carbamoyl-phosphate synthase [ammonia], mitochondrial-like

Overview
Namecarbamoyl-phosphate synthase [ammonia], mitochondrial-like
Smed IDSMED30029235
Length (bp)4624
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of carbamoyl-phosphate synthase [ammonia], mitochondrial-like (SMED30029235) t-SNE clustered cells

Violin plots show distribution of expression levels for carbamoyl-phosphate synthase [ammonia], mitochondrial-like (SMED30029235) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of carbamoyl-phosphate synthase [ammonia], mitochondrial-like (SMED30029235) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for carbamoyl-phosphate synthase [ammonia], mitochondrial-like (SMED30029235) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029235

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
tail regionSMED30029235SMESG000066808.1 SmedASXL_017275SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
gutSMED30029235SMESG000066808.1 dd_Smed_v4_4349_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30029235SMESG000066808.1 dd_Smed_v4_4349_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30029235SMESG000066808.1 dd_Smed_v4_4349_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029235SMESG000066808.1 dd_Smed_v4_4349_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30029235SMESG000066808.1 dd_Smed_v4_4349_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029235SMESG000066808.1 Contig40148newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029235SMESG000066808.1 Contig40148uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029235SMESG000081574.1 SMESG000077556.1 SMESG000071859.1 SMESG000068262.1 SMESG000067334.1 SMESG000066808.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039356.1 SMESG000033763.1 SMESG000020398.1 SMESG000015216.1 SMESG000007021.1 Contig42381newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029235SMESG000081574.1 SMESG000077556.1 SMESG000071859.1 SMESG000068262.1 SMESG000067334.1 SMESG000066808.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039356.1 SMESG000033763.1 SMESG000020398.1 SMESG000015216.1 SMESG000007021.1 Contig42381uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029235SMESG000066808.1 Contig9814newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029235SMESG000066808.1 Contig9814uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
tail regionSMED30029235SMESG000066808.1 dd_Smed_v6_4349_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
goblet cellSMED30029235SMESG000066808.1 dd_Smed_v6_4349_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30029235SMESG000066808.1 dd_Smed_v6_4349_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Human
Match: CPS1 (carbamoyl-phosphate synthase 1 [Source:HGNC Symbol;Acc:HGNC:2323])

HSP 1 Score: 1847.4 bits (4784), Expect = 0.000e+0
Identity = 890/1455 (61.17%), Postives = 1140/1455 (78.35%), Query Frame = 1
Query:  175 ARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAKIEFDTDPIEFKDPNKSNLTADVSTNYIQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIET-RNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSKSKTTI---IPSPKTIDFEPPXXXXXXXXXXXXXXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTSTEDFQNLDIPAATKLISDKFFDLVINLPNYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVESLDHVDLVTTDSLFNYQ 4527
            A + L +G    GYSFG+  S AGE+VFNTGL GYPE++TDP+Y+GQILT+  PI+GN G PDT A D  GL   +ES  I VSGL+V DYS+  +HW + KSL QWL +EKVPA++G+DTRMLTKI+RD G +L KIEF+  P++F DPNK NL A+VST  ++V+G+GNP K+V VDCGIK+N+I++L+ RGAEV LVPW++DFTK +YDG+ I+ GPG+PAL    ++N++ ++E+ R EPLFGI  GN + GLAAGA TYK+ + NRG NQPV+N+   QAFIT+QNHGY L+  +L   WK LF+N ND+TNEGIM+  KP F  QFHPE   GP DTE+LFD++  ++K    TTI   +P P  +     +V KVL+LGSGGLSIGQAGEFDYSGSQA+KA+KEE ++T+LMNPNIASVQTN  G KQAD VYFLP+T +FV +V++ E+PDG++L MGGQTALN G+EL ++G+L +Y VKVLGT ++SI+ATEDRQ F+D L EI  K+APS AV SIEDA++AA+ IGYPVM+R+A+ALGGLGSGI  N+E LMD+  +AFAMTNQ+L+E+S+ GWKE+EYEVVRDA DNC+TVCNMEN D +GVHTGDS+VVAP+QTLSN E+ MLR T++ V+RH GIVGECNIQ+ALHP S+EYCIIE+NARLSRSSALASKATGYPLAFIAAK+ALGI L +IKN  +  TSACFEPSLDY+ TKIPRWDLDRFH T   IGSSMKSVGEVMAIGRTFEES QKALRM HPS+ G T +L   K++  N DL K L  PS++RI+ I  A +   S+++I  LT ID WFL+K++ I+++   +  +N   +S++ E L  AK+ GFSDKQI   +G +E + RE+R    I PWVK IDT+AAEYP+VTNYLY +YNG EHDV FD  G+MVLGCGPYHIGSSVEFDWCAVS+IR LR+ G++TVV+N NPETVSTDFDE D+LYFEELSLER+LDIY  E   G IISVGGQIPNNLA+PL+KN V I+GT P +ID AEDRS FSA+LDE+ V QA W++++++++ALEFA  V YPCL+RPSY+LSGSAMNV ++ +E+  FL+ A ++SQ++PVV+TKF+EGA+E+E DA+ KDG ++ HA+SEH+E+AGVHSGDATL+LP  TIS+    ++++ + KIAK F ISGPFNVQFLVK  ++LVIECNLRASRS PFVSKT+G D I  ATKVM+   +DEK   T+D+P  P +Y+ IK+PMFSWPRL  ADP+LRCEM+STGEVACFGE ++TAFLKA+ S+ F++P+K   ILIG+Q  F+PRFL  A+ LH+ G+ ++ATEAT+++L  + +PA  V+WP  +++ QN  + +  KLI D   DLVINLPN  TK+V +NY+IRR A+DS  PL+ NF++ K+  E++     V + SLF+Y+
Sbjct:   46 AHIVLEDGTKMKGYSFGHPSSVAGEVVFNTGLGGYPEAITDPAYKGQILTMANPIIGNGGAPDTTALDELGLSKYLESNGIKVSGLLVLDYSKDYNHWLATKSLGQWLQEEKVPAIYGVDTRMLTKIIRDKGTMLGKIEFEGQPVDFVDPNKQNLIAEVSTKDVKVYGKGNPTKVVAVDCGIKNNVIRLLVKRGAEVHLVPWNHDFTKMEYDGILIAGGPGNPALAEPLIQNVRKILESDRKEPLFGISTGNLITGLAAGAKTYKMSMANRGQNQPVLNITNKQAFITAQNHGYALDN-TLPAGWKPLFVNVNDQTNEGIMHESKPFFAVQFHPEVTPGPIDTEYLFDSFFSLIKKGKATTITSVLPKPALVASRV-EVSKVLILGSGGLSIGQAGEFDYSGSQAVKAMKEENVKTVLMNPNIASVQTNEVGLKQADTVYFLPITPQFVTEVIKAEQPDGLILGMGGQTALNCGVELFKRGVLKEYGVKVLGTSVESIMATEDRQLFSDKLNEINEKIAPSFAVESIEDALKAADTIGYPVMIRSAYALGGLGSGICPNRETLMDLSTKAFAMTNQILVEKSVTGWKEIEYEVVRDADDNCVTVCNMENVDAMGVHTGDSVVVAPAQTLSNAEFQMLRRTSINVVRHLGIVGECNIQFALHPTSMEYCIIEVNARLSRSSALASKATGYPLAFIAAKIALGIPLPEIKNVVSGKTSACFEPSLDYMVTKIPRWDLDRFHGTSSRIGSSMKSVGEVMAIGRTFEESFQKALRMCHPSIEGFTPRLPMNKEWPSNLDLRKELSEPSSTRIYAIAKAIDDNMSLDEIEKLTYIDKWFLYKMRDILNMEKTLKGLNS--ESMTEETLKRAKEIGFSDKQISKCLGLTEAQTRELRLKKNIHPWVKQIDTLAAEYPSVTNYLYVTYNGQEHDVNFDDHGMMVLGCGPYHIGSSVEFDWCAVSSIRTLRQLGKKTVVVNCNPETVSTDFDECDKLYFEELSLERILDIYHQEACGGCIISVGGQIPNNLAVPLYKNGVKIMGTSPLQIDRAEDRSIFSAVLDELKVAQAPWKAVNTLNEALEFAKSVDYPCLLRPSYVLSGSAMNVVFSEDEMKKFLEEATRVSQEHPVVLTKFVEGAREVEMDAVGKDGRVISHAISEHVEDAGVHSGDATLMLPTQTISQGAIEKVKDATRKIAKAFAISGPFNVQFLVKGNDVLVIECNLRASRSFPFVSKTLGVDFIDVATKVMIGENVDEKHLPTLDHPIIPADYVAIKAPMFSWPRLRDADPILRCEMASTGEVACFGEGIHTAFLKAMLSTGFKIPQK--GILIGIQQSFRPRFLGVAEQLHNEGFKLFATEATSDWLNANNVPATPVAWP--SQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQKSRKVDSKSLFHYR 1492          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Human
Match: CPS1 (carbamoyl-phosphate synthase 1 [Source:HGNC Symbol;Acc:HGNC:2323])

HSP 1 Score: 1847.4 bits (4784), Expect = 0.000e+0
Identity = 890/1455 (61.17%), Postives = 1140/1455 (78.35%), Query Frame = 1
Query:  175 ARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAKIEFDTDPIEFKDPNKSNLTADVSTNYIQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIET-RNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSKSKTTI---IPSPKTIDFEPPXXXXXXXXXXXXXXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTSTEDFQNLDIPAATKLISDKFFDLVINLPNYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVESLDHVDLVTTDSLFNYQ 4527
            A + L +G    GYSFG+  S AGE+VFNTGL GYPE++TDP+Y+GQILT+  PI+GN G PDT A D  GL   +ES  I VSGL+V DYS+  +HW + KSL QWL +EKVPA++G+DTRMLTKI+RD G +L KIEF+  P++F DPNK NL A+VST  ++V+G+GNP K+V VDCGIK+N+I++L+ RGAEV LVPW++DFTK +YDG+ I+ GPG+PAL    ++N++ ++E+ R EPLFGI  GN + GLAAGA TYK+ + NRG NQPV+N+   QAFIT+QNHGY L+  +L   WK LF+N ND+TNEGIM+  KP F  QFHPE   GP DTE+LFD++  ++K    TTI   +P P  +     +V KVL+LGSGGLSIGQAGEFDYSGSQA+KA+KEE ++T+LMNPNIASVQTN  G KQAD VYFLP+T +FV +V++ E+PDG++L MGGQTALN G+EL ++G+L +Y VKVLGT ++SI+ATEDRQ F+D L EI  K+APS AV SIEDA++AA+ IGYPVM+R+A+ALGGLGSGI  N+E LMD+  +AFAMTNQ+L+E+S+ GWKE+EYEVVRDA DNC+TVCNMEN D +GVHTGDS+VVAP+QTLSN E+ MLR T++ V+RH GIVGECNIQ+ALHP S+EYCIIE+NARLSRSSALASKATGYPLAFIAAK+ALGI L +IKN  +  TSACFEPSLDY+ TKIPRWDLDRFH T   IGSSMKSVGEVMAIGRTFEES QKALRM HPS+ G T +L   K++  N DL K L  PS++RI+ I  A +   S+++I  LT ID WFL+K++ I+++   +  +N   +S++ E L  AK+ GFSDKQI   +G +E + RE+R    I PWVK IDT+AAEYP+VTNYLY +YNG EHDV FD  G+MVLGCGPYHIGSSVEFDWCAVS+IR LR+ G++TVV+N NPETVSTDFDE D+LYFEELSLER+LDIY  E   G IISVGGQIPNNLA+PL+KN V I+GT P +ID AEDRS FSA+LDE+ V QA W++++++++ALEFA  V YPCL+RPSY+LSGSAMNV ++ +E+  FL+ A ++SQ++PVV+TKF+EGA+E+E DA+ KDG ++ HA+SEH+E+AGVHSGDATL+LP  TIS+    ++++ + KIAK F ISGPFNVQFLVK  ++LVIECNLRASRS PFVSKT+G D I  ATKVM+   +DEK   T+D+P  P +Y+ IK+PMFSWPRL  ADP+LRCEM+STGEVACFGE ++TAFLKA+ S+ F++P+K   ILIG+Q  F+PRFL  A+ LH+ G+ ++ATEAT+++L  + +PA  V+WP  +++ QN  + +  KLI D   DLVINLPN  TK+V +NY+IRR A+DS  PL+ NF++ K+  E++     V + SLF+Y+
Sbjct:   46 AHIVLEDGTKMKGYSFGHPSSVAGEVVFNTGLGGYPEAITDPAYKGQILTMANPIIGNGGAPDTTALDELGLSKYLESNGIKVSGLLVLDYSKDYNHWLATKSLGQWLQEEKVPAIYGVDTRMLTKIIRDKGTMLGKIEFEGQPVDFVDPNKQNLIAEVSTKDVKVYGKGNPTKVVAVDCGIKNNVIRLLVKRGAEVHLVPWNHDFTKMEYDGILIAGGPGNPALAEPLIQNVRKILESDRKEPLFGISTGNLITGLAAGAKTYKMSMANRGQNQPVLNITNKQAFITAQNHGYALDN-TLPAGWKPLFVNVNDQTNEGIMHESKPFFAVQFHPEVTPGPIDTEYLFDSFFSLIKKGKATTITSVLPKPALVASRV-EVSKVLILGSGGLSIGQAGEFDYSGSQAVKAMKEENVKTVLMNPNIASVQTNEVGLKQADTVYFLPITPQFVTEVIKAEQPDGLILGMGGQTALNCGVELFKRGVLKEYGVKVLGTSVESIMATEDRQLFSDKLNEINEKIAPSFAVESIEDALKAADTIGYPVMIRSAYALGGLGSGICPNRETLMDLSTKAFAMTNQILVEKSVTGWKEIEYEVVRDADDNCVTVCNMENVDAMGVHTGDSVVVAPAQTLSNAEFQMLRRTSINVVRHLGIVGECNIQFALHPTSMEYCIIEVNARLSRSSALASKATGYPLAFIAAKIALGIPLPEIKNVVSGKTSACFEPSLDYMVTKIPRWDLDRFHGTSSRIGSSMKSVGEVMAIGRTFEESFQKALRMCHPSIEGFTPRLPMNKEWPSNLDLRKELSEPSSTRIYAIAKAIDDNMSLDEIEKLTYIDKWFLYKMRDILNMEKTLKGLNS--ESMTEETLKRAKEIGFSDKQISKCLGLTEAQTRELRLKKNIHPWVKQIDTLAAEYPSVTNYLYVTYNGQEHDVNFDDHGMMVLGCGPYHIGSSVEFDWCAVSSIRTLRQLGKKTVVVNCNPETVSTDFDECDKLYFEELSLERILDIYHQEACGGCIISVGGQIPNNLAVPLYKNGVKIMGTSPLQIDRAEDRSIFSAVLDELKVAQAPWKAVNTLNEALEFAKSVDYPCLLRPSYVLSGSAMNVVFSEDEMKKFLEEATRVSQEHPVVLTKFVEGAREVEMDAVGKDGRVISHAISEHVEDAGVHSGDATLMLPTQTISQGAIEKVKDATRKIAKAFAISGPFNVQFLVKGNDVLVIECNLRASRSFPFVSKTLGVDFIDVATKVMIGENVDEKHLPTLDHPIIPADYVAIKAPMFSWPRLRDADPILRCEMASTGEVACFGEGIHTAFLKAMLSTGFKIPQK--GILIGIQQSFRPRFLGVAEQLHNEGFKLFATEATSDWLNANNVPATPVAWP--SQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQKSRKVDSKSLFHYR 1492          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Human
Match: CPS1 (carbamoyl-phosphate synthase 1 [Source:HGNC Symbol;Acc:HGNC:2323])

HSP 1 Score: 1847.4 bits (4784), Expect = 0.000e+0
Identity = 890/1455 (61.17%), Postives = 1140/1455 (78.35%), Query Frame = 1
Query:  175 ARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAKIEFDTDPIEFKDPNKSNLTADVSTNYIQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIET-RNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSKSKTTI---IPSPKTIDFEPPXXXXXXXXXXXXXXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTSTEDFQNLDIPAATKLISDKFFDLVINLPNYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVESLDHVDLVTTDSLFNYQ 4527
            A + L +G    GYSFG+  S AGE+VFNTGL GYPE++TDP+Y+GQILT+  PI+GN G PDT A D  GL   +ES  I VSGL+V DYS+  +HW + KSL QWL +EKVPA++G+DTRMLTKI+RD G +L KIEF+  P++F DPNK NL A+VST  ++V+G+GNP K+V VDCGIK+N+I++L+ RGAEV LVPW++DFTK +YDG+ I+ GPG+PAL    ++N++ ++E+ R EPLFGI  GN + GLAAGA TYK+ + NRG NQPV+N+   QAFIT+QNHGY L+  +L   WK LF+N ND+TNEGIM+  KP F  QFHPE   GP DTE+LFD++  ++K    TTI   +P P  +     +V KVL+LGSGGLSIGQAGEFDYSGSQA+KA+KEE ++T+LMNPNIASVQTN  G KQAD VYFLP+T +FV +V++ E+PDG++L MGGQTALN G+EL ++G+L +Y VKVLGT ++SI+ATEDRQ F+D L EI  K+APS AV SIEDA++AA+ IGYPVM+R+A+ALGGLGSGI  N+E LMD+  +AFAMTNQ+L+E+S+ GWKE+EYEVVRDA DNC+TVCNMEN D +GVHTGDS+VVAP+QTLSN E+ MLR T++ V+RH GIVGECNIQ+ALHP S+EYCIIE+NARLSRSSALASKATGYPLAFIAAK+ALGI L +IKN  +  TSACFEPSLDY+ TKIPRWDLDRFH T   IGSSMKSVGEVMAIGRTFEES QKALRM HPS+ G T +L   K++  N DL K L  PS++RI+ I  A +   S+++I  LT ID WFL+K++ I+++   +  +N   +S++ E L  AK+ GFSDKQI   +G +E + RE+R    I PWVK IDT+AAEYP+VTNYLY +YNG EHDV FD  G+MVLGCGPYHIGSSVEFDWCAVS+IR LR+ G++TVV+N NPETVSTDFDE D+LYFEELSLER+LDIY  E   G IISVGGQIPNNLA+PL+KN V I+GT P +ID AEDRS FSA+LDE+ V QA W++++++++ALEFA  V YPCL+RPSY+LSGSAMNV ++ +E+  FL+ A ++SQ++PVV+TKF+EGA+E+E DA+ KDG ++ HA+SEH+E+AGVHSGDATL+LP  TIS+    ++++ + KIAK F ISGPFNVQFLVK  ++LVIECNLRASRS PFVSKT+G D I  ATKVM+   +DEK   T+D+P  P +Y+ IK+PMFSWPRL  ADP+LRCEM+STGEVACFGE ++TAFLKA+ S+ F++P+K   ILIG+Q  F+PRFL  A+ LH+ G+ ++ATEAT+++L  + +PA  V+WP  +++ QN  + +  KLI D   DLVINLPN  TK+V +NY+IRR A+DS  PL+ NF++ K+  E++     V + SLF+Y+
Sbjct:   46 AHIVLEDGTKMKGYSFGHPSSVAGEVVFNTGLGGYPEAITDPAYKGQILTMANPIIGNGGAPDTTALDELGLSKYLESNGIKVSGLLVLDYSKDYNHWLATKSLGQWLQEEKVPAIYGVDTRMLTKIIRDKGTMLGKIEFEGQPVDFVDPNKQNLIAEVSTKDVKVYGKGNPTKVVAVDCGIKNNVIRLLVKRGAEVHLVPWNHDFTKMEYDGILIAGGPGNPALAEPLIQNVRKILESDRKEPLFGISTGNLITGLAAGAKTYKMSMANRGQNQPVLNITNKQAFITAQNHGYALDN-TLPAGWKPLFVNVNDQTNEGIMHESKPFFAVQFHPEVTPGPIDTEYLFDSFFSLIKKGKATTITSVLPKPALVASRV-EVSKVLILGSGGLSIGQAGEFDYSGSQAVKAMKEENVKTVLMNPNIASVQTNEVGLKQADTVYFLPITPQFVTEVIKAEQPDGLILGMGGQTALNCGVELFKRGVLKEYGVKVLGTSVESIMATEDRQLFSDKLNEINEKIAPSFAVESIEDALKAADTIGYPVMIRSAYALGGLGSGICPNRETLMDLSTKAFAMTNQILVEKSVTGWKEIEYEVVRDADDNCVTVCNMENVDAMGVHTGDSVVVAPAQTLSNAEFQMLRRTSINVVRHLGIVGECNIQFALHPTSMEYCIIEVNARLSRSSALASKATGYPLAFIAAKIALGIPLPEIKNVVSGKTSACFEPSLDYMVTKIPRWDLDRFHGTSSRIGSSMKSVGEVMAIGRTFEESFQKALRMCHPSIEGFTPRLPMNKEWPSNLDLRKELSEPSSTRIYAIAKAIDDNMSLDEIEKLTYIDKWFLYKMRDILNMEKTLKGLNS--ESMTEETLKRAKEIGFSDKQISKCLGLTEAQTRELRLKKNIHPWVKQIDTLAAEYPSVTNYLYVTYNGQEHDVNFDDHGMMVLGCGPYHIGSSVEFDWCAVSSIRTLRQLGKKTVVVNCNPETVSTDFDECDKLYFEELSLERILDIYHQEACGGCIISVGGQIPNNLAVPLYKNGVKIMGTSPLQIDRAEDRSIFSAVLDELKVAQAPWKAVNTLNEALEFAKSVDYPCLLRPSYVLSGSAMNVVFSEDEMKKFLEEATRVSQEHPVVLTKFVEGAREVEMDAVGKDGRVISHAISEHVEDAGVHSGDATLMLPTQTISQGAIEKVKDATRKIAKAFAISGPFNVQFLVKGNDVLVIECNLRASRSFPFVSKTLGVDFIDVATKVMIGENVDEKHLPTLDHPIIPADYVAIKAPMFSWPRLRDADPILRCEMASTGEVACFGEGIHTAFLKAMLSTGFKIPQK--GILIGIQQSFRPRFLGVAEQLHNEGFKLFATEATSDWLNANNVPATPVAWP--SQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQKSRKVDSKSLFHYR 1492          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Human
Match: CPS1 (carbamoyl-phosphate synthase 1 [Source:HGNC Symbol;Acc:HGNC:2323])

