ++ C+  +       +   EN + + E+G  N   + G   T  D+
Sbjct:   65 PSTGKNLCASCGLEILDRYLLKVNNLIWHVRCLECSVCRTSLRQHSSCYIKNKEIFCKMDYFSRFGTKCARCGRQIYASDWVRR--ARGNAYHLACFACYSCKRQLSTGEEFGLVEEKVLCRIHY-------DTMVENLKRAAESG--NGITLEGAVPTEQDS 216          

HSP 2 Score: 73.559 bits (179), Expect = 1.463e-13
Identity = 37/93 (39.78%), Postives = 60/93 (64.52%), Query Frame = 2
Query: 1283 GISKKGSNSLRQ-------KRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSLCRQTGVMCGPSANQI 1540
            GI+ +G+    Q       KR RTSF  +QL+ M+A F+ ++NPD++ L++L+  TGLS+RV+QVWFQN RA+ ++   + +G   G   ++I
Sbjct:  203 GITLEGAVPTEQDSQPKPAKRARTSFTAEQLQIMQAQFAQDNNPDAQTLQKLADMTGLSRRVIQVWFQNCRARHKKHTPQHSGAPQGHPQSRI 295          
BLAST of LIM/homeobox protein Lhx2 vs. Planmine SMEST
Match: SMESG000057112.1 (SMESG000057112.1)

HSP 1 Score: 1251.5 bits (3237), Expect = 0.000e+0
Identity = 604/604 (100.00%), Postives = 604/604 (100.00%), Query Frame = 2
Query:  161 MKTNHEIHKEMTIFYDQKQFESNSFNKKKLINEIQQSKQPEMESAVCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQFKCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDFLVTQRDVNNRSENWRYSTETGSLNTTDVNGNSSTVTDNPLSALCQLNVDEYLRNKTSTSVVVPLIDKINLSSKLILQSTDERKNIPYNSLLETESPNTKEYTSLTSCKIIPEPNLNYDDQEFSEESLPDKTHGVNQIKLENTSSPNSNYEPDEKNIDETVESNEMSSETDMGKELIDHSSMHEASTLGTEDDDGSGGSCCESEDKIVISTKQGISKKGSNSLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSLCRQTGVMCGPSANQIQMPNVFDDTSLISIDKNGNYSTKTTMTTFSDISSSILNHSVQNNHLLCSMNDINYQNPANNGLLQQSTMSSLRDRYFPNGKQSFIPVTSYYSSTINPASQSSPSLFSMDVGNLAVNLGLAEFPRDTGDSFHLTEIGMGQKISSI 1972
            MKTNHEIHKEMTIFYDQKQFESNSFNKKKLINEIQQSKQPEMESAVCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQFKCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDFLVTQRDVNNRSENWRYSTETGSLNTTDVNGNSSTVTDNPLSALCQLNVDEYLRNKTSTSVVVPLIDKINLSSKLILQSTDERKNIPYNSLLETESPNTKEYTSLTSCKIIPEPNLNYDDQEFSEESLPDKTHGVNQIKLENTSSPNSNYEPDEKNIDETVESNEMSSETDMGKELIDHSSMHEASTLGTEDDDGSGGSCCESEDKIVISTKQGISKKGSNSLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSLCRQTGVMCGPSANQIQMPNVFDDTSLISIDKNGNYSTKTTMTTFSDISSSILNHSVQNNHLLCSMNDINYQNPANNGLLQQSTMSSLRDRYFPNGKQSFIPVTSYYSSTINPASQSSPSLFSMDVGNLAVNLGLAEFPRDTGDSFHLTEIGMGQKISSI
Sbjct:    1 MKTNHEIHKEMTIFYDQKQFESNSFNKKKLINEIQQSKQPEMESAVCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQFKCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDFLVTQRDVNNRSENWRYSTETGSLNTTDVNGNSSTVTDNPLSALCQLNVDEYLRNKTSTSVVVPLIDKINLSSKLILQSTDERKNIPYNSLLETESPNTKEYTSLTSCKIIPEPNLNYDDQEFSEESLPDKTHGVNQIKLENTSSPNSNYEPDEKNIDETVESNEMSSETDMGKELIDHSSMHEASTLGTEDDDGSGGSCCESEDKIVISTKQGISKKGSNSLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSLCRQTGVMCGPSANQIQMPNVFDDTSLISIDKNGNYSTKTTMTTFSDISSSILNHSVQNNHLLCSMNDINYQNPANNGLLQQSTMSSLRDRYFPNGKQSFIPVTSYYSSTINPASQSSPSLFSMDVGNLAVNLGLAEFPRDTGDSFHLTEIGMGQKISSI 604          
BLAST of LIM/homeobox protein Lhx2 vs. Planmine SMEST
Match: SMESG000010916.1 (SMESG000010916.1)