HSP 1 Score: 1847.4 bits (4784), Expect = 0.000e+0
Identity = 890/1455 (61.17%), Postives = 1140/1455 (78.35%), Query Frame = 1
Query:  175 ARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAKIEFDTDPIEFKDPNKSNLTADVSTNYIQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIET-RNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSKSKTTI---IPSPKTIDFEPPXXXXXXXXXXXXXXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTSTEDFQNLDIPAATKLISDKFFDLVINLPNYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVESLDHVDLVTTDSLFNYQ 4527
            A + L +G    GYSFG+  S AGE+VFNTGL GYPE++TDP+Y+GQILT+  PI+GN G PDT A D  GL   +ES  I VSGL+V DYS+  +HW + KSL QWL +EKVPA++G+DTRMLTKI+RD G +L KIEF+  P++F DPNK NL A+VST  ++V+G+GNP K+V VDCGIK+N+I++L+ RGAEV LVPW++DFTK +YDG+ I+ GPG+PAL    ++N++ ++E+ R EPLFGI  GN + GLAAGA TYK+ + NRG NQPV+N+   QAFIT+QNHGY L+  +L   WK LF+N ND+TNEGIM+  KP F  QFHPE   GP DTE+LFD++  ++K    TTI   +P P  +     +V KVL+LGSGGLSIGQAGEFDYSGSQA+KA+KEE ++T+LMNPNIASVQTN  G KQAD VYFLP+T +FV +V++ E+PDG++L MGGQTALN G+EL ++G+L +Y VKVLGT ++SI+ATEDRQ F+D L EI  K+APS AV SIEDA++AA+ IGYPVM+R+A+ALGGLGSGI  N+E LMD+  +AFAMTNQ+L+E+S+ GWKE+EYEVVRDA DNC+TVCNMEN D +GVHTGDS+VVAP+QTLSN E+ MLR T++ V+RH GIVGECNIQ+ALHP S+EYCIIE+NARLSRSSALASKATGYPLAFIAAK+ALGI L +IKN  +  TSACFEPSLDY+ TKIPRWDLDRFH T   IGSSMKSVGEVMAIGRTFEES QKALRM HPS+ G T +L   K++  N DL K L  PS++RI+ I  A +   S+++I  LT ID WFL+K++ I+++   +  +N   +S++ E L  AK+ GFSDKQI   +G +E + RE+R    I PWVK IDT+AAEYP+VTNYLY +YNG EHDV FD  G+MVLGCGPYHIGSSVEFDWCAVS+IR LR+ G++TVV+N NPETVSTDFDE D+LYFEELSLER+LDIY  E   G IISVGGQIPNNLA+PL+KN V I+GT P +ID AEDRS FSA+LDE+ V QA W++++++++ALEFA  V YPCL+RPSY+LSGSAMNV ++ +E+  FL+ A ++SQ++PVV+TKF+EGA+E+E DA+ KDG ++ HA+SEH+E+AGVHSGDATL+LP  TIS+    ++++ + KIAK F ISGPFNVQFLVK  ++LVIECNLRASRS PFVSKT+G D I  ATKVM+   +DEK   T+D+P  P +Y+ IK+PMFSWPRL  ADP+LRCEM+STGEVACFGE ++TAFLKA+ S+ F++P+K   ILIG+Q  F+PRFL  A+ LH+ G+ ++ATEAT+++L  + +PA  V+WP  +++ QN  + +  KLI D   DLVINLPN  TK+V +NY+IRR A+DS  PL+ NF++ K+  E++     V + SLF+Y+
Sbjct:   46 AHIVLEDGTKMKGYSFGHPSSVAGEVVFNTGLGGYPEAITDPAYKGQILTMANPIIGNGGAPDTTALDELGLSKYLESNGIKVSGLLVLDYSKDYNHWLATKSLGQWLQEEKVPAIYGVDTRMLTKIIRDKGTMLGKIEFEGQPVDFVDPNKQNLIAEVSTKDVKVYGKGNPTKVVAVDCGIKNNVIRLLVKRGAEVHLVPWNHDFTKMEYDGILIAGGPGNPALAEPLIQNVRKILESDRKEPLFGISTGNLITGLAAGAKTYKMSMANRGQNQPVLNITNKQAFITAQNHGYALDN-TLPAGWKPLFVNVNDQTNEGIMHESKPFFAVQFHPEVTPGPIDTEYLFDSFFSLIKKGKATTITSVLPKPALVASRV-EVSKVLILGSGGLSIGQAGEFDYSGSQAVKAMKEENVKTVLMNPNIASVQTNEVGLKQADTVYFLPITPQFVTEVIKAEQPDGLILGMGGQTALNCGVELFKRGVLKEYGVKVLGTSVESIMATEDRQLFSDKLNEINEKIAPSFAVESIEDALKAADTIGYPVMIRSAYALGGLGSGICPNRETLMDLSTKAFAMTNQILVEKSVTGWKEIEYEVVRDADDNCVTVCNMENVDAMGVHTGDSVVVAPAQTLSNAEFQMLRRTSINVVRHLGIVGECNIQFALHPTSMEYCIIEVNARLSRSSALASKATGYPLAFIAAKIALGIPLPEIKNVVSGKTSACFEPSLDYMVTKIPRWDLDRFHGTSSRIGSSMKSVGEVMAIGRTFEESFQKALRMCHPSIEGFTPRLPMNKEWPSNLDLRKELSEPSSTRIYAIAKAIDDNMSLDEIEKLTYIDKWFLYKMRDILNMEKTLKGLNS--ESMTEETLKRAKEIGFSDKQISKCLGLTEAQTRELRLKKNIHPWVKQIDTLAAEYPSVTNYLYVTYNGQEHDVNFDDHGMMVLGCGPYHIGSSVEFDWCAVSSIRTLRQLGKKTVVVNCNPETVSTDFDECDKLYFEELSLERILDIYHQEACGGCIISVGGQIPNNLAVPLYKNGVKIMGTSPLQIDRAEDRSIFSAVLDELKVAQAPWKAVNTLNEALEFAKSVDYPCLLRPSYVLSGSAMNVVFSEDEMKKFLEEATRVSQEHPVVLTKFVEGAREVEMDAVGKDGRVISHAISEHVEDAGVHSGDATLMLPTQTISQGAIEKVKDATRKIAKAFAISGPFNVQFLVKGNDVLVIECNLRASRSFPFVSKTLGVDFIDVATKVMIGENVDEKHLPTLDHPIIPADYVAIKAPMFSWPRLRDADPILRCEMASTGEVACFGEGIHTAFLKAMLSTGFKIPQK--GILIGIQQSFRPRFLGVAEQLHNEGFKLFATEATSDWLNANNVPATPVAWP--SQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQKSRKVDSKSLFHYR 1492          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Human
Match: CPS1 (carbamoyl-phosphate synthase 1 [Source:HGNC Symbol;Acc:HGNC:2323])

HSP 1 Score: 1845.48 bits (4779), Expect = 0.000e+0
Identity = 890/1455 (61.17%), Postives = 1140/1455 (78.35%), Query Frame = 1
Query:  175 ARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAKIEFDTDPIEFKDPNKSNLTADVSTNYIQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIET-RNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSKSKTTI---IPSPKTIDFEPPXXXXXXXXXXXXXXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTSTEDFQNLDIPAATKLISDKFFDLVINLPNYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVESLDHVDLVTTDSLFNYQ 4527
            A + L +G    GYSFG+  S AGE+VFNTGL GYPE++TDP+Y+GQILT+  PI+GN G PDT A D  GL   +ES  I VSGL+V DYS+  +HW + KSL QWL +EKVPA++G+DTRMLTKI+RD G +L KIEF+  P++F DPNK NL A+VST  ++V+G+GNP K+V VDCGIK+N+I++L+ RGAEV LVPW++DFTK +YDG+ I+ GPG+PAL    ++N++ ++E+ R EPLFGI  GN + GLAAGA TYK+ + NRG NQPV+N+   QAFIT+QNHGY L+  +L   WK LF+N ND+TNEGIM+  KP F  QFHPE   GP DTE+LFD++  ++K    TTI   +P P  +     +V KVL+LGSGGLSIGQAGEFDYSGSQA+KA+KEE ++T+LMNPNIASVQTN  G KQAD VYFLP+T +FV +V++ E+PDG++L MGGQTALN G+EL ++G+L +Y VKVLGT ++SI+ATEDRQ F+D L EI  K+APS AV SIEDA++AA+ IGYPVM+R+A+ALGGLGSGI  N+E LMD+  +AFAMTNQ+L+E+S+ GWKE+EYEVVRDA DNC+TVCNMEN D +GVHTGDS+VVAP+QTLSN E+ MLR T++ V+RH GIVGECNIQ+ALHP S+EYCIIE+NARLSRSSALASKATGYPLAFIAAK+ALGI L +IKN  +  TSACFEPSLDY+ TKIPRWDLDRFH T   IGSSMKSVGEVMAIGRTFEES QKALRM HPS+ G T +L   K++  N DL K L  PS++RI+ I  A +   S+++I  LT ID WFL+K++ I+++   +  +N   +S++ E L  AK+ GFSDKQI   +G +E + RE+R    I PWVK IDT+AAEYP+VTNYLY +YNG EHDV FD  G+MVLGCGPYHIGSSVEFDWCAVS+IR LR+ G++TVV+N NPETVSTDFDE D+LYFEELSLER+LDIY  E   G IISVGGQIPNNLA+PL+KN V I+GT P +ID AEDRS FSA+LDE+ V QA W++++++++ALEFA  V YPCL+RPSY+LSGSAMNV ++ +E+  FL+ A ++SQ++PVV+TKF+EGA+E+E DA+ KDG ++ HA+SEH+E+AGVHSGDATL+LP  TIS+    ++++ + KIAK F ISGPFNVQFLVK  ++LVIECNLRASRS PFVSKT+G D I  ATKVM+   +DEK   T+D+P  P +Y+ IK+PMFSWPRL  ADP+LRCEM+STGEVACFGE ++TAFLKA+ S+ F++P+K   ILIG+Q  F+PRFL  A+ LH+ G+ ++ATEAT+++L  + +PA  V+WP  +++ QN  + +  KLI D   DLVINLPN  TK+V +NY+IRR A+DS  PL+ NF++ K+  E++     V + SLF+Y+
Sbjct:   52 AHIVLEDGTKMKGYSFGHPSSVAGEVVFNTGLGGYPEAITDPAYKGQILTMANPIIGNGGAPDTTALDELGLSKYLESNGIKVSGLLVLDYSKDYNHWLATKSLGQWLQEEKVPAIYGVDTRMLTKIIRDKGTMLGKIEFEGQPVDFVDPNKQNLIAEVSTKDVKVYGKGNPTKVVAVDCGIKNNVIRLLVKRGAEVHLVPWNHDFTKMEYDGILIAGGPGNPALAEPLIQNVRKILESDRKEPLFGISTGNLITGLAAGAKTYKMSMANRGQNQPVLNITNKQAFITAQNHGYALDN-TLPAGWKPLFVNVNDQTNEGIMHESKPFFAVQFHPEVTPGPIDTEYLFDSFFSLIKKGKATTITSVLPKPALVASRV-EVSKVLILGSGGLSIGQAGEFDYSGSQAVKAMKEENVKTVLMNPNIASVQTNEVGLKQADTVYFLPITPQFVTEVIKAEQPDGLILGMGGQTALNCGVELFKRGVLKEYGVKVLGTSVESIMATEDRQLFSDKLNEINEKIAPSFAVESIEDALKAADTIGYPVMIRSAYALGGLGSGICPNRETLMDLSTKAFAMTNQILVEKSVTGWKEIEYEVVRDADDNCVTVCNMENVDAMGVHTGDSVVVAPAQTLSNAEFQMLRRTSINVVRHLGIVGECNIQFALHPTSMEYCIIEVNARLSRSSALASKATGYPLAFIAAKIALGIPLPEIKNVVSGKTSACFEPSLDYMVTKIPRWDLDRFHGTSSRIGSSMKSVGEVMAIGRTFEESFQKALRMCHPSIEGFTPRLPMNKEWPSNLDLRKELSEPSSTRIYAIAKAIDDNMSLDEIEKLTYIDKWFLYKMRDILNMEKTLKGLNS--ESMTEETLKRAKEIGFSDKQISKCLGLTEAQTRELRLKKNIHPWVKQIDTLAAEYPSVTNYLYVTYNGQEHDVNFDDHGMMVLGCGPYHIGSSVEFDWCAVSSIRTLRQLGKKTVVVNCNPETVSTDFDECDKLYFEELSLERILDIYHQEACGGCIISVGGQIPNNLAVPLYKNGVKIMGTSPLQIDRAEDRSIFSAVLDELKVAQAPWKAVNTLNEALEFAKSVDYPCLLRPSYVLSGSAMNVVFSEDEMKKFLEEATRVSQEHPVVLTKFVEGAREVEMDAVGKDGRVISHAISEHVEDAGVHSGDATLMLPTQTISQGAIEKVKDATRKIAKAFAISGPFNVQFLVKGNDVLVIECNLRASRSFPFVSKTLGVDFIDVATKVMIGENVDEKHLPTLDHPIIPADYVAIKAPMFSWPRLRDADPILRCEMASTGEVACFGEGIHTAFLKAMLSTGFKIPQK--GILIGIQQSFRPRFLGVAEQLHNEGFKLFATEATSDWLNANNVPATPVAWP--SQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQKSRKVDSKSLFHYR 1498          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Celegans
Match: pyr-1 (CAD protein Glutamine-dependent carbamoyl-phosphate synthase Aspartate carbamoyltransferase Dihydroorotase [Source:UniProtKB/Swiss-Prot;Acc:Q18990])

HSP 1 Score: 1410.2 bits (3649), Expect = 0.000e+0
Identity = 757/1485 (50.98%), Postives = 998/1485 (67.21%), Query Frame = 1
Query:  172 KARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQD--YSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAKIEFDTDP---IEFKDPNKSNLTADVSTNYIQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDF-TKDKYDGLFISNGPGDPALVSETVKNIKTVIETRNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSKSKTTII----PSPKTIDFEP----PXXXXXXXXXXXXXXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKG-YSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFD-KQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMM--NIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWP---TSTEDFQNLDIPAATKLISDKFFDLVINLP-----NYK-TKYVTENYLIRRAAIDSATPLMINFELVKMLVESLDH----------VDLVTTDSL 4515
            +A LHL +G  F G  +G  KS  GE+VF TG+ GY ESLTDPSY  Q+LTLTYP++GNYGVP     D   L    ES+RI  + LIV+        SHW +V+SLS+WL    VP L GID R L K +R++G + AK+  ++D     ++ D N  NL   VS     V+G G+   I+ VDCG+K+N I+ L  RG  V +VPW++   T+  YDGLF+SNGPGDP + +  V  +  VI   ++P+FGIC G+Q++  A GA TYKL  GNRGHNQP  +  T + +ITSQNHGY ++ +SL  DWK LF N NDKTNEGI+++ KP F+ QFHPE   GPTD EFLFD + + V+     T +       + + F P     + +KVLVLGSGGL+IGQAGEFDYSG+QA+KAL+EEGI T+L+NPNIA+VQT+      ADF YFLP+T E+V  V++KERP GIL + GGQTALN  I+L++ GI  +Y V+VLGT I +I+ TEDR  F   +  IG K+APS+A  ++E AIEAA ++GYPV+VRAA+ALGGLGSG ADN+E+L+ I ++A A +NQVL+++SL GWKEVEYEVVRDA DNCITVCNMEN DPLG+HTG+S+VVAPSQTLS+ EY+ LR  A+KVIRH GI+GECNIQYAL P SL Y IIE+NARLSRSSALASKATGYPLA++AAKLALG  L  I+N+ T  T+ACFEPSLDY   KIPRWDL +F     +IGSSMKSVGEVM IGR FEE+LQKALRM     +G +        +S     D +L  P++ R+  +      G + VEK H LT+ID WFL +++ IVD+   + + + N  ++S E L  AKQAGFSD+QI   IG +E  VRE R    ITP VK IDT+A E+P  TNYLY ++NG+E+DV+F+ K  VMVLG G Y IGSSVEFD   V  IR L+  G  T+ +N NPETVSTD+D  DRLYFEE+S E VLD+Y  E PKG I++ GGQ PNN+A+ L +  V I GT PN ID+AEDR KFS  L+ + + Q  W+   +++DA  F ++VGYPCL+RPSY+LSG+AMNVA+   +L  FLK A  +++++PVV++KF+  AKE++ DA+A DG +V  A+SEHIENAGVHSGDATLV P   ++K    +I++I+ +IA+ F ++GPFN+Q + K  E+ VIECNLR SRS PFVSKT+  D +A AT+ MM  + P             + K  +G+K P FS+ RL  AD +L  EM+STGEVACFG +   A+LKAL S+ F +P++N  I IG  H  +   L + ++L   GY +Y ++ TA+Y + +KI    V WP    S+++       +  + + +K F LVINLP      Y+ + + T  Y  RR AID+  PL+ + +  K  +++L+           VD VT+ SL
Sbjct:    2 RATLHLEDGSTFVGSIYGATKSVVGEIVFQTGMVGYVESLTDPSYAKQLLTLTYPLIGNYGVPSAEILDQFKLPAEFESDRIWPAALIVEKICVDGEHSHWQAVQSLSEWLRKADVPCLSGIDVRQLVKKIRETGTMKAKLVIESDNAQNFDYVDVNAENLVDFVSRKEPVVYGSGD-QTILAVDCGLKNNQIRCLAKRGFRVKVVPWNHPIDTESDYDGLFLSNGPGDPEICAPLVDRLAKVIARGDKPIFGICLGHQILSRAIGAKTYKLKYGNRGHNQPCTHYATGRCYITSQNHGYAVDPDSLPADWKALFTNENDKTNEGIVHSSKPFFSVQFHPEHTAGPTDCEFLFDVFADSVRQAKSGTFMNVDQELTRLMTFTPIYHAKEQRKVLVLGSGGLTIGQAGEFDYSGAQALKALREEGIRTVLINPNIATVQTS---KGFADFTYFLPITKEYVTDVIKKERPTGILCTFGGQTALNCAIDLYKDGIFEQYDVQVLGTQINTIMKTEDRDLFNQEISAIGEKVAPSKAATTMEGAIEAAEELGYPVLVRAAYALGGLGSGFADNREELIAIAQQALAHSNQVLVDKSLKGWKEVEYEVVRDAYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSDREYNALRTCAIKVIRHLGIIGECNIQYALDPYSLTYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGQHLPVIRNSVTGTTTACFEPSLDYCVVKIPRWDLGKFARVSTQIGSSMKSVGEVMGIGRCFEEALQKALRMVSDHADGFSPYT-----FSRPTTAD-DLSKPTDKRMFALARGMYYGDFDVEKAHELTRIDRWFLFRMQNIVDIYHRLEKTDVN--TVSAELLLEAKQAGFSDRQIAKKIGSNEYTVREARFVKGITPCVKQIDTVAGEWPAQTNYLYTTFNGIENDVSFNMKNAVMVLGSGVYRIGSSVEFDSSCVGCIRELKALGYSTITVNCNPETVSTDYDICDRLYFEEISFETVLDVYHLEKPKGVILAFGGQAPNNIAMSLSRAQVKIFGTSPNDIDNAEDRFKFSRKLESLKISQPQWKKSENMEDAKNFCAQVGYPCLIRPSYVLSGAAMNVAHNAEDLEVFLKQAAVVAKEHPVVVSKFINEAKELDVDAVALDGKLVVMAVSEHIENAGVHSGDATLVTPAQDMNKLTLDRIKDITFRIAEAFNVNGPFNMQLIAKNNELKVIECNLRVSRSFPFVSKTLDYDFVALATRAMMASDSPAIRATIKPTATLLKGKGRVGVKVPQFSFSRLAGADVMLGVEMASTGEVACFGTSRCDAYLKALLSTGFVVPKQNIFISIGGYHA-KAEMLKSVEALLKLGYELYGSKGTADYFQSNKINVKPVDWPFEEGSSDEKTASGTRSVVEFLENKEFHLVINLPIRGSGAYRVSAFRTHGYKTRRMAIDNGIPLITDIKCAKTFIQALEMVGKRPTMNSLVDCVTSKSL 1473          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Fly
Match: r (gene:FBgn0003189 transcript:FBtr0089734)

HSP 1 Score: 1439.86 bits (3726), Expect = 0.000e+0
Identity = 749/1471 (50.92%), Postives = 997/1471 (67.78%), Query Frame = 1
Query:  169 TKARLHLNNGKVFSGYSFGYDKST-------AGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESER--IHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAKIEFDTDPIE------FKDPNKSNLTADVSTNYIQVFGR--GNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIETRNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSKSKT-------TIIPSPKTIDFEPPXXXXXXXXXXXXXXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIG-LQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWP--TSTEDFQNLDIPAATKLISDKFFDLVINLP------NYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVESL 4482
            T   L L +G V  GYSFGY  S         GE+VF TG+ GY E+LTD SY GQIL LTYP++GNYGVP  +  D +GL L+ E  +  +  + L+V + +E   HW   K+L  WL   KVP +  IDTR LTK +R+ G++L KI ++  P+E      F DPN  NL  + S    QV+G   G   +I  +DCG+K N ++ L+ RGA VTL+PW      +++D LF+SNGPG+P    + V+ ++ VIE   +P+FGIC G+QL+  A G +TYK+  GNRGHN P ++  T +  +TSQNHGY ++ E L D W  LF+NAND TNEGI++  KP F+ QFHPE   GP DTEFLFD +ME ++ K  T        + P+   ID  P   +KVL+LGSGGLSIGQAGEFDYSGSQAIKA++E  I+T+L+NPNIA+VQT+      AD  YFLP+T  +VE+V++ ERP+G+LL+ GGQTALN G++L   G+ SKY+V++LGTPI+SII TEDR+ FA+ + EIG ++APS AV S+  A++AA+++GYPVM RAAF+LGGLGSG A+N+E+L  + ++A A ++Q+++++SL GWKEVEYEVVRDA +NCITVCNMENFDPLG+HTG+SIVVAPSQTLS+ EY MLR TALKVIRHFG+VGECNIQYAL P S +Y IIE+NARLSRSSALASKATGYPLA++AAKLALG+ L DIKN+ T  T+ACFEPSLDY   KIPRWDL +F    K IGSSMKSVGEVMAIGR FEE+ QKALRM    + G    +           L + L  P++ R   I  A + G S+ ++H LT ID WFL K++RI+ L    S +  N        L  AK+ GFSDKQI   I  +E+ VR  RQ   I P VK IDT+A E+P  TNYLY +YNG EHDV F     +V+G G Y IGSSVEFDWCAV  +R LRK    T++IN+NPETVSTD+D  DRLYFEE+S E V+DIY+ EN +G I+S+GGQ+PNN+A+ L +    +LGT P  ID AE+R KFS +LD   + Q  W+ L+++  A+EF   VGYPCLVRPSY+LSG+AMNVAY+  +L  +L +A ++S+++PVVI+KFL  AKEI+ DA+A DG I+C A+SEH+ENAGVHSGDATLV PP  ++ +    I+ I+  +A   +++GPFN+Q + K  E+ VIECN+R SRS PFVSKT+  D +ATAT+ ++ + ++  D             +G+K P FS+ RL  AD  L  EM+STGEVACFG+N Y A+LKA+ S+ F++P+    + IG  +H+ +   LP+ + L   GY +YA+  T ++   H +    V W    +T D  N ++    + +++K FDLVINLP         + ++T  Y  RR A+D + PL+ + +  K+LVES+
Sbjct:    4 TDCYLALEDGTVLPGYSFGYVPSENESKVGFGGEVVFQTGMVGYTEALTDRSYSGQILVLTYPLIGNYGVPAPD-EDEHGLPLHFEWMKGVVQATALVVGEVAEEAFHWRKWKTLPDWLKQHKVPGIQDIDTRALTKKLREQGSMLGKIVYEKPPVEGLPKSSFVDPNVRNLAKECSVKERQVYGNPNGKGPRIAILDCGLKLNQLRCLLQRGASVTLLPWSARLEDEQFDALFLSNGPGNPESCDQIVQQVRKVIEEGQKPVFGICLGHQLLAKAIGCSTYKMKYGNRGHNLPCLHRATGRCLMTSQNHGYAVDLEQLPDGWSELFVNANDGTNEGIVHASKPYFSVQFHPEHHAGPQDTEFLFDVFMESIQQKDLTIPQLIEQRLRPTTPAIDSAPVMPRKVLILGSGGLSIGQAGEFDYSGSQAIKAMRESNIQTVLINPNIATVQTS---KGMADKCYFLPLTPHYVEQVIKSERPNGVLLTFGGQTALNCGVQLERAGVFSKYNVRILGTPIQSIIETEDRKLFAERVNEIGEQVAPSEAVYSVAQALDAASRLGYPVMARAAFSLGGLGSGFANNEEELQSLAQQALAHSSQLIVDKSLKGWKEVEYEVVRDAYNNCITVCNMENFDPLGIHTGESIVVAPSQTLSDREYQMLRSTALKVIRHFGVVGECNIQYALCPHSEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGLPLPDIKNSVTGNTTACFEPSLDYCVVKIPRWDLAKFVRVSKHIGSSMKSVGEVMAIGRNFEEAFQKALRMVDSDVLGFDPDVVP----LNKEQLAEQLSEPTDRRPFVIAAALQLGMSLRELHQLTNIDYWFLEKLERIILLQ---SLLTRNGSRTDAALLLKAKRFGFSDKQIAKYIKSTELAVRHQRQEFGIRPHVKQIDTVAGEWPASTNYLYHTYNGSEHDVDFPGGHTIVVGSGVYRIGSSVEFDWCAVGCLRELRKLQRPTIMINYNPETVSTDYDMCDRLYFEEISFEVVMDIYEMENSEGIILSMGGQLPNNIAMDLHRQQAKVLGTSPESIDCAENRFKFSRMLDRKGILQPRWKELTNLQSAIEFCEEVGYPCLVRPSYVLSGAAMNVAYSNQDLETYLNAASEVSREHPVVISKFLTEAKEIDVDAVASDGRILCMAVSEHVENAGVHSGDATLVTPPQDLNAETLEAIKRITCDLASVLDVTGPFNMQLIAKNNELKVIECNVRVSRSFPFVSKTLDHDFVATATRAIVGLDVEPLDVL------HGVGKVGVKVPQFSFSRLAGADVQLGVEMASTGEVACFGDNRYEAYLKAMMSTGFQIPKNAVLLSIGSFKHKME--LLPSIRDLAKMGYKLYASMGTGDFYAEHGVNVESVQWTFDKTTPDDINGELRHLAEFLANKQFDLVINLPMSGGGARRVSSFMTHGYRTRRLAVDYSIPLVTDVKCTKLLVESM 1455          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Fly
Match: r (gene:FBgn0003189 transcript:FBtr0340156)

HSP 1 Score: 1439.86 bits (3726), Expect = 0.000e+0
Identity = 749/1471 (50.92%), Postives = 997/1471 (67.78%), Query Frame = 1
Query:  169 TKARLHLNNGKVFSGYSFGYDKST-------AGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESER--IHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAKIEFDTDPIE------FKDPNKSNLTADVSTNYIQVFGR--GNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIETRNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSKSKT-------TIIPSPKTIDFEPPXXXXXXXXXXXXXXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIG-LQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWP--TSTEDFQNLDIPAATKLISDKFFDLVINLP------NYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVESL 4482
            T   L L +G V  GYSFGY  S         GE+VF TG+ GY E+LTD SY GQIL LTYP++GNYGVP  +  D +GL L+ E  +  +  + L+V + +E   HW   K+L  WL   KVP +  IDTR LTK +R+ G++L KI ++  P+E      F DPN  NL  + S    QV+G   G   +I  +DCG+K N ++ L+ RGA VTL+PW      +++D LF+SNGPG+P    + V+ ++ VIE   +P+FGIC G+QL+  A G +TYK+  GNRGHN P ++  T +  +TSQNHGY ++ E L D W  LF+NAND TNEGI++  KP F+ QFHPE   GP DTEFLFD +ME ++ K  T        + P+   ID  P   +KVL+LGSGGLSIGQAGEFDYSGSQAIKA++E  I+T+L+NPNIA+VQT+      AD  YFLP+T  +VE+V++ ERP+G+LL+ GGQTALN G++L   G+ SKY+V++LGTPI+SII TEDR+ FA+ + EIG ++APS AV S+  A++AA+++GYPVM RAAF+LGGLGSG A+N+E+L  + ++A A ++Q+++++SL GWKEVEYEVVRDA +NCITVCNMENFDPLG+HTG+SIVVAPSQTLS+ EY MLR TALKVIRHFG+VGECNIQYAL P S +Y IIE+NARLSRSSALASKATGYPLA++AAKLALG+ L DIKN+ T  T+ACFEPSLDY   KIPRWDL +F    K IGSSMKSVGEVMAIGR FEE+ QKALRM    + G    +           L + L  P++ R   I  A + G S+ ++H LT ID WFL K++RI+ L    S +  N        L  AK+ GFSDKQI   I  +E+ VR  RQ   I P VK IDT+A E+P  TNYLY +YNG EHDV F     +V+G G Y IGSSVEFDWCAV  +R LRK    T++IN+NPETVSTD+D  DRLYFEE+S E V+DIY+ EN +G I+S+GGQ+PNN+A+ L +    +LGT P  ID AE+R KFS +LD   + Q  W+ L+++  A+EF   VGYPCLVRPSY+LSG+AMNVAY+  +L  +L +A ++S+++PVVI+KFL  AKEI+ DA+A DG I+C A+SEH+ENAGVHSGDATLV PP  ++ +    I+ I+  +A   +++GPFN+Q + K  E+ VIECN+R SRS PFVSKT+  D +ATAT+ ++ + ++  D             +G+K P FS+ RL  AD  L  EM+STGEVACFG+N Y A+LKA+ S+ F++P+    + IG  +H+ +   LP+ + L   GY +YA+  T ++   H +    V W    +T D  N ++    + +++K FDLVINLP         + ++T  Y  RR A+D + PL+ + +  K+LVES+
Sbjct:    4 TDCYLALEDGTVLPGYSFGYVPSENESKVGFGGEVVFQTGMVGYTEALTDRSYSGQILVLTYPLIGNYGVPAPD-EDEHGLPLHFEWMKGVVQATALVVGEVAEEAFHWRKWKTLPDWLKQHKVPGIQDIDTRALTKKLREQGSMLGKIVYEKPPVEGLPKSSFVDPNVRNLAKECSVKERQVYGNPNGKGPRIAILDCGLKLNQLRCLLQRGASVTLLPWSARLEDEQFDALFLSNGPGNPESCDQIVQQVRKVIEEGQKPVFGICLGHQLLAKAIGCSTYKMKYGNRGHNLPCLHRATGRCLMTSQNHGYAVDLEQLPDGWSELFVNANDGTNEGIVHASKPYFSVQFHPEHHAGPQDTEFLFDVFMESIQQKDLTIPQLIEQRLRPTTPAIDSAPVMPRKVLILGSGGLSIGQAGEFDYSGSQAIKAMRESNIQTVLINPNIATVQTS---KGMADKCYFLPLTPHYVEQVIKSERPNGVLLTFGGQTALNCGVQLERAGVFSKYNVRILGTPIQSIIETEDRKLFAERVNEIGEQVAPSEAVYSVAQALDAASRLGYPVMARAAFSLGGLGSGFANNEEELQSLAQQALAHSSQLIVDKSLKGWKEVEYEVVRDAYNNCITVCNMENFDPLGIHTGESIVVAPSQTLSDREYQMLRSTALKVIRHFGVVGECNIQYALCPHSEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGLPLPDIKNSVTGNTTACFEPSLDYCVVKIPRWDLAKFVRVSKHIGSSMKSVGEVMAIGRNFEEAFQKALRMVDSDVLGFDPDVVP----LNKEQLAEQLSEPTDRRPFVIAAALQLGMSLRELHQLTNIDYWFLEKLERIILLQ---SLLTRNGSRTDAALLLKAKRFGFSDKQIAKYIKSTELAVRHQRQEFGIRPHVKQIDTVAGEWPASTNYLYHTYNGSEHDVDFPGGHTIVVGSGVYRIGSSVEFDWCAVGCLRELRKLQRPTIMINYNPETVSTDYDMCDRLYFEEISFEVVMDIYEMENSEGIILSMGGQLPNNIAMDLHRQQAKVLGTSPESIDCAENRFKFSRMLDRKGILQPRWKELTNLQSAIEFCEEVGYPCLVRPSYVLSGAAMNVAYSNQDLETYLNAASEVSREHPVVISKFLTEAKEIDVDAVASDGRILCMAVSEHVENAGVHSGDATLVTPPQDLNAETLEAIKRITCDLASVLDVTGPFNMQLIAKNNELKVIECNVRVSRSFPFVSKTLDHDFVATATRAIVGLDVEPLDVL------HGVGKVGVKVPQFSFSRLAGADVQLGVEMASTGEVACFGDNRYEAYLKAMMSTGFQIPKNAVLLSIGSFKHKME--LLPSIRDLAKMGYKLYASMGTGDFYAEHGVNVESVQWTFDKTTPDDINGELRHLAEFLANKQFDLVINLPMSGGGARRVSSFMTHGYRTRRLAVDYSIPLVTDVKCTKLLVESM 1455          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Fly
Match: r (gene:FBgn0003189 transcript:FBtr0340155)