HSP 1 Score: 118.242 bits (295), Expect = 3.218e-28
Identity = 57/99 (57.58%), Postives = 74/99 (74.75%), Query Frame = 2
Query: 1301 SNSLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSLCRQTGVMCGPSANQIQMPNVFDDTSLISIDKNGN 1597
             N+ RQKR+RTSFKH QLR MK+YF++NHNPD+KDL+ LS+KTGLSKRVLQVWFQNARAK+RR++ R      G   +     +V DD+ L +  K+G+
Sbjct:  230 GNASRQKRMRTSFKHHQLRAMKSYFALNHNPDAKDLKSLSEKTGLSKRVLQVWFQNARAKYRRNVSRNENTSQGSLKDA---KSVADDSELGTFSKDGD 325          

HSP 2 Score: 90.5077 bits (223), Expect = 5.136e-19
Identity = 53/173 (30.64%), Postives = 89/173 (51.45%), Query Frame = 2
Query:  224 SNSFNKKKLINE-IQQSKQPEM---ESAVCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQFK---CQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDFLVTQRDVNNRSENWRYSTETGSLNT 721
            S   ++  +I E I QS   ++    S  C  C   I D+F+ +    +WH +CLRC  C V L +  SCFT++   +C++DY R F    C +C   +   +L+MR     L +HV CF C  C  +L  G+++G      FC++D +   ++  N SE++ ++ + G  N+
Sbjct:    2 STEIDRHLIIGESINQSNSTDIYNQNSMNCAGCKSKITDRFFLKAADKMWHVNCLRCWICHVELHSEMSCFTRDGVVYCKEDYSRLFGRKCCIRCGVKITYDELVMR--VKNLVFHVTCFCCVQCGRMLNPGEYFGLKGLLPFCQDDLI---KNPINMSEDFIHNLQNGLTNS 169          
BLAST of LIM/homeobox protein Lhx2 vs. Planmine SMEST
Match: SMESG000001774.1 (SMESG000001774.1)

HSP 1 Score: 110.153 bits (274), Expect = 2.158e-26
Identity = 52/70 (74.29%), Postives = 59/70 (84.29%), Query Frame = 2
Query: 1283 GISKKGSNSLRQKRVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRS 1492
            GISK       QKR+RTSFKH Q+R M+ YFS+NHNPD+KDL+ LS+KTGLSKRVLQVWFQNARAKFRRS
Sbjct:  190 GISK-------QKRLRTSFKHHQVRVMRTYFSLNHNPDTKDLKTLSEKTGLSKRVLQVWFQNARAKFRRS 252          

HSP 2 Score: 94.7449 bits (234), Expect = 4.322e-21
Identity = 42/123 (34.15%), Postives = 74/123 (60.16%), Query Frame = 2
Query:  287 ESAVCNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDR---QFKCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDF 646
            +  +C+ C  +I DK+Y   D  +WH SCL+C+ C+ SL    SC+ +N  F+C+ DY R   Q KC KC E ++  +++M+  +S   +H+ CF C +C   L +G+++  + + LFC+++ 
Sbjct:    8 QRLLCSGCECVITDKYYLRTDEHVWHGSCLKCDICEQSLDKTNSCYKRNGTFYCQHDYFRIYQQRKCAKCQEHIEHKEMVMKVLNS--VFHIHCFICGVCGKRLNSGEYFLLNGNILFCQDEI 128          
BLAST of LIM/homeobox protein Lhx2 vs. Planmine SMEST
Match: SMESG000059633.1 (SMESG000059633.1)