HSP 1 Score: 1439.86 bits (3726), Expect = 0.000e+0
Identity = 749/1471 (50.92%), Postives = 997/1471 (67.78%), Query Frame = 1
Query:  169 TKARLHLNNGKVFSGYSFGYDKST-------AGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESER--IHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAKIEFDTDPIE------FKDPNKSNLTADVSTNYIQVFGR--GNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIETRNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSKSKT-------TIIPSPKTIDFEPPXXXXXXXXXXXXXXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIG-LQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWP--TSTEDFQNLDIPAATKLISDKFFDLVINLP------NYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVESL 4482
            T   L L +G V  GYSFGY  S         GE+VF TG+ GY E+LTD SY GQIL LTYP++GNYGVP  +  D +GL L+ E  +  +  + L+V + +E   HW   K+L  WL   KVP +  IDTR LTK +R+ G++L KI ++  P+E      F DPN  NL  + S    QV+G   G   +I  +DCG+K N ++ L+ RGA VTL+PW      +++D LF+SNGPG+P    + V+ ++ VIE   +P+FGIC G+QL+  A G +TYK+  GNRGHN P ++  T +  +TSQNHGY ++ E L D W  LF+NAND TNEGI++  KP F+ QFHPE   GP DTEFLFD +ME ++ K  T        + P+   ID  P   +KVL+LGSGGLSIGQAGEFDYSGSQAIKA++E  I+T+L+NPNIA+VQT+      AD  YFLP+T  +VE+V++ ERP+G+LL+ GGQTALN G++L   G+ SKY+V++LGTPI+SII TEDR+ FA+ + EIG ++APS AV S+  A++AA+++GYPVM RAAF+LGGLGSG A+N+E+L  + ++A A ++Q+++++SL GWKEVEYEVVRDA +NCITVCNMENFDPLG+HTG+SIVVAPSQTLS+ EY MLR TALKVIRHFG+VGECNIQYAL P S +Y IIE+NARLSRSSALASKATGYPLA++AAKLALG+ L DIKN+ T  T+ACFEPSLDY   KIPRWDL +F    K IGSSMKSVGEVMAIGR FEE+ QKALRM    + G    +           L + L  P++ R   I  A + G S+ ++H LT ID WFL K++RI+ L    S +  N        L  AK+ GFSDKQI   I  +E+ VR  RQ   I P VK IDT+A E+P  TNYLY +YNG EHDV F     +V+G G Y IGSSVEFDWCAV  +R LRK    T++IN+NPETVSTD+D  DRLYFEE+S E V+DIY+ EN +G I+S+GGQ+PNN+A+ L +    +LGT P  ID AE+R KFS +LD   + Q  W+ L+++  A+EF   VGYPCLVRPSY+LSG+AMNVAY+  +L  +L +A ++S+++PVVI+KFL  AKEI+ DA+A DG I+C A+SEH+ENAGVHSGDATLV PP  ++ +    I+ I+  +A   +++GPFN+Q + K  E+ VIECN+R SRS PFVSKT+  D +ATAT+ ++ + ++  D             +G+K P FS+ RL  AD  L  EM+STGEVACFG+N Y A+LKA+ S+ F++P+    + IG  +H+ +   LP+ + L   GY +YA+  T ++   H +    V W    +T D  N ++    + +++K FDLVINLP         + ++T  Y  RR A+D + PL+ + +  K+LVES+
Sbjct:    4 TDCYLALEDGTVLPGYSFGYVPSENESKVGFGGEVVFQTGMVGYTEALTDRSYSGQILVLTYPLIGNYGVPAPD-EDEHGLPLHFEWMKGVVQATALVVGEVAEEAFHWRKWKTLPDWLKQHKVPGIQDIDTRALTKKLREQGSMLGKIVYEKPPVEGLPKSSFVDPNVRNLAKECSVKERQVYGNPNGKGPRIAILDCGLKLNQLRCLLQRGASVTLLPWSARLEDEQFDALFLSNGPGNPESCDQIVQQVRKVIEEGQKPVFGICLGHQLLAKAIGCSTYKMKYGNRGHNLPCLHRATGRCLMTSQNHGYAVDLEQLPDGWSELFVNANDGTNEGIVHASKPYFSVQFHPEHHAGPQDTEFLFDVFMESIQQKDLTIPQLIEQRLRPTTPAIDSAPVMPRKVLILGSGGLSIGQAGEFDYSGSQAIKAMRESNIQTVLINPNIATVQTS---KGMADKCYFLPLTPHYVEQVIKSERPNGVLLTFGGQTALNCGVQLERAGVFSKYNVRILGTPIQSIIETEDRKLFAERVNEIGEQVAPSEAVYSVAQALDAASRLGYPVMARAAFSLGGLGSGFANNEEELQSLAQQALAHSSQLIVDKSLKGWKEVEYEVVRDAYNNCITVCNMENFDPLGIHTGESIVVAPSQTLSDREYQMLRSTALKVIRHFGVVGECNIQYALCPHSEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGLPLPDIKNSVTGNTTACFEPSLDYCVVKIPRWDLAKFVRVSKHIGSSMKSVGEVMAIGRNFEEAFQKALRMVDSDVLGFDPDVVP----LNKEQLAEQLSEPTDRRPFVIAAALQLGMSLRELHQLTNIDYWFLEKLERIILLQ---SLLTRNGSRTDAALLLKAKRFGFSDKQIAKYIKSTELAVRHQRQEFGIRPHVKQIDTVAGEWPASTNYLYHTYNGSEHDVDFPGGHTIVVGSGVYRIGSSVEFDWCAVGCLRELRKLQRPTIMINYNPETVSTDYDMCDRLYFEEISFEVVMDIYEMENSEGIILSMGGQLPNNIAMDLHRQQAKVLGTSPESIDCAENRFKFSRMLDRKGILQPRWKELTNLQSAIEFCEEVGYPCLVRPSYVLSGAAMNVAYSNQDLETYLNAASEVSREHPVVISKFLTEAKEIDVDAVASDGRILCMAVSEHVENAGVHSGDATLVTPPQDLNAETLEAIKRITCDLASVLDVTGPFNMQLIAKNNELKVIECNVRVSRSFPFVSKTLDHDFVATATRAIVGLDVEPLDVL------HGVGKVGVKVPQFSFSRLAGADVQLGVEMASTGEVACFGDNRYEAYLKAMMSTGFQIPKNAVLLSIGSFKHKME--LLPSIRDLAKMGYKLYASMGTGDFYAEHGVNVESVQWTFDKTTPDDINGELRHLAEFLANKQFDLVINLPMSGGGARRVSSFMTHGYRTRRLAVDYSIPLVTDVKCTKLLVESM 1455          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Zebrafish
Match: cps1 (carbamoyl-phosphate synthase 1, mitochondrial [Source:ZFIN;Acc:ZDB-GENE-081105-17])

HSP 1 Score: 1936 bits (5014), Expect = 0.000e+0
Identity = 924/1455 (63.51%), Postives = 1153/1455 (79.24%), Query Frame = 1
Query:  175 ARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAKIEFDTDPIEFKDPNKSNLTADVSTNYIQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIET-RNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSKSKTTIIPSPKTIDFEPPXXXXXXXXXXXX--XXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTSTEDFQNLDIPAATKLISDKFFDLVINLPNYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVESLDHVDLVTTDSLFNYQA 4530
            A L L +G    GYSFG+D+S AGELVFNTGL GYPE+LTDPSYRGQILTLTYPIVGNYGVP+T   D  GL  NVES+RI VSGL+VQDYS   SHWNSVKSL+QWL +EKVPALFGIDTRMLTKI+RD G VL KIEFD  P+E  DPN+ NL ++VST  IQVFG+GNP K+V VDCGIKHN+I++L+ RGAEV LVPWD D    +YDGLFISNGPGDP+L    ++N++ V+E+ R +P+FGIC GNQ+  LAAGA +YKLP+GNRG NQPV+NV+T QAFIT+QNHGYG+++ESL   W  LFINAND TNEGIM+  KP+FTAQFHPEA GGPTDTEFLFDA++ +++   + +I          PP+++   VL  G   LSIGQAGEFDYSGSQA+KA++EE ++T+L+NPNIASVQTN  G KQAD VYFLPVT EFV +V+  ERPDGILLSMGGQTALN G+EL + G+L KY VKVLGTP++SI+ATEDRQ F+D L EI  K+APS AV ++ DA++AA++IGYPVM+R+A+ALGGLGSG+  NKE+L D   +A AM++Q+L+E+SLLGWKEVEYEVVRD ADNC+TVCNMENFDPLG+HTGDSIVVAPSQTLSN EYHMLRETA+KV+RH GIVGECNIQYALHP SLEYCIIE+NARLSRSSALASKATGYPLAF+AAKLALGI L +IKNA ++ T+ACFEPSLDYI TKIPRWDLDRFH   +EIGS+MKSVGEVMA+GR+FEES+QKALRM HPS++G   +L   K ++E  DL + L  PS++RI  +  A   G +V++IH LT ID WFLHK+K I ++   + +      ++  + L  AK  GFSD+Q+G  +  SE E R +R +  I PWVK IDT+AAEYP  TNYLYC+Y+G EHD+ F   G MV+GCGPYHIGSSVEFDWCAVS+IRALR+ G++TVV+NHNPETVSTDFDE DRLYFEEL+LER+LDI Q E   G I+SVGGQIPNNLA+PL  N V ILGT+P +ID AE+RS FS+ILD++ V QA WR+LSS++DA+ FAS VGYPCL+RPSY+LSGSAMNV Y  +E+  FL+ A Q+SQD+PVVITKF+ GA+E+E DA+A+ G ++ HA++EH+E+AGVHSGDATL+LP  TIS+    +++  + KIAK FEISGPFN QFLVK  +++VIECNLRASRS PFVSKTIG D I  AT+VM+   +DE    +++NP  P +++GIK+PMFSWPRL +ADPVLRCEM+STGEVACFG N+Y+AFLKA+ S+ F+LP+K   ILIG+QH F+P FL TA  LH+ G+ +YATE T+ +L  + +P   V+WP+   +  +L  P+ ++LIS+   DLV+NLPN  +K++ +N+ IRR A+D   PL+ NF++VK+  E++ +   +   SLF+Y++
Sbjct:   35 AHLVLEDGTKMKGYSFGHDQSAAGELVFNTGLVGYPEALTDPSYRGQILTLTYPIVGNYGVPNTQELDELGLKKNVESDRIQVSGLLVQDYSAEYSHWNSVKSLAQWLQEEKVPALFGIDTRMLTKIIRDKGTVLGKIEFDGQPVEITDPNQRNLVSEVSTKDIQVFGKGNPVKVVAVDCGIKHNIIRLLVKRGAEVHLVPWDQDLMSLEYDGLFISNGPGDPSLAKTLIQNVRKVLESDRPQPVFGICMGNQITALAAGAQSYKLPMGNRGQNQPVVNVMTGQAFITAQNHGYGIDSESLPPGWSPLFINANDGTNEGIMHNTKPVFTAQFHPEAKGGPTDTEFLFDAFISLIRKGREGSIASVMPKKPAVPPRIQVSKVLVLGSGGLSIGQAGEFDYSGSQAVKAMREENLQTVLINPNIASVQTNEVGTKQADSVYFLPVTPEFVTQVISVERPDGILLSMGGQTALNCGVELFQSGVLEKYGVKVLGTPVESIMATEDRQLFSDKLMEINEKIAPSFAVKTVADALKAADEIGYPVMLRSAYALGGLGSGLCANKEKLEDTAHKALAMSSQILVEKSLLGWKEVEYEVVRDIADNCVTVCNMENFDPLGIHTGDSIVVAPSQTLSNEEYHMLRETAIKVVRHLGIVGECNIQYALHPSSLEYCIIEVNARLSRSSALASKATGYPLAFVAAKLALGIPLPEIKNAVSEQTTACFEPSLDYIVTKIPRWDLDRFHGMSREIGSAMKSVGEVMAVGRSFEESIQKALRMCHPSVDGFVPRLPLKKAWAEQQDLQRELSMPSSTRIFSLAQALHSGVTVDQIHDLTAIDKWFLHKLKHITEMEQRLGQYKS--ATVPRDLLLKAKMDGFSDRQVGQAMDISEGEARVLRLNQNIRPWVKQIDTLAAEYPAATNYLYCTYHGQEHDLDFKDHGTMVVGCGPYHIGSSVEFDWCAVSSIRALRQMGKRTVVVNHNPETVSTDFDECDRLYFEELTLERILDITQQEGCTGCIVSVGGQIPNNLAMPLHLNGVKILGTNPAQIDRAEERSVFSSILDDLGVGQAPWRALSSLEDAVSFASNVGYPCLLRPSYVLSGSAMNVVYGEDEMKRFLEEATQVSQDHPVVITKFIRGAREVEVDAVARMGKVLAHAITEHVEDAGVHSGDATLMLPTQTISQGALEKVKTATQKIAKAFEISGPFNTQFLVKGNDVMVIECNLRASRSFPFVSKTIGVDFIDVATRVMVGERMDESRLPSLENPIIPVDFVGIKAPMFSWPRLREADPVLRCEMASTGEVACFGPNIYSAFLKAMLSTGFKLPQK--GILIGIQHSFRPNFLSTAHQLHEEGFKLYATEGTSAWLNANDVPTIPVAWPSVETNTTHL--PSISRLISEGHIDLVVNLPNNNSKFLKDNFQIRRMAVDYGVPLITNFQVVKLFAEAIRYSSELDATSLFHYRS 1483          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Zebrafish
Match: cps1 (carbamoyl-phosphate synthase 1, mitochondrial [Source:ZFIN;Acc:ZDB-GENE-081105-17])

HSP 1 Score: 1934.46 bits (5010), Expect = 0.000e+0
Identity = 925/1457 (63.49%), Postives = 1155/1457 (79.27%), Query Frame = 1
Query:  175 ARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAKIEFDTDPIEFKDPNKSNLTADVSTNYIQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIET-RNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSK---SKTTIIPSPKTIDFEPPXXXXXXXXXXXX--XXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTSTEDFQNLDIPAATKLISDKFFDLVINLPNYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVESLDHVDLVTTDSLFNYQ 4527
            A L L +G    GYSFG+D+S AGELVFNTGL GYPE+LTDPSYRGQILTLTYPIVGNYGVP+T   D  GL  NVES+RI VSGL+VQDYS   SHWNSVKSL+QWL +EKVPALFGIDTRMLTKI+RD G VL KIEFD  P+E  DPN+ NL ++VST  IQVFG+GNP K+V VDCGIKHN+I++L+ RGAEV LVPWD D    +YDGLFISNGPGDP+L    ++N++ V+E+ R +P+FGIC GNQ+  LAAGA +YKLP+GNRG NQPV+NV+T QAFIT+QNHGYG+++ESL   W  LFINAND TNEGIM+  KP+FTAQFHPEA GGPTDTEFLFDA++ +++     S  +++P    +   PP+++   VL  G   LSIGQAGEFDYSGSQA+KA++EE ++T+L+NPNIASVQTN  G KQAD VYFLPVT EFV +V+  ERPDGILLSMGGQTALN G+EL + G+L KY VKVLGTP++SI+ATEDRQ F+D L EI  K+APS AV ++ DA++AA++IGYPVM+R+A+ALGGLGSG+  NKE+L D   +A AM++Q+L+E+SLLGWKEVEYEVVRD ADNC+TVCNMENFDPLG+HTGDSIVVAPSQTLSN EYHMLRETA+KV+RH GIVGECNIQYALHP SLEYCIIE+NARLSRSSALASKATGYPLAF+AAKLALGI L +IKNA ++ T+ACFEPSLDYI TKIPRWDLDRFH   +EIGS+MKSVGEVMA+GR+FEES+QKALRM HPS++G   +L   K ++E  DL + L  PS++RI  +  A   G +V++IH LT ID WFLHK+K I ++   + +      ++  + L  AK  GFSD+Q+G  +  SE E R +R +  I PWVK IDT+AAEYP  TNYLYC+Y+G EHD+ F   G MV+GCGPYHIGSSVEFDWCAVS+IRALR+ G++TVV+NHNPETVSTDFDE DRLYFEEL+LER+LDI Q E   G I+SVGGQIPNNLA+PL  N V ILGT+P +ID AE+RS FS+ILD++ V QA WR+LSS++DA+ FAS VGYPCL+RPSY+LSGSAMNV Y  +E+  FL+ A Q+SQD+PVVITKF+ GA+E+E DA+A+ G ++ HA++EH+E+AGVHSGDATL+LP  TIS+    +++  + KIAK FEISGPFN QFLVK  +++VIECNLRASRS PFVSKTIG D I  AT+VM+   +DE    +++NP  P +++GIK+PMFSWPRL +ADPVLRCEM+STGEVACFG N+Y+AFLKA+ S+ F+LP+K   ILIG+QH F+P FL TA  LH+ G+ +YATE T+ +L  + +P   V+WP+   +  +L  P+ ++LIS+   DLV+NLPN  +K++ +N+ IRR A+D   PL+ NF++VK+  E++ +   +   SLF+Y+
Sbjct:   35 AHLVLEDGTKMKGYSFGHDQSAAGELVFNTGLVGYPEALTDPSYRGQILTLTYPIVGNYGVPNTQELDELGLKKNVESDRIQVSGLLVQDYSAEYSHWNSVKSLAQWLQEEKVPALFGIDTRMLTKIIRDKGTVLGKIEFDGQPVEITDPNQRNLVSEVSTKDIQVFGKGNPVKVVAVDCGIKHNIIRLLVKRGAEVHLVPWDQDLMSLEYDGLFISNGPGDPSLAKTLIQNVRKVLESDRPQPVFGICMGNQITALAAGAQSYKLPMGNRGQNQPVVNVMTGQAFITAQNHGYGIDSESLPPGWSPLFINANDGTNEGIMHNTKPVFTAQFHPEAKGGPTDTEFLFDAFISLIRKGREGSIASVMPKKPAV---PPRIQVSKVLVLGSGGLSIGQAGEFDYSGSQAVKAMREENLQTVLINPNIASVQTNEVGTKQADSVYFLPVTPEFVTQVISVERPDGILLSMGGQTALNCGVELFQSGVLEKYGVKVLGTPVESIMATEDRQLFSDKLMEINEKIAPSFAVKTVADALKAADEIGYPVMLRSAYALGGLGSGLCANKEKLEDTAHKALAMSSQILVEKSLLGWKEVEYEVVRDIADNCVTVCNMENFDPLGIHTGDSIVVAPSQTLSNEEYHMLRETAIKVVRHLGIVGECNIQYALHPSSLEYCIIEVNARLSRSSALASKATGYPLAFVAAKLALGIPLPEIKNAVSEQTTACFEPSLDYIVTKIPRWDLDRFHGMSREIGSAMKSVGEVMAVGRSFEESIQKALRMCHPSVDGFVPRLPLKKAWAEQQDLQRELSMPSSTRIFSLAQALHSGVTVDQIHDLTAIDKWFLHKLKHITEMEQRLGQYKS--ATVPRDLLLKAKMDGFSDRQVGQAMDISEGEARVLRLNQNIRPWVKQIDTLAAEYPAATNYLYCTYHGQEHDLDFKDHGTMVVGCGPYHIGSSVEFDWCAVSSIRALRQMGKRTVVVNHNPETVSTDFDECDRLYFEELTLERILDITQQEGCTGCIVSVGGQIPNNLAMPLHLNGVKILGTNPAQIDRAEERSVFSSILDDLGVGQAPWRALSSLEDAVSFASNVGYPCLLRPSYVLSGSAMNVVYGEDEMKRFLEEATQVSQDHPVVITKFIRGAREVEVDAVARMGKVLAHAITEHVEDAGVHSGDATLMLPTQTISQGALEKVKTATQKIAKAFEISGPFNTQFLVKGNDVMVIECNLRASRSFPFVSKTIGVDFIDVATRVMVGERMDESRLPSLENPIIPVDFVGIKAPMFSWPRLREADPVLRCEMASTGEVACFGPNIYSAFLKAMLSTGFKLPQK--GILIGIQHSFRPNFLSTAHQLHEEGFKLYATEGTSAWLNANDVPTIPVAWPSVETNTTHL--PSISRLISEGHIDLVVNLPNNNSKFLKDNFQIRRMAVDYGVPLITNFQVVKLFAEAIRYSSELDATSLFHYR 1482          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Zebrafish
Match: cps1 (carbamoyl-phosphate synthase 1, mitochondrial [Source:ZFIN;Acc:ZDB-GENE-081105-17])