HSP 1 Score: 84.7297 bits (208), Expect = 7.069e-17
Identity = 47/135 (34.81%), Postives = 66/135 (48.89%), Query Frame = 2
Query:  269 SKQPEMESAVCNFCSQIILDKFYFEVD-GLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQF--KCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDFLVTQRD 664
            SK+     ++C  C   I DKF   V   L WH+ CLRC  C   L    +CF K+ K +C++DY + F   C  C   L  SD ++  GS    YH+ C +C  CN +L  GD +    + + C +D    QRD
Sbjct:   18 SKRSIKSCSLCVGCGGAITDKFILRVQPDLEWHARCLRCVKCNRGLDEKNTCFVKDGKTYCKEDYQKLFLQVCAACNRGLHKSDYVLHVGSR--IYHISCMKCVACNRVLQTGDEFAMRPNGVICLHDH---QRD 147          

HSP 2 Score: 57.3806 bits (137), Expect = 2.823e-8
Identity = 38/115 (33.04%), Postives = 58/115 (50.43%), Query Frame = 2
Query: 1172 IDHSSMHEASTLGTEDDDGSGGSCCESEDKIVISTKQGISKKG----SNSLRQK-----RVRTSFKHQQLRTMKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRR 1489
            ID  S   +S  G +  +G  G    +   +  S+  G++  G    S + R K     RVRT    +QL T++  ++ N  PD+    QL + TGLS RV++VWFQN R K ++
Sbjct:  250 IDDISQDGSSVCGNQSINGGHGGTISAAGSLP-SSGGGVTCTGNVKLSGTKRSKEQKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKK 363          
BLAST of LIM/homeobox protein Lhx2 vs. Planmine SMEST
Match: SMESG000020988.1 (SMESG000020988.1)

HSP 1 Score: 83.5741 bits (205), Expect = 8.888e-17
Identity = 41/119 (34.45%), Postives = 65/119 (54.62%), Query Frame = 2
Query:  299 CNFCSQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDYDRQ---FKCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYGCSNSQLFCKNDF 646
            CN C+ +I +K  F +    WH SC++C++CQ+ L    +CF       CR  Y++     KC  C  P+++ ++ M S +   PYH+ CF+C+ C  L+  GD +  SN  L CK D+
Sbjct:   53 CNMCNDLIKEKHLFVIGDSYWHKSCVKCDSCQIQLD--ETCFLVKNTLLCRNCYNKSSYVTKCFGCKLPMQTHEVAMYSLNQ--PYHLSCFKCNYCKNLISKGDKFIISNGFLICKQDY 167          
The following BLAST results are available for this feature:
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LHX22.654e-2956.78LIM homeobox 2 [Source:HGNC Symbol;Acc:HGNC:6594][more]
LHX23.367e-2956.78LIM homeobox 2 [Source:HGNC Symbol;Acc:HGNC:6594][more]
LHX92.544e-2849.61LIM homeobox 9 [Source:HGNC Symbol;Acc:HGNC:14222][more]
LHX93.006e-2849.61LIM homeobox 9 [Source:HGNC Symbol;Acc:HGNC:14222][more]
LHX93.817e-2129.52LIM homeobox 9 [Source:HGNC Symbol;Acc:HGNC:14222][more]
back to top
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttx-32.464e-2674.24LIM/homeobox protein ttx-3 [Source:UniProtKB/Swis... [more]
ttx-33.511e-2674.24LIM/homeobox protein ttx-3 [Source:UniProtKB/Swis... [more]
lim-49.946e-1934.65LIM domain family [Source:UniProtKB/TrEMBL;Acc:A0... [more]
lim-76.694e-1834.62CeLIM-7; LIM domain family [Source:UniProtKB/TrEM... [more]
lin-117.021e-1834.40pep chromosome:WBcel235:I:10248256:10255327:1 gene... [more]
back to top
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ap8.739e-3075.71gene:FBgn0267978 transcript:FBtr0086059[more]
ap8.739e-3075.71gene:FBgn0267978 transcript:FBtr0335274[more]
ap1.269e-2775.71gene:FBgn0267978 transcript:FBtr0300504[more]
ap1.294e-2775.71gene:FBgn0267978 transcript:FBtr0086058[more]
Awh5.790e-2336.36gene:FBgn0013751 transcript:FBtr0073155[more]
back to top
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lhx2b1.645e-2954.62LIM homeobox 2b [Source:ZFIN;Acc:ZDB-GENE-051220-1... [more]
lhx92.472e-2852.99LIM homeobox 9 [Source:NCBI gene;Acc:550405][more]
lhx2a6.916e-2557.30LIM homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-091118-1... [more]
lhx2a8.361e-2557.30LIM homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-091118-1... [more]
si:ch211-236k19.21.387e-2430.66si:ch211-236k19.2 [Source:ZFIN;Acc:ZDB-GENE-060531... [more]
back to top
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zfp36l27.065e-2878.79ZFP36 ring finger protein-like 2 [Source:Xenbase;A... [more]
LHX27.486e-2879.69LIM homeobox 2 [Source:NCBI gene;Acc:100486746][more]
zfp36l28.832e-2878.79ZFP36 ring finger protein-like 2 [Source:Xenbase;A... [more]
LHX28.923e-2855.65LIM homeobox 2 [Source:NCBI gene;Acc:100486746][more]
zfp36l21.552e-2030.36ZFP36 ring finger protein-like 2 [Source:Xenbase;A... [more]
back to top
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lhx21.951e-2956.78LIM homeobox protein 2 [Source:MGI Symbol;Acc:MGI:... [more]
Lhx22.290e-2956.78LIM homeobox protein 2 [Source:MGI Symbol;Acc:MGI:... [more]
Lhx94.634e-2878.79LIM homeobox protein 9 [Source:MGI Symbol;Acc:MGI:... [more]
Lhx97.036e-2854.78LIM homeobox protein 9 [Source:MGI Symbol;Acc:MGI:... [more]
Lhx93.356e-2129.52LIM homeobox protein 9 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of LIM/homeobox protein Lhx2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Z0S2|LHX2_MOUSE1.602e-2856.78LIM/homeobox protein Lhx2 OS=Mus musculus OX=10090... [more]
sp|P50458|LHX2_HUMAN1.617e-2856.78LIM/homeobox protein Lhx2 OS=Homo sapiens OX=9606 ... [more]
sp|P36198|LHX2_RAT4.613e-2856.78LIM/homeobox protein Lhx2 OS=Rattus norvegicus OX=... [more]
sp|Q9NQ69|LHX9_HUMAN1.444e-2749.61LIM/homeobox protein Lhx9 OS=Homo sapiens OX=9606 ... [more]
sp|A0JNI8|LHX9_BOVIN1.774e-2755.65LIM/homeobox protein Lhx9 OS=Bos taurus OX=9913 GN... [more]
back to top
BLAST of LIM/homeobox protein Lhx2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4NSB01.637e-4128.13Uncharacterized protein OS=Paragonimus westermani ... [more]
A0A4E0RRD92.865e-3631.90LIM/homeobox protein Lhx2 OS=Fasciola hepatica OX=... [more]
A0A504YGM11.166e-3530.73LIM/homeobox protein Lhx2 (Fragment) OS=Fasciola g... [more]
G9K8687.719e-3055.37LIM homeobox 2 (Fragment) OS=Mustela putorius furo... [more]
A6MKB42.943e-2956.03LIM homeobox protein Lhx2-like protein (Fragment) ... [more]
back to top