HSP 1 Score: 1930.22 bits (4999), Expect = 0.000e+0
Identity = 928/1471 (63.09%), Postives = 1159/1471 (78.79%), Query Frame = 1
Query:  130 SISAFLSKRINMPTKARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAKIEFDTDPIEFKDPNKSNLTADVSTNYIQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIET-RNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNE--GIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSKSKTTIIPSPKTIDFEPPXXXXXXXXXXXX--XXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTSTEDFQNLDIPAATKLISDKFFDLVINLPNYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVESLDHVDLVTTDSLFNYQ 4527
            S +  LS ++   T A L L +G    GYSFG+D+S AGELVFNTGL GYPE+LTDPSYRGQILTLTYPIVGNYGVP+T   D  GL  NVES+RI VSGL+VQDYS   SHWNSVKSL+QWL +EKVPALFGIDTRMLTKI+RD G VL KIEFD  P+E  DPN+ NL ++VST  IQVFG+GNP K+V VDCGIKHN+I++L+ RGAEV LVPWD D    +YDGLFISNGPGDP+L    ++N++ V+E+ R +P+FGIC GNQ+  LAAGA +YKLP+GNRG NQPV+NV+T QAFIT+QNHGYG+++ESL   W  LFINAND TNE  GIM+  KP+FTAQFHPEA GGPTDTEFLFDA++ +++   + +I          PP+++   VL  G   LSIGQAGEFDYSGSQA+KA++EE ++T+L+NPNIASVQTN  G KQAD VYFLPVT EFV +V+  ERPDGILLSMGGQTALN G+EL + G+L KY VKVLGTP++SI+ATEDRQ F+D L EI  K+APS AV ++ DA++AA++IGYPVM+R+A+ALGGLGSG+  NKE+L D   +A AM++Q+L+E+SLLGWKEVEYEVVRD ADNC+TVCNMENFDPLG+HTGDSIVVAPSQTLSN EYHMLRETA+KV+RH GIVGECNIQYALHP SLEYCIIE+NARLSRSSALASKATGYPLAF+AAKLALGI L +IKNA ++ T+ACFEPSLDYI TKIPRWDLDRFH   +EIGS+MKSVGEVMA+GR+FEES+QKALRM HPS++G   +L   K ++E  DL + L  PS++RI  +  A   G +V++IH LT ID WFLHK+K I ++   + +      ++  + L  AK  GFSD+Q+G  +  SE E R +R +  I PWVK IDT+AAEYP  TNYLYC+Y+G EHD+ F   G MV+GCGPYHIGSSVEFDWCAVS+IRALR+ G++TVV+NHNPETVSTDFDE DRLYFEEL+LER+LDI Q E   G I+SVGGQIPNNLA+PL  N V ILGT+P +ID AE+RS FS+ILD++ V QA WR+LSS++DA+ FAS VGYPCL+RPSY+LSGSAMNV Y  +E+  FL+ A Q+SQD+PVVITKF+ GA+E+E DA+A+ G ++ HA++EH+E+AGVHSGDATL+LP  TIS+    +++  + KIAK FEISGPFN QFLVK  +++VIECNLRASRS PFVSKTIG D I  AT+VM+   +DE    +++NP  P +++GIK+PMFSWPRL +ADPVLRCEM+STGEVACFG N+Y+AFLKA+ S+ F+LP+K   ILIG+QH F+P FL TA  LH+ G+ +YATE T+ +L  + +P   V+WP+   +  +L  P+ ++LIS+   DLV+NLPN  +K++ +N+ IRR A+D   PL+ NF++VK+  E++ +   +   SLF+Y+
Sbjct:   23 SSTRLLSLKVCAQT-AHLVLEDGTKMKGYSFGHDQSAAGELVFNTGLVGYPEALTDPSYRGQILTLTYPIVGNYGVPNTQELDELGLKKNVESDRIQVSGLLVQDYSAEYSHWNSVKSLAQWLQEEKVPALFGIDTRMLTKIIRDKGTVLGKIEFDGQPVEITDPNQRNLVSEVSTKDIQVFGKGNPVKVVAVDCGIKHNIIRLLVKRGAEVHLVPWDQDLMSLEYDGLFISNGPGDPSLAKTLIQNVRKVLESDRPQPVFGICMGNQITALAAGAQSYKLPMGNRGQNQPVVNVMTGQAFITAQNHGYGIDSESLPPGWSPLFINANDGTNEVWGIMHNTKPVFTAQFHPEAKGGPTDTEFLFDAFISLIRKGREGSIASVMPKKPAVPPRIQVSKVLVLGSGGLSIGQAGEFDYSGSQAVKAMREENLQTVLINPNIASVQTNEVGTKQADSVYFLPVTPEFVTQVISVERPDGILLSMGGQTALNCGVELFQSGVLEKYGVKVLGTPVESIMATEDRQLFSDKLMEINEKIAPSFAVKTVADALKAADEIGYPVMLRSAYALGGLGSGLCANKEKLEDTAHKALAMSSQILVEKSLLGWKEVEYEVVRDIADNCVTVCNMENFDPLGIHTGDSIVVAPSQTLSNEEYHMLRETAIKVVRHLGIVGECNIQYALHPSSLEYCIIEVNARLSRSSALASKATGYPLAFVAAKLALGIPLPEIKNAVSEQTTACFEPSLDYIVTKIPRWDLDRFHGMSREIGSAMKSVGEVMAVGRSFEESIQKALRMCHPSVDGFVPRLPLKKAWAEQQDLQRELSMPSSTRIFSLAQALHSGVTVDQIHDLTAIDKWFLHKLKHITEMEQRLGQYKS--ATVPRDLLLKAKMDGFSDRQVGQAMDISEGEARVLRLNQNIRPWVKQIDTLAAEYPAATNYLYCTYHGQEHDLDFKDHGTMVVGCGPYHIGSSVEFDWCAVSSIRALRQMGKRTVVVNHNPETVSTDFDECDRLYFEELTLERILDITQQEGCTGCIVSVGGQIPNNLAMPLHLNGVKILGTNPAQIDRAEERSVFSSILDDLGVGQAPWRALSSLEDAVSFASNVGYPCLLRPSYVLSGSAMNVVYGEDEMKRFLEEATQVSQDHPVVITKFIRGAREVEVDAVARMGKVLAHAITEHVEDAGVHSGDATLMLPTQTISQGALEKVKTATQKIAKAFEISGPFNTQFLVKGNDVMVIECNLRASRSFPFVSKTIGVDFIDVATRVMVGERMDESRLPSLENPIIPVDFVGIKAPMFSWPRLREADPVLRCEMASTGEVACFGPNIYSAFLKAMLSTGFKLPQK--GILIGIQHSFRPNFLSTAHQLHEEGFKLYATEGTSAWLNANDVPTIPVAWPSVETNTTHL--PSISRLISEGHIDLVVNLPNNNSKFLKDNFQIRRMAVDYGVPLITNFQVVKLFAEAIRYSSELDATSLFHYR 1486          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Zebrafish
Match: cps1 (carbamoyl-phosphate synthase 1, mitochondrial [Source:ZFIN;Acc:ZDB-GENE-081105-17])

HSP 1 Score: 1883.61 bits (4878), Expect = 0.000e+0
Identity = 903/1430 (63.15%), Postives = 1130/1430 (79.02%), Query Frame = 1
Query:  277 YPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAKIEFDTDPIEFKDPNKSNLTADVSTNYIQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIET-RNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSK---SKTTIIPSPKTIDFEPPXXXXXXXXXXXX--XXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTSTEDFQNLDIPAATKLISDKFFDLVINLPNYKTKYVTENYLIRRAAIDSATPLMINF-------ELVKMLVESLDHVDLVTTDSLFNYQ 4527
            YPE+LTDPSYRGQILTLTYPIVGNYGVP+T   D  GL  NVES+RI VSGL+VQDYS   SHWNSVKSL+QWL +EKVPALFGIDTRMLTKI+RD G VL KIEFD  P+E  DPN+ NL ++VST  IQVFG+GNP K+V VDCGIKHN+I++L+ RGAEV LVPWD D    +YDGLFISNGPGDP+L    ++N++ V+E+ R +P+FGIC GNQ+  LAAGA +YKLP+GNRG NQPV+NV+T QAFIT+QNHGYG+++ESL   W  LFINAND TNEGIM+  KP+FTAQFHPEA GGPTDTEFLFDA++ +++     S  +++P    +   PP+++   VL  G   LSIGQAGEFDYSGSQA+KA++EE ++T+L+NPNIASVQTN  G KQAD VYFLPVT EFV +V+  ERPDGILLSMGGQTALN G+EL + G+L KY VKVLGTP++SI+ATEDRQ F+D L EI  K+APS AV ++ DA++AA++IGYPVM+R+A+ALGGLGSG+  NKE+L D   +A AM++Q+L+E+SLLGWKEVEYEVVRD ADNC+TVCNMENFDPLG+HTGDSIVVAPSQTLSN EYHMLRETA+KV+RH GIVGECNIQYALHP SLEYCIIE+NARLSRSSALASKATGYPLAF+AAKLALGI L +IKNA ++ T+ACFEPSLDYI TKIPRWDLDRFH   +EIGS+MKSVGEVMA+GR+FEES+QKALRM HPS++G   +L   K ++E  DL + L  PS++RI  +  A   G +V++IH LT ID WFLHK+K I ++   + +      ++  + L  AK  GFSD+Q+G  +  SE E R +R +  I PWVK IDT+AAEYP  TNYLYC+Y+G EHD+ F   G MV+GCGPYHIGSSVEFDWCAVS+IRALR+ G++TVV+NHNPETVSTDFDE DRLYFEEL+LER+LDI Q E   G I+SVGGQIPNNLA+PL  N V ILGT+P +ID AE+RS FS+ILD++ V QA WR+LSS++DA+ FAS VGYPCL+RPSY+LSGSAMNV Y  +E+  FL+ A Q+SQD+PVVITKF+ GA+E+E DA+A+ G ++ HA++EH+E+AGVHSGDATL+LP  TIS+    +++  + KIAK FEISGPFN QFLVK  +++VIECNLRASRS PFVSKTIG D I  AT+VM+   +DE    +++NP  P +++GIK+PMFSWPRL +ADPVLRCEM+STGEVACFG N+Y+AFLKA+ S+ F+LP+K   ILIG+QH F+P FL TA  LH+ G+ +YATE T+ +L  + +P   V+WP+   +  +L  P+ ++LIS+   DLV+NLPN  +K++ +N+ IRR A+D   PL+ NF       ++VK+  E++ +   +   SLF+Y+
Sbjct:   55 YPEALTDPSYRGQILTLTYPIVGNYGVPNTQELDELGLKKNVESDRIQVSGLLVQDYSAEYSHWNSVKSLAQWLQEEKVPALFGIDTRMLTKIIRDKGTVLGKIEFDGQPVEITDPNQRNLVSEVSTKDIQVFGKGNPVKVVAVDCGIKHNIIRLLVKRGAEVHLVPWDQDLMSLEYDGLFISNGPGDPSLAKTLIQNVRKVLESDRPQPVFGICMGNQITALAAGAQSYKLPMGNRGQNQPVVNVMTGQAFITAQNHGYGIDSESLPPGWSPLFINANDGTNEGIMHNTKPVFTAQFHPEAKGGPTDTEFLFDAFISLIRKGREGSIASVMPKKPAV---PPRIQVSKVLVLGSGGLSIGQAGEFDYSGSQAVKAMREENLQTVLINPNIASVQTNEVGTKQADSVYFLPVTPEFVTQVISVERPDGILLSMGGQTALNCGVELFQSGVLEKYGVKVLGTPVESIMATEDRQLFSDKLMEINEKIAPSFAVKTVADALKAADEIGYPVMLRSAYALGGLGSGLCANKEKLEDTAHKALAMSSQILVEKSLLGWKEVEYEVVRDIADNCVTVCNMENFDPLGIHTGDSIVVAPSQTLSNEEYHMLRETAIKVVRHLGIVGECNIQYALHPSSLEYCIIEVNARLSRSSALASKATGYPLAFVAAKLALGIPLPEIKNAVSEQTTACFEPSLDYIVTKIPRWDLDRFHGMSREIGSAMKSVGEVMAVGRSFEESIQKALRMCHPSVDGFVPRLPLKKAWAEQQDLQRELSMPSSTRIFSLAQALHSGVTVDQIHDLTAIDKWFLHKLKHITEMEQRLGQYKS--ATVPRDLLLKAKMDGFSDRQVGQAMDISEGEARVLRLNQNIRPWVKQIDTLAAEYPAATNYLYCTYHGQEHDLDFKDHGTMVVGCGPYHIGSSVEFDWCAVSSIRALRQMGKRTVVVNHNPETVSTDFDECDRLYFEELTLERILDITQQEGCTGCIVSVGGQIPNNLAMPLHLNGVKILGTNPAQIDRAEERSVFSSILDDLGVGQAPWRALSSLEDAVSFASNVGYPCLLRPSYVLSGSAMNVVYGEDEMKRFLEEATQVSQDHPVVITKFIRGAREVEVDAVARMGKVLAHAITEHVEDAGVHSGDATLMLPTQTISQGALEKVKTATQKIAKAFEISGPFNTQFLVKGNDVMVIECNLRASRSFPFVSKTIGVDFIDVATRVMVGERMDESRLPSLENPIIPVDFVGIKAPMFSWPRLREADPVLRCEMASTGEVACFGPNIYSAFLKAMLSTGFKLPQK--GILIGIQHSFRPNFLSTAHQLHEEGFKLYATEGTSAWLNANDVPTIPVAWPSVETNTTHL--PSISRLISEGHIDLVVNLPNNNSKFLKDNFQIRRMAVDYGVPLITNFQVFFSFLQVVKLFAEAIRYSSELDATSLFHYR 1475          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Zebrafish
Match: cad (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:ZFIN;Acc:ZDB-GENE-021030-4])

HSP 1 Score: 1482.23 bits (3836), Expect = 0.000e+0
Identity = 757/1489 (50.84%), Postives = 1019/1489 (68.44%), Query Frame = 1
Query:  175 ARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAKIEFDTDP---IEFKDPNKSNLTADVSTNYIQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIETRN-EPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSKSKT--------------TIIPSPKTIDFEPPXXXXXXXXXXXXXXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTSTEDFQNLDIPAATK------LISDKFFDLVINLP------NYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVESLD----------HVDLVTTDSLFN 4521
            A L L +G  F G  FG   S +GE+VF TG+ GYPE+LTDPSY+ QILTLTYP++GNYG+P  +     GL    ES +IH + LIV + SE  SHW++ KSL +WL ++ +P L G+DTR LTK +R+ G +L K+  +  P   I F +P+  NL  +VS    +VF      +I  +DCGIK+N I+ L  RGA VT+VPWD     + +DGLFISNGPG+P    ETV+NI+ V    N +P+FGIC G+QL+ L  GA TYK+  GNRGHNQP I+  T++ +ITSQNHG+ ++ E+L  DW VLF NAND+T+EGI++  KP+F+ QFHPE   GPTD   LFD +++ V+   +               T   SP    F  P+   VL  G     IGQAGEFDYSGSQAIKA+KEE I+TIL+NPNIA+VQT+      AD VYFLP+T E+V +V++ ERPDG+LL+ GGQTALN G+EL ++G+L KY V+VLGTP+ SI  TEDR+ F + ++EI   +APS A +S+E A+ AA ++GYPV+VR+AFALGGLGSG A+N+++++ +  +AFA T+QVL+++SL GWKE+EYEVVRDA DNC+TVCNMEN DPLG+HTG+SIVVAPSQTL++YEY+MLR TA+KVIRH G+VGECNIQYAL+PES +Y IIE+NARLSRSSALASKATGYPLA++AAKL+LGI L  +KN+ T  T+A FEPSLDY   K+PRWDL +F     +IGSSMKSVGEVMAIGR+FEE+ QKALRM   +  G         D++   + ++ L TP++ RI  +  A   GY+VE+++ LTKID WFLHK+K I D    +     +  ++  E +  AKQ GFSDKQI   +  +E+ VR++R+  KI P VK IDT+AAE+P  TNYLY +Y+G E DV F++  VMV+G G Y IGSSVEFDWCAV  I  LRK G +T+++N+NPETVSTD+D  DRLYF+E+S E V+DIY+ ENP+G I+S+GGQ+PNN+A+ L +    ILGT P  ID+AE+R KFS +LD I + Q  W+ LS  + A+ F   VGYPCLVRPSY+LSG+AMNVAY+  ++  FL SA  +S+++PVVI+KF++ AKEI+ DA+A DG ++  A+SEH+ENAGVHSGDATLV PP  I++    +I+ I   I ++ +++GPFN+Q + K+ ++ VIECN+R SRS P+VSKT+G D++A AT+V++   ++                +G+K P FS+ RL  AD VL  EM+STGEVACFGEN Y A+LKA+ S+ F++P+KN  + IG  ++ +   LPT ++L   GYN+YA+  TA++   H +    V WP   E     D P   K       + +  FDLVINL          + +VT+ Y  RR AID + PL+ + +  K+ V++L           HVD +T+  L  
Sbjct:    6 ASLVLEDGTTFKGRLFGAVSSVSGEVVFQTGMVGYPEALTDPSYKSQILTLTYPMIGNYGIPK-DEDGEFGLSKWFESSQIHAAALIVGEVSENPSHWSAAKSLDEWLREQGIPGLQGVDTRCLTKKIREKGTMLGKLVVEGTPADNIPFDNPDARNLVKEVSMKAPKVFNPEGTVRITAIDCGIKYNQIRCLCQRGARVTVVPWDQPLDSNDFDGLFISNGPGNPEYCKETVENIRKVACVENPKPIFGICLGHQLLSLVIGAKTYKMKYGNRGHNQPCIHKGTSRCYITSQNHGFAVDPETLPKDWDVLFTNANDQTSEGIVHNHKPLFSVQFHPEHMAGPTDLVGLFDVFLDTVRDVKENKAGKSVKQRLMEHLTFPGSPDPNAFVRPRKVLVLGSGGLS--IGQAGEFDYSGSQAIKAMKEENIQTILINPNIATVQTS---KGLADKVYFLPITPEYVTQVIKNERPDGVLLTFGGQTALNCGVELKKQGVLEKYKVRVLGTPVASIEMTEDRKIFVEKMEEINEHVAPSEAAMSVEQAVAAAERLGYPVLVRSAFALGGLGSGFANNRDEMITLVTQAFAHTSQVLVDKSLKGWKEIEYEVVRDAYDNCVTVCNMENIDPLGIHTGESIVVAPSQTLNDYEYNMLRNTAIKVIRHLGVVGECNIQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLSLGIPLPVLKNSVTNSTTANFEPSLDYCVVKVPRWDLSKFLRVSTKIGSSMKSVGEVMAIGRSFEEAFQKALRMVDENCVGF--------DHTIKPESEEELQTPTDKRIFVLAAALHAGYTVERLYELTKIDHWFLHKMKNIADHKKLLETYKQDESAMPPEIMRKAKQLGFSDKQIAQAVQSTELAVRKLRRDWKIFPVVKQIDTVAAEWPAQTNYLYLTYHGSESDVVFEQPHVMVIGSGVYRIGSSVEFDWCAVGCIMELRKMGYKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYEMENPEGVILSMGGQLPNNIAMSLHRQQCRILGTSPEFIDNAENRFKFSRMLDTIGISQPRWKELSDTESAVNFCETVGYPCLVRPSYVLSGAAMNVAYSDTDMEKFLSSAVAVSKEHPVVISKFIQEAKEIDVDAVACDGEVIAIAVSEHVENAGVHSGDATLVTPPQDINQKTMERIKMIVHAIGQELQVTGPFNLQLIAKDDQLKVIECNVRVSRSFPYVSKTLGVDLVALATRVILGEEVEAVGLM------RGNGIVGVKVPQFSFSRLAGADVVLGVEMTSTGEVACFGENRYEAYLKAMLSTGFKIPKKNILLSIG-SYKNKSELLPTVQTLESLGYNLYASLGTADFYTEHGVKVMAVDWPFEEES----DCPNKDKQRNIMDYLEENHFDLVINLSMRNSGGRRLSSFVTKGYRTRRMAIDFSVPLITDIKCTKLFVQALKQIGQAPRVKTHVDSMTSQKLIR 1469          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Xenopus
Match: ENSXETT00000045254.1 (carbamoyl-phosphate synthase 1 [Source:NCBI gene;Acc:100158506])