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lhx2b2.141e-2951.28LIM homeobox 2b [Source:ZFIN;Acc:ZDB-GENE-051220-1... [more]
lhx91.546e-2852.99LIM homeobox 9 [Source:NCBI gene;Acc:103038813][more]
ENSAMXT00000051669.13.066e-2237.42pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
lmx1ba2.793e-2038.66LIM homeobox transcription factor 1, beta a [Sourc... [more]
lhx63.162e-2033.33LIM homeobox 6 [Source:NCBI gene;Acc:103041775][more]
back to top
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lmo4b4.639e-1832.85LIM domain only 4b [Source:ZFIN;Acc:ZDB-GENE-03013... [more]
lmo25.887e-1230.00LIM domain only 2 (rhombotin-like 1) [Source:NCBI ... [more]
lmo23.448e-1130.00LIM domain only 2 (rhombotin-like 1) [Source:NCBI ... [more]
ENSPMAT00000009434.14.993e-1040.24pep scaffold:Pmarinus_7.0:GL476605:204971:209125:-... [more]
ENSPMAT00000000489.18.167e-1040.91pep scaffold:Pmarinus_7.0:GL476379:43572:49059:-1 ... [more]
back to top
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO433544.913e-3064.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343701.323e-1933.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460732.840e-1930.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO373167.609e-1731.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
LHX15.900e-1530.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of LIM/homeobox protein Lhx2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lhx2b4.698e-3055.46LIM homeobox 2 [Source:NCBI gene;Acc:101154958][more]
lhx95.500e-2850.83LIM homeobox 9 [Source:NCBI gene;Acc:100049461][more]
ENSORLT00000039212.16.835e-2331.88LIM/homeobox protein Lhx2-like [Source:NCBI gene;A... [more]
lmx1ba1.591e-2240.00LIM/homeobox protein LMX-1.2-like [Source:NCBI gen... [more]
lhx61.801e-2030.67LIM homeobox 6 [Source:NCBI gene;Acc:101170034][more]
back to top
BLAST of LIM/homeobox protein Lhx2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000057112.10.000e+0100.00SMESG000057112.1[more]
SMESG000010916.13.218e-2857.58SMESG000010916.1[more]
SMESG000001774.12.158e-2674.29SMESG000001774.1[more]
SMESG000059633.17.069e-1734.81SMESG000059633.1[more]
SMESG000020988.18.888e-1734.45SMESG000020988.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029242 ID=SMED30029242|Name=LIM/homeobox protein Lhx2|organism=Schmidtea mediterranea sexual|type=transcript|length=2061bp
TTTCCTGATGCCATAACCAATAAAAATGAGGAGAGAATAAAATCAATGAT
TGGTTAATTTTGCGATTTTTAAATAGTTAACAAAGATCTTTTCATTGAAA
ATTTAAATACTATCTTATTGGAAATTTAATGGATTTAATTTAATTACATT
TATAATTTTTATGAAAACCAATCACGAAATCCATAAAGAAATGACAATAT
TTTATGATCAAAAACAATTTGAAAGCAATTCTTTCAATAAAAAGAAGCTG
ATTAACGAAATTCAACAATCAAAACAACCCGAAATGGAATCAGCTGTTTG
CAATTTCTGTTCCCAAATTATTCTAGATAAATTCTATTTTGAGGTAGACG
GGCTCCTATGGCACAGCAGTTGTCTACGATGTAACGCTTGTCAAGTCAGT
CTAAGCAACATGAGGTCATGTTTTACTAAAAATAAAAAGTTTTGGTGTCG
ACAAGATTACGACAGGCAATTTAAATGCCAGAAATGCTGCGAACCATTAA
AATCTTCAGATTTGATTATGAGATCTGGAAGTTCCGGTTTACCGTACCAT
GTCGGTTGTTTCAGATGTGATCTTTGCAACGTTTTACTATTAGCAGGAGA
TTTCTACGGTTGCTCGAACAGCCAATTGTTTTGCAAAAATGATTTTCTCG
TTACTCAGAGAGATGTGAATAATCGTTCGGAAAATTGGCGATATTCTACC
GAGACTGGATCACTCAATACGACTGATGTGAATGGGAATTCGTCCACAGT
CACCGATAATCCGTTATCTGCTCTTTGCCAACTAAATGTTGACGAATATC
TCAGAAATAAAACCTCAACATCTGTAGTAGTTCCGCTAATTGATAAAATC
AACCTTTCATCAAAACTGATTTTACAGTCCACAGATGAAAGAAAAAATAT
TCCATATAATTCTTTGTTGGAAACTGAAAGTCCCAATACCAAAGAATACA
CATCTCTGACATCGTGTAAGATTATCCCAGAACCGAATTTAAATTATGAT
GACCAAGAGTTTTCTGAAGAATCCTTGCCAGATAAAACCCACGGGGTCAA
CCAAATCAAACTCGAAAACACCAGCTCTCCAAACTCAAATTATGAACCGG
ATGAAAAAAATATCGACGAAACCGTTGAGTCGAATGAAATGTCTTCGGAA
ACAGACATGGGAAAAGAGCTGATTGATCATAGCTCGATGCATGAAGCATC
AACTCTCGGAACAGAAGACGACGACGGAAGTGGCGGATCTTGCTGTGAAA
GTGAAGACAAAATTGTTATTTCTACCAAACAAGGAATCTCAAAAAAAGGA
TCAAATAGTTTGAGACAAAAAAGAGTTCGAACATCATTTAAGCATCAACA
GTTAAGAACGATGAAAGCTTACTTTTCCATGAATCATAATCCAGATTCAA
AAGATCTACGGCAACTTTCGCAAAAAACTGGATTATCGAAAAGAGTTCTA
CAAGTTTGGTTTCAGAATGCGCGCGCAAAATTCCGCCGAAGTCTTTGTCG
GCAAACTGGAGTAATGTGCGGCCCATCTGCCAACCAAATACAAATGCCAA
ACGTGTTCGATGACACTTCCCTAATCAGCATTGACAAAAATGGCAATTAC
TCAACTAAAACCACAATGACAACTTTCAGTGACATATCCTCGTCGATTTT
GAATCATTCCGTACAAAACAATCACCTACTCTGTTCAATGAACGATATCA
ACTATCAGAATCCAGCAAATAACGGATTGCTACAACAATCGACGATGTCA
AGTCTCCGAGACCGTTATTTCCCAAATGGTAAACAATCCTTCATTCCTGT
AACATCATATTACAGTAGCACCATTAATCCCGCCTCCCAAAGTTCTCCGT
CTTTGTTTTCAATGGATGTGGGAAATCTAGCCGTTAATTTAGGATTGGCT
GAATTTCCCCGTGATACTGGAGATTCGTTTCATTTAACTGAAATTGGAAT
GGGACAAAAAATTTCATCAATTTGAAAGTTTGGTCAATTTTTGAAAATAT
TACGTCAATTATGATCTCATCAGACGATTTTACATCGAAATATTTCACTC
ACACACACACA
back to top