HSP 1 Score: 1776.14 bits (4599), Expect = 0.000e+0
Identity = 869/1454 (59.77%), Postives = 1106/1454 (76.07%), Query Frame = 1
Query:  175 ARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAKIEFDTDPIEFKDPNKSNLTADVSTNYIQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIETRNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSKSKTT---IIPSPKTIDFEPPXXXXXXXXXXXXXXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTSTEDFQNLDIPAATKLISDKFFDLVINLPNYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVESLDHVDLVTTDSLFNYQ 4527
            A L L +G    GYSFG+  S AGE+VFNTGL GY  ++TDP YRGQILTLT PI+GN G PDT A DS GLM  +ESE I VSGL+V DY+   SHW +VKSLS+WL +EKVPAL GIDTRML K +RD G VL KIEF+  P+E  DPNK NL  +VST  I+V+G+GNP KIV VDCG+KHN I+ L+ + +++  +P                              N   + + R  P+FG+  GN++  LAAGA TY+LP+ NRG NQPV+N +  QAFIT+QNH YG+++ SL + WK LF+N ND +NEGIM+  KPIFTAQFHPE   GP DTEFLFD +M M+K    TT   ++P P  +  +  +V KVL+LGSGGLSIGQAGEFDYSGSQA+KA+KEE ++T+LMNPNIASVQTN  G KQAD VYFLPVT +FV +V++ ERPDGI+L MGGQTALN G+EL ++G+L +Y VKVLGT ++SI+ATEDRQ F+D L EI   +APS AV +I+DA++AA++IGYPVM+R+A+ALGGLGSG+  +KE LMD+  +A AM+NQ+L+E+S++GWKE+EYEVVRDAADNC+TVCNMEN D +GVHTGDSIVVAPSQTLSN E+ MLR  A+KV+RH GIVGECNIQ+ALHP SLEY IIE+NARLSRSSALASKATGYPLAFIAAK+ALGI L +IKN  +  T+ACFEPSLDY+ TKIPRWDLDRFH T   IGSSMKSVGEVMAIGR FEES QKALRM HPS++G T+ L   K ++ + +L K +  P+++R++ +    E G  +++IH LT ID WFLHK++ I+++   +       +S+  E L  AKQ GFSD+ IG  +G SE + RE+R +  + PWVK IDT+AAEYP +TNYLY +YNG EHD+ FD QG+MVLGCGPYHIGSSVEFDWCAVS+IR LR+ G++TVV+N NPETVSTDFDE DRLYFEELS ER+LD++Q E+  G IISVGGQIPNNLA+PL+KN V I+GT P +ID AEDRS FSAILDE+ + QA W++++S+DDAL+F + VGYPCL+RPSY+LSGSAMNV +   EL  FL  A ++SQ++PVVITKF++GA+E+E DA+AK+G ++CHA+SEH+E+AGVHSGDATL++P  TIS+    +++  + KIA  F ISGPFN+QFLV+  ++LVIECNLRASRS PFVSKT+G D I  ATKVM    +DE    T+ +P  P +Y+GIK+PMFSWPRL  ADPVLRCEM+STGEVACFGEN+Y+AFLKA+ S+ F+LP+K   ILIG+QH F+P FL TA+ L + GY +YATEATA++L  + +PA  V+WP  +++ ++   P+  KLI +   D+VINLPN  TK+V +NYLIRR A D    L+ NF++VK+  E++ +   + T SLF+++
Sbjct:   39 ANLVLEDGTKLKGYSFGHPTSVAGEVVFNTGLAGYVTAITDPGYRGQILTLTNPIIGNGGAPDTKALDSYGLMKFIESEHIQVSGLLVLDYTNEHSHWRAVKSLSEWLHEEKVPALCGIDTRMLAKKIRDKGTVLGKIEFEGKPVELVDPNKRNLIDEVSTKEIKVYGKGNPVKIVAVDCGVKHNTIRQLV-QVSKIRKLP------------------------------NSDCIYKYRTPPVFGVSMGNEIAALAAGARTYRLPMANRGQNQPVMNTMNGQAFITAQNHAYGVDSNSLPEGWKPLFVNINDHSNEGIMHETKPIFTAQFHPEGSPGPADTEFLFDVFMSMIKKGKGTTLASVMPKP-ALQSKRIEVSKVLILGSGGLSIGQAGEFDYSGSQAVKAMKEENVKTVLMNPNIASVQTNEIGLKQADSVYFLPVTPQFVTEVIKAERPDGIILGMGGQTALNCGVELFKRGVLKEYGVKVLGTSVESIMATEDRQLFSDKLMEINEPIAPSFAVETIKDAVDAADKIGYPVMIRSAYALGGLGSGLCPDKETLMDLGTKALAMSNQILVERSVVGWKEIEYEVVRDAADNCVTVCNMENMDAMGVHTGDSIVVAPSQTLSNEEFQMLRSCAIKVVRHLGIVGECNIQFALHPTSLEYVIIEVNARLSRSSALASKATGYPLAFIAAKIALGIPLPEIKNVVSGKTTACFEPSLDYMVTKIPRWDLDRFHGTSGVIGSSMKSVGEVMAIGRNFEESFQKALRMCHPSVDGFTANLPMNKSWAADANLRKEMAEPTSTRVYSMAKGLETGIHMDEIHKLTSIDKWFLHKMQGILNMEKTLRSTRS--ESVPEETLRRAKQIGFSDRYIGKCLGLSEAQTRELRLNKNVKPWVKQIDTLAAEYPAITNYLYLTYNGQEHDIKFDDQGMMVLGCGPYHIGSSVEFDWCAVSSIRTLRQLGKKTVVVNCNPETVSTDFDECDRLYFEELSQERILDVFQQEHCDGCIISVGGQIPNNLAVPLYKNGVKIMGTSPLQIDRAEDRSTFSAILDELQIAQAPWKAVNSLDDALQFTNTVGYPCLLRPSYVLSGSAMNVVHGEEELKNFLAEATRVSQEHPVVITKFIQGAREVEMDAVAKEGRVICHAISEHVEDAGVHSGDATLMIPTQTISQGALEKVKIATKKIANAFAISGPFNMQFLVRGNDVLVIECNLRASRSFPFVSKTLGVDFIDVATKVMTGEKVDEAALPTLASPIIPADYVGIKAPMFSWPRLRGADPVLRCEMASTGEVACFGENIYSAFLKAMISTGFKLPQK--GILIGIQHSFRPHFLGTAQQLKEEGYKLYATEATADWLNANDVPATHVAWP--SQEGKSSSSPSIYKLIKEGNIDMVINLPNNNTKHVRDNYLIRRTAADCGIALLTNFQVVKLFAEAMKYSGDLDTKSLFHFR 1454          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Xenopus
Match: ENSXETT00000045303.1 (carbamoyl-phosphate synthase 1 [Source:NCBI gene;Acc:100158506])

HSP 1 Score: 1726.84 bits (4471), Expect = 0.000e+0
Identity = 855/1454 (58.80%), Postives = 1092/1454 (75.10%), Query Frame = 1
Query:  175 ARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAKIEFDTDPIEFKDPNKSNLTADVSTNYIQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIETRNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSKSKTT---IIPSPKTIDFEPPXXXXXXXXXXXXXXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTSTEDFQNLDIPAATKLISDKFFDLVINLPNYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVESLDHVDLVTTDSLFNYQ 4527
            A L L +G    GYSFG+  S AGE+VFNTGL GY E++TDP YRGQILTLT PI+GN G PDT A DS GLM  +ESE I VSGL+V DY+   SHW +VKSLS+WL +EKVPAL GIDTRML K +RD G VL KIEF+  P+E  DPNK NL  +VST  I+V+G+GNP KIV VDCG+KHN I+ L+ + +++  +P                              N   + + R  P+FG+  GN++  LAAGA TY+LP+ NRG NQPV+N +  QAFIT+QNH YG+++ SL + WK LF+N ND +NEGIM+  KPIFTAQFHPE   GP DTEFLFD +M M+K    TT   ++P P  +  +  +V KVL+LGSGGLSIGQAGEFDYSGSQA+KA+KEE ++T+LMNPNIASVQTN  G KQAD VYFLPVT +FV +V++ ERPDGI+L MGGQTALN G+EL ++G+L +Y VKVLGT ++SI+ATEDRQ F+D L EI   +APS AV +I+DA++AA++IGYPVM+R+A+ALGGLGSG+  +KE LMD+  +A AM+NQ+L+E+S++GWKE+EYEVVRDAADNC+TVCNMEN D +GVHTGDSIVVAPSQTLSN E+ MLR  A+KV+RH GIVGECNIQ+ALHP SLEY IIE+NARLSRSSALASKATGYPLAFIAAK+ALGI L +IKN  +  T+ACFEPSLDY+ TKIPRWDLDRFH T   IGSSMKSVGEVMAIGR FEES QKALRM HPS++G T+ L   K ++ + +L K +  P+++R++ +    E G  +++IH LT ID WFLHK++ I+++   +       +S+  E L  AKQ GFSD+ IG  +G SE + RE+R +  + PWVK IDT+AAEYP +TNYLY +YNG  +   F     +   C     GSSVEFDWCAVS+IR LR+ G++TVV+N NPETVSTDFDE DRLYFEELS ER+LD++Q E+  G IISVGGQIPNNLA+PL+KN V I+GT P +ID AEDRS FSAILDE+ + QA W++++S+DDAL+F + VGYPCL+RPSY+LSGSAMNV +   EL  FL  A ++SQ++PVVITKF++GA+E+E DA+AK+G ++CHA+SEH+E+AGVHSGDATL++P  TIS+    +++  + KIA  F ISGPFN+QFLV+  ++LVIECNLRASRS PFVSKT+G D I  ATKVM    +DE    T+ +P  P +Y+GIK+PMFSWPRL  ADPVLRCEM+STGEVACFGEN+Y+AFLKA+ S+ F+LP+K   ILIG+QH F+P FL TA+ L + GY +YATEATA++L  + +PA  V+WP  +++ ++   P+  KLI +   D+VINLPN  TK+V +NYLIRR A D    L+ NF++VK+  E++ +   + T SLF+++
Sbjct:    8 ANLVLEDGTKLKGYSFGHPTSVAGEVVFNTGLAGYVEAITDPGYRGQILTLTNPIIGNGGAPDTKALDSYGLMKFIESEHIQVSGLLVLDYTNEHSHWRAVKSLSEWLHEEKVPALCGIDTRMLAKKIRDKGTVLGKIEFEGKPVELVDPNKRNLIDEVSTKEIKVYGKGNPVKIVAVDCGVKHNTIRQLV-QVSKIRKLP------------------------------NSDCIYKYRTPPVFGVSMGNEIAALAAGARTYRLPMANRGQNQPVMNTMNGQAFITAQNHAYGVDSNSLPEGWKPLFVNINDHSNEGIMHETKPIFTAQFHPEGSPGPADTEFLFDVFMSMIKKGKGTTLASVMPKP-ALQSKRIEVSKVLILGSGGLSIGQAGEFDYSGSQAVKAMKEENVKTVLMNPNIASVQTNEIGLKQADSVYFLPVTPQFVTEVIKAERPDGIILGMGGQTALNCGVELFKRGVLKEYGVKVLGTSVESIMATEDRQLFSDKLMEINEPIAPSFAVETIKDAVDAADKIGYPVMIRSAYALGGLGSGLCPDKETLMDLGTKALAMSNQILVERSVVGWKEIEYEVVRDAADNCVTVCNMENMDAMGVHTGDSIVVAPSQTLSNEEFQMLRSCAIKVVRHLGIVGECNIQFALHPTSLEYVIIEVNARLSRSSALASKATGYPLAFIAAKIALGIPLPEIKNVVSGKTTACFEPSLDYMVTKIPRWDLDRFHGTSGVIGSSMKSVGEVMAIGRNFEESFQKALRMCHPSVDGFTANLPMNKSWAADANLRKEMAEPTSTRVYSMAKGLETGIHMDEIHKLTSIDKWFLHKMQGILNMEKTLRSTRS--ESVPEETLRRAKQIGFSDRYIGKCLGLSEAQTRELRLNKNVKPWVKQIDTLAAEYPAITNYLYLTYNGQPYMCPFVS---INASCLFPMTGSSVEFDWCAVSSIRTLRQLGKKTVVVNCNPETVSTDFDECDRLYFEELSQERILDVFQQEHCDGCIISVGGQIPNNLAVPLYKNGVKIMGTSPLQIDRAEDRSTFSAILDELQIAQAPWKAVNSLDDALQFTNTVGYPCLLRPSYVLSGSAMNVVHGEEELKNFLAEATRVSQEHPVVITKFIQGAREVEMDAVAKEGRVICHAISEHVEDAGVHSGDATLMIPTQTISQGALEKVKIATKKIANAFAISGPFNMQFLVRGNDVLVIECNLRASRSFPFVSKTLGVDFIDVATKVMTGEKVDEAALPTLASPIIPADYVGIKAPMFSWPRLRGADPVLRCEMASTGEVACFGENIYSAFLKAMISTGFKLPQK--GILIGIQHSFRPHFLGTAQQLKEEGYKLYATEATADWLNANDVPATHVAWP--SQEGKSSSSPSIYKLIKEGNIDMVINLPNNNTKHVRDNYLIRRTAADCGIALLTNFQVVKLFAEAMKYSGDLDTKSLFHFR 1420          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Xenopus
Match: CAD (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:NCBI gene;Acc:100125119])

HSP 1 Score: 1222.61 bits (3162), Expect = 0.000e+0
Identity = 641/1239 (51.74%), Postives = 859/1239 (69.33%), Query Frame = 1
Query:  916 CFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVK------SKSKT---------TIIPSPKTIDFEPPXXXXXXXXXXXXXXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTSTEDFQNLDIPAATKL------ISDKFFDLVINLP------NYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVESL----------DHVDLVTTDSLFN 4521
            CF  ++  LA   T Y    GNRGHNQP I+  + + FITSQNHGY ++  +L + W  LF NAND++NEGI++  KP F+ QFHPE C GP D   LFD +++ V+      S  KT         T   SP   D E  +  KVL+LGSGGLSIGQAGEFDYSGSQAIKALKEE I+T+L+NPNIA+VQT+      AD VYFLP+T E+V +V++ ERPDGILL+ GGQTALN G+EL ++G+L KY+V+VLGTP+KSI  TEDR+ F + ++EIG  +APS A  S+E A  AA ++GYPV+VR+A+ALGGLGSG A  KE+L  +  +AFA T QVL+++SL GWKE+EYEVVRDA +NC+TVCNMEN DPLG+HTG+SIVVAPSQTL++ EY+MLR TA+KVI+H GIVGECNIQYAL+PES +Y IIE+NARLSRSSALASKATGYPLA++AAKLALGI L  ++N+ T  T+A FEPSLDY   K+PRWDL +F     +IGSSMKSVGEVM++GR FEE+ QKALRM   +  G         D+      D+ L TP++ RI  +  A   GY++E+++ LTKID WFLHK+K I D    +   + +   +  E L  AKQ GFSDKQI L +  +E+ VR++RQ + I P VK +DT+AAE+P  TNYLY +YNG EHD+ F++  VMV+G G Y IGSSVEFDWCAV  I+ LRK G +T+++N+NPETVSTD+D  DRLYF+E+S E V+DIY+ ENP+G I+S+GGQ+PNN+A+ L +    +LGT P  ID AE+R KFS +LD I + Q  W+ LS ++ A++F + VG+PC+VRPSY+LSG+AMNVA++  +L   L +A  +S+++PVVI+KF++ AKEI+ DA+A DGV+V  A+SEH+ENAGVHSGDATLV P   I+     +I+ I   +  + +++GPFN+Q + K+ ++ VIECN+R SRS PFVSKT+G +++A AT+V+M   ++     T          +G+K P FS+ RL  AD VL  EM+STGEVACFGEN Y A+LKA+ S+ F++P+KN  + IG  ++ +   LPT +++   GY++YA+  TA++   H I    + WP   E+ +N D P   K       +S+  FDLVINL          + +VT  Y  RR A+D + PL+I+ +  K+ VE+L           HVD +T+  L  
Sbjct:   36 CFMAEI--LAICITAY----GNRGHNQPCIHESSRRCFITSQNHGYAVDPNTLPEGWSPLFTNANDQSNEGIIHDSKPFFSVQFHPEHCAGPMDLVGLFDVFLDTVRDRKAGDSGEKTVKQRVTELLTYKESPSVTDLEASRPHKVLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTVLINPNIATVQTS---KGLADKVYFLPITPEYVTQVIKNERPDGILLTFGGQTALNCGVELTKQGVLEKYNVRVLGTPVKSIEMTEDRKVFVEKMEEIGEHVAPSEAAFSLEQAQAAAERLGYPVLVRSAYALGGLGSGFASTKEELTALVCQAFAHTTQVLVDKSLKGWKEIEYEVVRDAYNNCVTVCNMENVDPLGIHTGESIVVAPSQTLNDREYNMLRNTAIKVIQHLGIVGECNIQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPVLRNSVTNSTTANFEPSLDYCVVKVPRWDLSKFLRVSTKIGSSMKSVGEVMSVGRNFEEAFQKALRMVDENCVGF--------DHCIKSASDEELETPTDKRIFVLAAALRAGYTIERLYELTKIDRWFLHKMKNITDQVATLESYHQDETLMPREVLLRAKQLGFSDKQIALAVQSTELAVRKMRQELLILPVVKQLDTVAAEWPAQTNYLYLTYNGTEHDLAFEEPHVMVIGSGVYRIGSSVEFDWCAVGCIQELRKMGFKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGIILSMGGQLPNNIAMSLHRQQCRVLGTSPEAIDSAENRFKFSRMLDTIGISQPQWKELSDMESAVQFCNTVGFPCVVRPSYVLSGAAMNVAHSDGDLEKVLSNAVAVSKEHPVVISKFIQEAKEIDVDAVACDGVVVAVAISEHVENAGVHSGDATLVTPAQDITPKTLERIKAIVHAVGLELQVNGPFNLQLIAKDDQLKVIECNVRVSRSFPFVSKTLGVNLVALATQVIMGEEVEPVGVMT------GTGIVGVKVPQFSFSRLAGADVVLGVEMTSTGEVACFGENRYEAYLKAMLSTGFKIPQKNILLTIG-SYKNKSELLPTVRAMESLGYSLYASLGTADFYTEHGIKVKAMDWP--FEESEN-DGPLREKQGSIMDHLSENHFDLVINLSMRNSGGRRLSSFVTRGYRARRLAVDYSVPLIIDIKCTKLFVEALRQIGGAPPVKTHVDCMTSQKLIR 1247          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Xenopus
Match: CAD (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:NCBI gene;Acc:100125119])