protein sequence of SMED30029242-orf-1

>SMED30029242-orf-1 ID=SMED30029242-orf-1|Name=SMED30029242-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=605bp
MKTNHEIHKEMTIFYDQKQFESNSFNKKKLINEIQQSKQPEMESAVCNFC
SQIILDKFYFEVDGLLWHSSCLRCNACQVSLSNMRSCFTKNKKFWCRQDY
DRQFKCQKCCEPLKSSDLIMRSGSSGLPYHVGCFRCDLCNVLLLAGDFYG
CSNSQLFCKNDFLVTQRDVNNRSENWRYSTETGSLNTTDVNGNSSTVTDN
PLSALCQLNVDEYLRNKTSTSVVVPLIDKINLSSKLILQSTDERKNIPYN
SLLETESPNTKEYTSLTSCKIIPEPNLNYDDQEFSEESLPDKTHGVNQIK
LENTSSPNSNYEPDEKNIDETVESNEMSSETDMGKELIDHSSMHEASTLG
TEDDDGSGGSCCESEDKIVISTKQGISKKGSNSLRQKRVRTSFKHQQLRT
MKAYFSMNHNPDSKDLRQLSQKTGLSKRVLQVWFQNARAKFRRSLCRQTG
VMCGPSANQIQMPNVFDDTSLISIDKNGNYSTKTTMTTFSDISSSILNHS
VQNNHLLCSMNDINYQNPANNGLLQQSTMSSLRDRYFPNGKQSFIPVTSY
YSSTINPASQSSPSLFSMDVGNLAVNLGLAEFPRDTGDSFHLTEIGMGQK
ISSI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000240body wall musculature
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001356Homeobox_dom
IPR001781Znf_LIM
IPR009057Homeobox-like_sf
IPR017970Homeobox_CS
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0008270zinc ion binding
GO:0043565sequence-specific DNA binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 386..448
e-value: 2.6E-20
score: 83.5
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 387..443
e-value: 1.5E-17
score: 63.1
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 384..444
score: 17.054
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 387..444
e-value: 4.95663E-19
score: 78.8244
IPR001781Zinc finger, LIM-typeSMARTSM00132lim_4coord: 105..161
e-value: 0.0011
score: 26.4
coord: 46..99
e-value: 1.3E-11
score: 54.5
IPR001781Zinc finger, LIM-typePFAMPF00412LIMcoord: 106..163
e-value: 6.5E-7
score: 29.5
coord: 47..103
e-value: 1.9E-11
score: 44.0
IPR001781Zinc finger, LIM-typePROSITEPS00478LIM_DOMAIN_1coord: 47..81
IPR001781Zinc finger, LIM-typePROSITEPS00478LIM_DOMAIN_1coord: 106..143
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 107..168
score: 8.029
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 45..106
score: 12.682
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 380..445
e-value: 8.5E-25
score: 88.3
NoneNo IPR availableGENE3DG3DSA:2.10.110.10coord: 4..167
e-value: 1.8E-28
score: 101.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 285..315
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 297..312
NoneNo IPR availablePANTHERPTHR24208:SF168PROTEIN APTEROUScoord: 39..498
NoneNo IPR availablePANTHERPTHR24208FAMILY NOT NAMEDcoord: 39..498
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 73..140
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 419..442
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 375..443