HSP 1 Score: 1133.24 bits (2930), Expect = 0.000e+0
Identity = 611/1179 (51.82%), Postives = 808/1179 (68.53%), Query Frame = 1
Query:  976 GNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSKSKTTIIPSPKTIDFEPPXXXXXXXXXXXXXXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTSTEDFQNLDIPAATKL------ISDKFFDLVINLP------NYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVE 4476
            GNRGHNQP I+  + + FITSQNHGY ++  +L + W  LF NAND++NEGI++  KP F+ QFHPE C GP D   LFD +++ V+ +       S +  D E  +  KVL+LGSGGLSIGQAGEFDYSGSQAIKALKEE I+T+L+NPNIA+VQT+      AD VYFLP+T E+V +V++ ERPDGILL+ GGQTALN G+EL ++G+L KY+V+VLGTP+KSI  TEDR+ F + ++EIG  +APS      E A  AA ++GYPV+VR+A+ALGGLGSG A  KE+L  +  +AFA T QVL+++SL GWKE+EYEVVRDA +NC+TVCNMEN DPLG+HTG+SIVVAPSQTL++ EY+MLR TA+KVI+H GIVGECNIQYAL+PES +Y IIE+NARLSRSSALASKATGYPLA++AAKLALGI L  ++N+ T  T+A FEPSLDY   K+PRWDL +F     +IGSSMKSVGEVM++GR FEE+ QKALRM   +  G         D+      D+ L TP++ RI  +  A   GY++E+++ LTKID WFLHK+K I D    +   + +   +  E L  AKQ GFSDKQI L +  +E+ VR++RQ + I P VK +DT+AAE+P  TNYLY +YNG EHD+ F++  VMV+G G Y IGSSVEFDWCAV  I+ LRK G +T+++N+NPETVSTD+D  DRLYF+E+S E V+DIY+ ENP+G I+S+GGQ+PNN+A+ L +    +LGT P  ID AE+R KFS +LD I + Q  W+ LS ++ A++F + VG+PC+VRPSY+LSG+AMNVA++  +L   L +A  +S+++PVVI+KF++ AKEI+ DA+A DGV+V  A+SEH+ENAGVHSGDATLV P   I+     +I+ I         IS P   Q    + ++ VIECN+R SRS PFVSKT+G +++A AT+V+M   ++     T          +G+K P FS+ RL  AD VL  EM+STGEVACFGEN Y A+LKA+ S+ F++P+KN  + IG                    Y +               P   + WP   E+ +N D P   K       +S+  FDLVINL          + +VT  Y  RR A+D + PL+I+ +  K+ VE
Sbjct:    8 GNRGHNQPCIHESSRRCFITSQNHGYAVDPNTLPEGWSPLFTNANDQSNEGIIHDSKPFFSVQFHPEHCAGPMDLVGLFDVFLDTVRDRKAGD---SGEKTDLEASRPHKVLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTVLINPNIATVQTS---KGLADKVYFLPITPEYVTQVIKNERPDGILLTFGGQTALNCGVELTKQGVLEKYNVRVLGTPVKSIEMTEDRKVFVEKMEEIGEHVAPS------EAAQAAAERLGYPVLVRSAYALGGLGSGFASTKEELTALVCQAFAHTTQVLVDKSLKGWKEIEYEVVRDAYNNCVTVCNMENVDPLGIHTGESIVVAPSQTLNDREYNMLRNTAIKVIQHLGIVGECNIQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPVLRNSVTNSTTANFEPSLDYCVVKVPRWDLSKFLRVSTKIGSSMKSVGEVMSVGRNFEEAFQKALRMVDENCVGF--------DHCIKSASDEELETPTDKRIFVLAAALRAGYTIERLYELTKIDRWFLHKMKNITDQVATLESYHQDETLMPREVLLRAKQLGFSDKQIALAV--TELAVRKMRQELLILPVVKQLDTVAAEWPAQTNYLYLTYNGTEHDLAFEEPHVMVIGSGVYRIGSSVEFDWCAVGCIQELRKMGFKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGIILSMGGQLPNNIAMSLHRQQCRVLGTSPEAIDSAENRFKFSRMLDTIGISQPQWKELSDMESAVQFCNTVGFPCVVRPSYVLSGAAMNVAHSDGDLEKVLSNAVAVSKEHPVVISKFIQEAKEIDVDAVACDGVVVAVAISEHVENAGVHSGDATLVTPAQDITPKTLERIKAIVHA-----SIS-PLPAQ----DDQLKVIECNVRVSRSFPFVSKTLGVNLVALATQVIMGEEVEPVGVMT------GTGIVGVKVPQFSFSRLAGADVVLGVEMTSTGEVACFGENRYEAYLKAMLSTGFKIPQKNILLTIG-------------------SYKVRGGR-----------PKLAMDWP--FEESEN-DGPLREKQGSIMDHLSENHFDLVINLSMRNSGGRRLSSFVTRGYRARRLAVDYSVPLIIDIKCTKLFVE 1115          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Xenopus
Match: CAD (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:NCBI gene;Acc:100125119])

HSP 1 Score: 1003.43 bits (2593), Expect = 0.000e+0
Identity = 550/1113 (49.42%), Postives = 742/1113 (66.67%), Query Frame = 1
Query: 1264 SPKTIDFEPPXXXXXXXXXXXXXXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSM--GGQT---ALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTSTEDFQNLDIPAATKL------ISDKFFDLVINLP------NYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVESL----------DHVDLVTTDSLFN 4521
            SP   D E  +  KVL+LGSGGLSIGQAGEFDYSGSQAIKALKEE I+T+L+NPNIA+VQT+      AD VYFLP+T E+V +V        ++LS+  GG      L   +E H     S  S+ +   P                             ++    A  AA ++GYPV+VR+A+ALGGLGSG A  KE+L  +  +AFA T QVL+++SL GWKE+EYEVVRDA +NC+TVCNMEN DPLG+HTG+SIVVAPSQTL++ EY+MLR TA+KVI+H GIVGECNIQYAL+PES +Y IIE+NARLSRSSALASKATGYPLA++AAKLALGI L  ++N+ T  T+A FEPSLDY   K+PRWDL +F     +IGSSMKSVGEVM++GR FEE+ QKALRM   +  G         D+      D+ L TP++ RI  +  A   GY++E+++ LTKID WFLHK+K I D    +   + +   +  E L  AKQ GFSDKQI L +  +E+ VR++RQ + I P VK +DT+AAE+P  TNYLY +YNG EHD+ F++  VMV+G G Y IGSSVEFDWCAV  I+ LRK G +T+++N+NPETVSTD+D  DRLYF+E+S E V+DIY+ ENP+G I+S+GGQ+PNN+A+ L +    +LGT P  ID AE+R KFS +LD I + Q  W+ LS ++ A++F + VG+PC+VRPSY+LSG+AMNVA++  +L   L +A  +S+++PVVI+KF++ AKEI+ DA+A DGV+V  A+SEH+ENAGVHSGDATLV P   I+     +I+ I   +  + +++GPFN+Q + K+ ++ VIECN+R SRS PFVSKT+G +++A AT+V+M   ++     T          +G+K P FS+ RL  AD VL  EM+STGEVACFGEN Y A+LKA+ S+ F++P+KN  + IG  ++ +   LPT +++   GY++YA+  TA++   H I    + WP   E+ +N D P   K       +S+  FDLVINL          + +VT  Y  RR A+D + PL+I+ +  K+ VE+L           HVD +T+  L  
Sbjct:   32 SPSVTDLEASRPHKVLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTVLINPNIATVQTS---KGLADKVYFLPITPEYVTQV----SVSLLILSLQQGGSCLYKGLTKWVEHH-----SLVSLPICPVPTCCFFIL----------------------MLLCLQAQAAAERLGYPVLVRSAYALGGLGSGFASTKEELTALVCQAFAHTTQVLVDKSLKGWKEIEYEVVRDAYNNCVTVCNMENVDPLGIHTGESIVVAPSQTLNDREYNMLRNTAIKVIQHLGIVGECNIQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPVLRNSVTNSTTANFEPSLDYCVVKVPRWDLSKFLRVSTKIGSSMKSVGEVMSVGRNFEEAFQKALRMVDENCVGF--------DHCIKSASDEELETPTDKRIFVLAAALRAGYTIERLYELTKIDRWFLHKMKNITDQVATLESYHQDETLMPREVLLRAKQLGFSDKQIALAVQSTELAVRKMRQELLILPVVKQLDTVAAEWPAQTNYLYLTYNGTEHDLAFEEPHVMVIGSGVYRIGSSVEFDWCAVGCIQELRKMGFKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGIILSMGGQLPNNIAMSLHRQQCRVLGTSPEAIDSAENRFKFSRMLDTIGISQPQWKELSDMESAVQFCNTVGFPCVVRPSYVLSGAAMNVAHSDGDLEKVLSNAVAVSKEHPVVISKFIQEAKEIDVDAVACDGVVVAVAISEHVENAGVHSGDATLVTPAQDITPKTLERIKAIVHAVGLELQVNGPFNLQLIAKDDQLKVIECNVRVSRSFPFVSKTLGVNLVALATQVIMGEEVEPVGVMT------GTGIVGVKVPQFSFSRLAGADVVLGVEMTSTGEVACFGENRYEAYLKAMLSTGFKIPQKNILLTIG-SYKNKSELLPTVRAMESLGYSLYASLGTADFYTEHGIKVKAMDWP--FEESEN-DGPLREKQGSIMDHLSENHFDLVINLSMRNSGGRRLSSFVTRGYRARRLAVDYSVPLIIDIKCTKLFVEALRQIGGAPPVKTHVDCMTSQKLIR 1092          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Mouse
Match: Cps1 (carbamoyl-phosphate synthetase 1 [Source:MGI Symbol;Acc:MGI:891996])

HSP 1 Score: 1845.86 bits (4780), Expect = 0.000e+0
Identity = 889/1455 (61.10%), Postives = 1143/1455 (78.56%), Query Frame = 1
Query:  175 ARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAKIEFDTDPIEFKDPNKSNLTADVSTNYIQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIET-RNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSKSKTTI---IPSPKTIDFEPPXXXXXXXXXXXXXXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTSTEDFQNLDIPAATKLISDKFFDLVINLPNYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVESLDHVDLVTTDSLFNYQ 4527
            A + L +G    GYSFG+  S AGE+VFNTGL GYPE+LTDP+Y+GQILT+  PI+GN G PDT ARD  GL   +ES+ I V+GL+V +YS   +HW + KSL QWL +EKVPA++G+DTRMLTKI+RD G +L KIEF+   ++F DPNK NL A+VST  ++VFG+GNP K+V VDCGIK+N+I++L+ RGAEV LVPW++DFT+ +YDGL I+ GPG+PAL    ++N+K ++E+ R EPLFGI  GN + GLAAGA +YK+ + NRG NQPV+N+   QAFIT+QNHGY L+  +L   WK LF+N ND+TNEGIM+  KP F  QFHPE   GPTDTE+LFD++  ++K    TTI   +P P  +     +V KVL+LGSGGLSIGQAGEFDYSGSQA+KA+KEE ++T+LMNPNIASVQTN  G KQAD VYFLP+T +FV +V++ ERPDG++L MGGQTALN G+EL ++G+L +Y VKVLGT ++SI+ATEDRQ F+D L EI  K+APS AV S+EDA++AA+ IGYPVM+R+A+ALGGLGSGI  NKE L+D+  +AFAMTNQ+L+E+S+ GWKE+EYEVVRDA DNC+TVCNMEN D +GVHTGDS+VVAP+QTLSN E+ MLR T++ V+RH GIVGECNIQ+ALHP S+EYCIIE+NARLSRSSALASKATGYPLAFIAAK+ALGI L +IKN  +  TSACFEPSLDY+ TKIPRWDLDRFH T   IGSSMKSVGEVMAIGRTFEES QKALRM HPS++G T +L   K++  N DL K L  PS++RI+ I  A E   S+++I  LT ID WFL+K++ I+++   +  +N +  S++ E L  AK+ GFSDKQI   +G +E + RE+R    I PWVK IDT+AAEYP+VTNYLY +YNG EHD+ FD+ G+MVLGCGPYHIGSSVEFDWCAVS+IR LR+ G++TVV+N NPETVSTDFDE D+LYFEELSLER+LDIY  E   G IISVGGQIPNNLA+PL+KN V I+GT P +ID AEDRS FSA+LDE+ V QA W++++++++ALEFA+ VGYPCL+RPSY+LSGSAMNV ++ +E+  FL+ A ++SQ++PVV+TKF+EGA+E+E DA+ K+G ++ HA+SEH+E+AGVHSGDATL+LP  TIS+    ++++ + KIAK F ISGPFNVQFLVK  ++LVIECNLRASRS PFVSKT+G D I  ATKVM+   +DEK   T++ P  P +Y+ IK+PMFSWPRL  ADP+LRCEM+STGEVACFGE ++TAFLKA+ S+ F++P+K   ILIG+Q  F+PRFL  A+ LH+ G+ ++ATEAT+++L  + +PA  V+WP  +++ QN  + +  KLI D   DLVINLPN  TK+V +NY+IRR A+DS   L+ NF++ K+  E++     V + SLF+Y+
Sbjct:   46 AHIVLEDGTKMKGYSFGHPSSVAGEVVFNTGLGGYPEALTDPAYKGQILTMANPIIGNGGAPDTTARDELGLNKYMESDGIKVAGLLVLNYSNDYNHWLATKSLGQWLQEEKVPAIYGVDTRMLTKIIRDKGTMLGKIEFEGQSVDFVDPNKQNLIAEVSTKDVKVFGKGNPTKVVAVDCGIKNNVIRLLVKRGAEVHLVPWNHDFTQMEYDGLLIAGGPGNPALAQPLIQNVKKILESDRKEPLFGISTGNIITGLAAGAKSYKMSMANRGQNQPVLNITNRQAFITAQNHGYALDN-TLPAGWKPLFVNVNDQTNEGIMHESKPFFAVQFHPEVSPGPTDTEYLFDSFFSLIKKGKGTTITSVLPKPALVASRV-EVSKVLILGSGGLSIGQAGEFDYSGSQAVKAMKEENVKTVLMNPNIASVQTNEVGLKQADAVYFLPITPQFVTEVIKAERPDGLILGMGGQTALNCGVELFKRGVLKEYGVKVLGTSVESIMATEDRQLFSDKLNEINEKIAPSFAVESMEDALKAADTIGYPVMIRSAYALGGLGSGICPNKETLIDLGTKAFAMTNQILVERSVTGWKEIEYEVVRDADDNCVTVCNMENVDAMGVHTGDSVVVAPAQTLSNAEFQMLRRTSVNVVRHLGIVGECNIQFALHPTSMEYCIIEVNARLSRSSALASKATGYPLAFIAAKIALGIPLPEIKNVVSGKTSACFEPSLDYMVTKIPRWDLDRFHGTSSRIGSSMKSVGEVMAIGRTFEESFQKALRMCHPSVDGFTPRLPMNKEWPANLDLKKELSEPSSTRIYAIAKALENNMSLDEIVRLTSIDKWFLYKMRDILNMDKTLKGLNSD--SVTEETLRKAKEIGFSDKQISKCLGLTEAQTRELRLKKNIHPWVKQIDTLAAEYPSVTNYLYVTYNGQEHDIKFDEHGIMVLGCGPYHIGSSVEFDWCAVSSIRTLRQLGKKTVVVNCNPETVSTDFDECDKLYFEELSLERILDIYHQEACNGCIISVGGQIPNNLAVPLYKNGVKIMGTSPLQIDRAEDRSIFSAVLDELKVAQAPWKAVNTLNEALEFANSVGYPCLLRPSYVLSGSAMNVVFSEDEMKRFLEEATRVSQEHPVVLTKFVEGAREVEMDAVGKEGRVISHAISEHVEDAGVHSGDATLMLPTQTISQGAIEKVKDATRKIAKAFAISGPFNVQFLVKGNDVLVIECNLRASRSFPFVSKTLGVDFIDVATKVMIGESIDEKRLPTLEQPIIPSDYVAIKAPMFSWPRLRDADPILRCEMASTGEVACFGEGIHTAFLKAMLSTGFKIPQK--GILIGIQQSFRPRFLGVAEQLHNEGFKLFATEATSDWLNANNVPATPVAWP--SQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIALLTNFQVTKLFAEAVQKSRTVDSKSLFHYR 1492          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Mouse
Match: Cad (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:MGI Symbol;Acc:MGI:1916969])

HSP 1 Score: 1443.33 bits (3735), Expect = 0.000e+0
Identity = 749/1487 (50.37%), Postives = 1003/1487 (67.45%), Query Frame = 1
Query:  175 ARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAK-IEFDTDP--IEFKDPNKSNLTADVSTNYIQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIETRN-EPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSKSKTTI-----------------IPSPKTIDFEPPXXXXXXXXXXXXXXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTSTEDFQNLDIPAATKL---ISDKFFDLVINLP------NYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVESLD----------HVDLVTTDSL 4515
            A L L +G V  G  FG   STAGE+VF TG+ GYPE+LTDPSY+ QIL LTYP++GNYG+P ++  D  GL    ES  IHV+GL+V +     SHW++  +L +WL    +P L G+DTR LTK +R+ G++L K ++  T+P  + F DPN   L  +VS    +VF  G   +I  +DCG+K+N I+ L   GAEVT+VPWD++    KYDGLF+SNGPGDPA     V  +  V+   N  P+FGIC G+QL+ LA GA TYK+  GNRGHNQP + V T + F+TSQNHG+ ++ +SL   W  LF NAND +NEGI++   P F+ QFHPE   GP+D E LFD ++E V+  +   I                 +P P +    PP+   +L  G     IGQAGEFDYSGSQAIKALKEE I+T+L+NPNIA+VQT+      AD VYFLP+T  +V +V+  ERPDG+LL+ GGQTALN G+EL + G+L++Y V+VLGTP+++I  TEDR++FA  + EIG  +APS A  S+E A  AA ++GYPV+VRAAFALGGLGSG A  KE+L  +   AFA T+QVLI++SL GWKE+EYEVVRDA  NC+TVCNMEN DPLG+HTG+SIVVAPSQTL++ EY +LR TA+KV +H GIVGECN+QYAL+PES +Y IIE+NARLSRSSALASKATGYPLA++AAKLALGI L +++N+ T  T+A FEPSLDY   KIPRWDL +F     +IGS MKSVGEVM IGR+FEE+ QKALRM   +  G         D++     D  L TP++ RI  +  A   GYSVE+++ LT+ID WFLH++KRIV  A  + +  G  ++L  + L  AK  GFSDKQI L +  +E+ VR++RQ + I P VK IDT+AAE+P  TNYLY +Y G  HD+ F    V+VLG G Y IGSSVEFDWCAV  I+ LRK G +T+++N+NPETVSTD+D  DRLYF+E+S E V+DIY+ ENP+G I+S+GGQ+PNN+A+ L +    +LGT P  ID AE+R KFS +LD I + Q  WR LS ++ A +F   VGYPC+VRPSY+LSG+AMNVAYT  +L  FL SA  +S+++PVVI+KF++ AKEI+ DA+A DG++   A+SEH+ENAGVHSGDATLV PP  I+     +I+ I   + ++ +++GPFN+Q + K+ ++ VIECN+R SRS PFVSKT+G D++A AT+++M   ++     T          +G+K P FS+ RL  AD VL  EM+STGEVA FGE+   A+LKA+ S+ F++P KN  + IG  ++ +   LPT + L   GY++YA+  TA++   H +    V W    E+  + + P    +   +++  F+LVINL          + +VT+ Y  RR A D + PL+I+ +  K+ VE+L           HVD +T+  L
Sbjct:    2 AALVLEDGSVLQGRPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILVLTYPLIGNYGIP-SDEEDEFGLSKWFESSEIHVAGLVVGECCPTPSHWSANCTLHEWLQQRGIPGLQGVDTRELTKKLREQGSLLGKLVQKGTEPSALPFVDPNARPLAPEVSIKTPRVFNAGGAPRICALDCGLKYNQIRCLCQLGAEVTVVPWDHELDSQKYDGLFLSNGPGDPASYPGVVSTLSRVLSEPNPRPVFGICLGHQLLALAIGAKTYKMRYGNRGHNQPCLLVGTGRCFLTSQNHGFAVDADSLPAGWAPLFTNANDCSNEGIVHDSLPFFSVQFHPEHRAGPSDMELLFDVFLETVREAAAGNIGGQTVRERLAQRLCPPELPIPGS-GLPPPRKVLILGSGGLS--IGQAGEFDYSGSQAIKALKEENIQTLLINPNIATVQTS---QGLADKVYFLPITLHYVTQVIRNERPDGVLLTFGGQTALNCGVELTKAGVLARYGVRVLGTPVETIELTEDRRAFAARMAEIGEHVAPSEAANSLEQAQAAAERLGYPVLVRAAFALGGLGSGFASTKEELSALVAPAFAHTSQVLIDKSLKGWKEIEYEVVRDAYGNCVTVCNMENLDPLGIHTGESIVVAPSQTLNDREYQLLRRTAIKVTQHLGIVGECNVQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPELRNSVTGGTAA-FEPSLDYCVVKIPRWDLSKFLRVSTKIGSCMKSVGEVMGIGRSFEEAFQKALRMVDENCVGF--------DHTVKPVSDMELETPTDKRIFVVAAALWAGYSVERLYELTRIDCWFLHRMKRIVTHAQLLEQHRG--QALPQDLLHQAKCLGFSDKQIALAVLSTELAVRKLRQELGICPAVKQIDTVAAEWPAQTNYLYLTYWGNTHDLDFRAPHVLVLGSGVYRIGSSVEFDWCAVGCIQQLRKMGYKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGVILSMGGQLPNNMAMALHRQQCRVLGTSPEAIDSAENRFKFSRLLDTIGISQPQWRELSDLESARQFCHTVGYPCVVRPSYVLSGAAMNVAYTDGDLERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAVACDGIVSAIAISEHVENAGVHSGDATLVTPPQDITPKTLERIKAIVHAVGQELQVTGPFNLQLIAKDDQLKVIECNVRVSRSFPFVSKTLGVDLVALATRIIMGEKVEPVGLMT------GSGVVGVKVPQFSFSRLAGADVVLGVEMTSTGEVAGFGESRCEAYLKAMLSTGFKIPEKNILLTIG-SYKNKSELLPTVRLLESLGYSLYASLGTADFYTEHGVKVTAVDW--HFEEAVDGECPPQRSILDQLAENHFELVINLSMRGAGGRRLSSFVTKGYRTRRLAADFSVPLIIDIKCTKLFVEALGQIGPAPPLKVHVDCMTSQKL 1461          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Mouse
Match: Cad (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:MGI Symbol;Acc:MGI:1916969])

HSP 1 Score: 1442.17 bits (3732), Expect = 0.000e+0
Identity = 749/1487 (50.37%), Postives = 1003/1487 (67.45%), Query Frame = 1
Query:  175 ARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAK-IEFDTDP--IEFKDPNKSNLTADVSTNYIQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIETRN-EPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSKSKTTI-----------------IPSPKTIDFEPPXXXXXXXXXXXXXXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTSTEDFQNLDIPAATKL---ISDKFFDLVINLP------NYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVESLD----------HVDLVTTDSL 4515
            A L L +G V  G  FG   STAGE+VF TG+ GYPE+LTDPSY+ QIL LTYP++GNYG+P ++  D  GL    ES  IHV+GL+V +     SHW++  +L +WL    +P L G+DTR LTK +R+ G++L K ++  T+P  + F DPN   L  +VS    +VF  G   +I  +DCG+K+N I+ L   GAEVT+VPWD++    KYDGLF+SNGPGDPA     V  +  V+   N  P+FGIC G+QL+ LA GA TYK+  GNRGHNQP + V T + F+TSQNHG+ ++ +SL   W  LF NAND +NEGI++   P F+ QFHPE   GP+D E LFD ++E V+  +   I                 +P P +    PP+   +L  G     IGQAGEFDYSGSQAIKALKEE I+T+L+NPNIA+VQT+      AD VYFLP+T  +V +V+  ERPDG+LL+ GGQTALN G+EL + G+L++Y V+VLGTP+++I  TEDR++FA  + EIG  +APS A  S+E A  AA ++GYPV+VRAAFALGGLGSG A  KE+L  +   AFA T+QVLI++SL GWKE+EYEVVRDA  NC+TVCNMEN DPLG+HTG+SIVVAPSQTL++ EY +LR TA+KV +H GIVGECN+QYAL+PES +Y IIE+NARLSRSSALASKATGYPLA++AAKLALGI L +++N+ T  T+A FEPSLDY   KIPRWDL +F     +IGS MKSVGEVM IGR+FEE+ QKALRM   +  G         D++     D  L TP++ RI  +  A   GYSVE+++ LT+ID WFLH++KRIV  A  + +  G  ++L  + L  AK  GFSDKQI L +  +E+ VR++RQ + I P VK IDT+AAE+P  TNYLY +Y G  HD+ F    V+VLG G Y IGSSVEFDWCAV  I+ LRK G +T+++N+NPETVSTD+D  DRLYF+E+S E V+DIY+ ENP+G I+S+GGQ+PNN+A+ L +    +LGT P  ID AE+R KFS +LD I + Q  WR LS ++ A +F   VGYPC+VRPSY+LSG+AMNVAYT  +L  FL SA  +S+++PVVI+KF++ AKEI+ DA+A DG++   A+SEH+ENAGVHSGDATLV PP  I+     +I+ I   + ++ +++GPFN+Q + K+ ++ VIECN+R SRS PFVSKT+G D++A AT+++M   ++     T          +G+K P FS+ RL  AD VL  EM+STGEVA FGE+   A+LKA+ S+ F++P KN  + IG  ++ +   LPT + L   GY++YA+  TA++   H +    V W    E+  + + P    +   +++  F+LVINL          + +VT+ Y  RR A D + PL+I+ +  K+ VE+L           HVD +T+  L
Sbjct:    2 AALVLEDGSVLQGRPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILVLTYPLIGNYGIP-SDEEDEFGLSKWFESSEIHVAGLVVGECCPTPSHWSANCTLHEWLQQRGIPGLQGVDTRELTKKLREQGSLLGKLVQKGTEPSALPFVDPNARPLAPEVSIKTPRVFNAGGAPRICALDCGLKYNQIRCLCQLGAEVTVVPWDHELDSQKYDGLFLSNGPGDPASYPGVVSTLSRVLSEPNPRPVFGICLGHQLLALAIGAKTYKMRYGNRGHNQPCLLVGTGRCFLTSQNHGFAVDADSLPAGWAPLFTNANDCSNEGIVHDSLPFFSVQFHPEHRAGPSDMELLFDVFLETVREAAAGNIGGQTVRERLAQRLCPPELPIPGS-GLPPPRKVLILGSGGLS--IGQAGEFDYSGSQAIKALKEENIQTLLINPNIATVQTS---QGLADKVYFLPITLHYVTQVIRNERPDGVLLTFGGQTALNCGVELTKAGVLARYGVRVLGTPVETIELTEDRRAFAARMAEIGEHVAPSEAANSLEQAQAAAERLGYPVLVRAAFALGGLGSGFASTKEELSALVAPAFAHTSQVLIDKSLKGWKEIEYEVVRDAYGNCVTVCNMENLDPLGIHTGESIVVAPSQTLNDREYQLLRRTAIKVTQHLGIVGECNVQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPELRNSVTGGTAA-FEPSLDYCVVKIPRWDLSKFLRVSTKIGSCMKSVGEVMGIGRSFEEAFQKALRMVDENCVGF--------DHTVKPVSDMELETPTDKRIFVVAAALWAGYSVERLYELTRIDCWFLHRMKRIVTHAQLLEQHRG--QALPQDLLHQAKCLGFSDKQIALAVLSTELAVRKLRQELGICPAVKQIDTVAAEWPAQTNYLYLTYWGNTHDLDFRAPHVLVLGSGVYRIGSSVEFDWCAVGCIQQLRKMGYKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGVILSMGGQLPNNMAMALHRQQCRVLGTSPEAIDSAENRFKFSRLLDTIGISQPQWRELSDLESARQFCHTVGYPCVVRPSYVLSGAAMNVAYTDGDLERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAVACDGIVSAIAISEHVENAGVHSGDATLVTPPQDITPKTLERIKAIVHAVGQELQVTGPFNLQLIAKDDQLKVIECNVRVSRSFPFVSKTLGVDLVALATRIIMGEKVEPVGLMT------GSGVVGVKVPQFSFSRLAGADVVLGVEMTSTGEVAGFGESRCEAYLKAMLSTGFKIPEKNILLTIG-SYKNKSELLPTVRLLESLGYSLYASLGTADFYTEHGVKVTAVDW--HFEEAVDGECPPQRSILDQLAENHFELVINLSMRGAGGRRLSSFVTKGYRTRRLAADFSVPLIIDIKCTKLFVEALGQIGPAPPLKVHVDCMTSQKL 1461          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Mouse
Match: Cad (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:MGI Symbol;Acc:MGI:1916969])

HSP 1 Score: 1441.79 bits (3731), Expect = 0.000e+0
Identity = 749/1487 (50.37%), Postives = 1003/1487 (67.45%), Query Frame = 1
Query:  175 ARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAK-IEFDTDP--IEFKDPNKSNLTADVSTNYIQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIETRN-EPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSKSKTTI-----------------IPSPKTIDFEPPXXXXXXXXXXXXXXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTSTEDFQNLDIPAATKL---ISDKFFDLVINLP------NYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVESLD----------HVDLVTTDSL 4515
            A L L +G V  G  FG   STAGE+VF TG+ GYPE+LTDPSY+ QIL LTYP++GNYG+P ++  D  GL    ES  IHV+GL+V +     SHW++  +L +WL    +P L G+DTR LTK +R+ G++L K ++  T+P  + F DPN   L  +VS    +VF  G   +I  +DCG+K+N I+ L   GAEVT+VPWD++    KYDGLF+SNGPGDPA     V  +  V+   N  P+FGIC G+QL+ LA GA TYK+  GNRGHNQP + V T + F+TSQNHG+ ++ +SL   W  LF NAND +NEGI++   P F+ QFHPE   GP+D E LFD ++E V+  +   I                 +P P +    PP+   +L  G     IGQAGEFDYSGSQAIKALKEE I+T+L+NPNIA+VQT+      AD VYFLP+T  +V +V+  ERPDG+LL+ GGQTALN G+EL + G+L++Y V+VLGTP+++I  TEDR++FA  + EIG  +APS A  S+E A  AA ++GYPV+VRAAFALGGLGSG A  KE+L  +   AFA T+QVLI++SL GWKE+EYEVVRDA  NC+TVCNMEN DPLG+HTG+SIVVAPSQTL++ EY +LR TA+KV +H GIVGECN+QYAL+PES +Y IIE+NARLSRSSALASKATGYPLA++AAKLALGI L +++N+ T  T+A FEPSLDY   KIPRWDL +F     +IGS MKSVGEVM IGR+FEE+ QKALRM   +  G         D++     D  L TP++ RI  +  A   GYSVE+++ LT+ID WFLH++KRIV  A  + +  G  ++L  + L  AK  GFSDKQI L +  +E+ VR++RQ + I P VK IDT+AAE+P  TNYLY +Y G  HD+ F    V+VLG G Y IGSSVEFDWCAV  I+ LRK G +T+++N+NPETVSTD+D  DRLYF+E+S E V+DIY+ ENP+G I+S+GGQ+PNN+A+ L +    +LGT P  ID AE+R KFS +LD I + Q  WR LS ++ A +F   VGYPC+VRPSY+LSG+AMNVAYT  +L  FL SA  +S+++PVVI+KF++ AKEI+ DA+A DG++   A+SEH+ENAGVHSGDATLV PP  I+     +I+ I   + ++ +++GPFN+Q + K+ ++ VIECN+R SRS PFVSKT+G D++A AT+++M   ++     T          +G+K P FS+ RL  AD VL  EM+STGEVA FGE+   A+LKA+ S+ F++P KN  + IG  ++ +   LPT + L   GY++YA+  TA++   H +    V W    E+  + + P    +   +++  F+LVINL          + +VT+ Y  RR A D + PL+I+ +  K+ VE+L           HVD +T+  L
Sbjct:    2 AALVLEDGSVLQGRPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILVLTYPLIGNYGIP-SDEEDEFGLSKWFESSEIHVAGLVVGECCPTPSHWSANCTLHEWLQQRGIPGLQGVDTRELTKKLREQGSLLGKLVQKGTEPSALPFVDPNARPLAPEVSIKTPRVFNAGGAPRICALDCGLKYNQIRCLCQLGAEVTVVPWDHELDSQKYDGLFLSNGPGDPASYPGVVSTLSRVLSEPNPRPVFGICLGHQLLALAIGAKTYKMRYGNRGHNQPCLLVGTGRCFLTSQNHGFAVDADSLPAGWAPLFTNANDCSNEGIVHDSLPFFSVQFHPEHRAGPSDMELLFDVFLETVREAAAGNIGGQTVRERLAQRLCPPELPIPGS-GLPPPRKVLILGSGGLS--IGQAGEFDYSGSQAIKALKEENIQTLLINPNIATVQTS---QGLADKVYFLPITLHYVTQVIRNERPDGVLLTFGGQTALNCGVELTKAGVLARYGVRVLGTPVETIELTEDRRAFAARMAEIGEHVAPSEAANSLEQAQAAAERLGYPVLVRAAFALGGLGSGFASTKEELSALVAPAFAHTSQVLIDKSLKGWKEIEYEVVRDAYGNCVTVCNMENLDPLGIHTGESIVVAPSQTLNDREYQLLRRTAIKVTQHLGIVGECNVQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPELRNSVTGGTAA-FEPSLDYCVVKIPRWDLSKFLRVSTKIGSCMKSVGEVMGIGRSFEEAFQKALRMVDENCVGF--------DHTVKPVSDMELETPTDKRIFVVAAALWAGYSVERLYELTRIDCWFLHRMKRIVTHAQLLEQHRG--QALPQDLLHQAKCLGFSDKQIALAVLSTELAVRKLRQELGICPAVKQIDTVAAEWPAQTNYLYLTYWGNTHDLDFRAPHVLVLGSGVYRIGSSVEFDWCAVGCIQQLRKMGYKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGVILSMGGQLPNNMAMALHRQQCRVLGTSPEAIDSAENRFKFSRLLDTIGISQPQWRELSDLESARQFCHTVGYPCVVRPSYVLSGAAMNVAYTDGDLERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAVACDGIVSAIAISEHVENAGVHSGDATLVTPPQDITPKTLERIKAIVHAVGQELQVTGPFNLQLIAKDDQLKVIECNVRVSRSFPFVSKTLGVDLVALATRIIMGEKVEPVGLMT------GSGVVGVKVPQFSFSRLAGADVVLGVEMTSTGEVAGFGESRCEAYLKAMLSTGFKIPEKNILLTIG-SYKNKSELLPTVRLLESLGYSLYASLGTADFYTEHGVKVTAVDW--HFEEAVDGECPPQRSILDQLAENHFELVINLSMRGAGGRRLSSFVTKGYRTRRLAADFSVPLIIDIKCTKLFVEALGQIGPAPPLKVHVDCMTSQKL 1461          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Mouse
Match: Cad (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:MGI Symbol;Acc:MGI:1916969])

HSP 1 Score: 1291.95 bits (3342), Expect = 0.000e+0
Identity = 697/1487 (46.87%), Postives = 944/1487 (63.48%), Query Frame = 1
Query:  175 ARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAK-IEFDTDP--IEFKDPNKSNLTADVSTNYIQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIETRN-EPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSKSKTTI-----------------IPSPKTIDFEPPXXXXXXXXXXXXXXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTSTEDFQNLDIPAATKL---ISDKFFDLVINLP------NYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVESLD----------HVDLVTTDSL 4515
            A L L +G V  G  FG   STAGE+VF TG+ GYPE+LTDPSY+ QIL LTYP++GNYG+P ++  D  GL    ES  IHV+GL+V +     SHW++  +L +WL    +P L G+DTR LTK +R+ G++L K ++  T+P  + F DPN   L  +VS    +VF  G   +I  +DCG+K+N I+ L   GAEVT+VPWD++    KYDGLF+SNGPGDPA     V  +  V+   N  P+FGIC G+QL+ LA GA TYK+  GNRGHNQP + V T + F+TSQNHG+ ++ +SL   W  LF NAND +NEGI++   P F+ QFHPE   GP+D E LFD ++E V+  +   I                 +P P +    PP+   +L  G     IGQAGEFDYSGSQAIKALKEE I+T+L+NPNIA+VQT+      AD VYFLP+T  +V +V+  ERPDG+LL+ GGQTALN G+EL + G+L++Y V+VLGTP+++I  TEDR++FA  + EIG  +APS A  S+E A  AA ++GYPV+VRAAFALGGLGSG A  KE+L  +   AFA T+QVLI++SL GWKE+                                           EY ++R+            G C          + Y IIE+NARLSRSSALASKATGYPLA++AAKLALGI L +++N+ T  T+A FEPSLDY   KIPRWDL +F     +IGS MKSVGEVM IGR+FEE+ QKALRM   +  G         D++     D  L TP++ RI  +  A   GYSVE+++ LT+ID WFLH++KRIV  A  + +  G  ++L  + L  AK  GFSDKQI L +  +E+ VR++RQ + I P VK IDT+AAE+P  TNYLY +Y G  HD+ F    V+VLG G Y IGSSVEFDWCAV  I+ LRK G +T+++N+NPETVSTD+D  DRLYF+E+S E V+DIY+ ENP+G I+S+GGQ+PNN+A+ L +    +LGT P  ID AE+R KFS +LD I + Q  WR LS ++ A +F   VGYPC+VRPSY+LSG+AMNVAYT  +L  FL SA  +S+++PVVI+KF++ AKEI+ DA+A DG++   A+SEH+ENAGVHSGDATLV PP  I+     +I+ I   + ++ +++GPFN+Q + K+ ++ VIECN+R SRS PFVSKT+G D++A AT+++M   ++     T          +G+K P FS+ RL  AD VL  EM+STGEVA FGE+   A+LKA+ S+ F++P KN  + IG  ++ +   LPT + L   GY++YA+  TA++   H +    V W    E+  + + P    +   +++  F+LVINL          + +VT+ Y  RR A D + PL+I+ +  K+ VE+L           HVD +T+  L
Sbjct:    2 AALVLEDGSVLQGRPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILVLTYPLIGNYGIP-SDEEDEFGLSKWFESSEIHVAGLVVGECCPTPSHWSANCTLHEWLQQRGIPGLQGVDTRELTKKLREQGSLLGKLVQKGTEPSALPFVDPNARPLAPEVSIKTPRVFNAGGAPRICALDCGLKYNQIRCLCQLGAEVTVVPWDHELDSQKYDGLFLSNGPGDPASYPGVVSTLSRVLSEPNPRPVFGICLGHQLLALAIGAKTYKMRYGNRGHNQPCLLVGTGRCFLTSQNHGFAVDADSLPAGWAPLFTNANDCSNEGIVHDSLPFFSVQFHPEHRAGPSDMELLFDVFLETVREAAAGNIGGQTVRERLAQRLCPPELPIPGS-GLPPPRKVLILGSGGLS--IGQAGEFDYSGSQAIKALKEENIQTLLINPNIATVQTS---QGLADKVYFLPITLHYVTQVIRNERPDGVLLTFGGQTALNCGVELTKAGVLARYGVRVLGTPVETIELTEDRRAFAARMAEIGEHVAPSEAANSLEQAQAAAERLGYPVLVRAAFALGGLGSGFASTKEELSALVAPAFAHTSQVLIDKSLKGWKEI-------------------------------------------EYEVVRDA----------YGNC----------VTYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPELRNSVTGGTAA-FEPSLDYCVVKIPRWDLSKFLRVSTKIGSCMKSVGEVMGIGRSFEEAFQKALRMVDENCVGF--------DHTVKPVSDMELETPTDKRIFVVAAALWAGYSVERLYELTRIDCWFLHRMKRIVTHAQLLEQHRG--QALPQDLLHQAKCLGFSDKQIALAVLSTELAVRKLRQELGICPAVKQIDTVAAEWPAQTNYLYLTYWGNTHDLDFRAPHVLVLGSGVYRIGSSVEFDWCAVGCIQQLRKMGYKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGVILSMGGQLPNNMAMALHRQQCRVLGTSPEAIDSAENRFKFSRLLDTIGISQPQWRELSDLESARQFCHTVGYPCVVRPSYVLSGAAMNVAYTDGDLERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAVACDGIVSAIAISEHVENAGVHSGDATLVTPPQDITPKTLERIKAIVHAVGQELQVTGPFNLQLIAKDDQLKVIECNVRVSRSFPFVSKTLGVDLVALATRIIMGEKVEPVGLMT------GSGVVGVKVPQFSFSRLAGADVVLGVEMTSTGEVAGFGESRCEAYLKAMLSTGFKIPEKNILLTIG-SYKNKSELLPTVRLLESLGYSLYASLGTADFYTEHGVKVTAVDW--HFEEAVDGECPPQRSILDQLAENHFELVINLSMRGAGGRRLSSFVTKGYRTRRLAADFSVPLIIDIKCTKLFVEALGQIGPAPPLKVHVDCMTSQKL 1398          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. UniProt/SwissProt
Match: sp|P31327|CPSM_HUMAN (Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens OX=9606 GN=CPS1 PE=1 SV=2)

HSP 1 Score: 1847.4 bits (4784), Expect = 0.000e+0
Identity = 890/1455 (61.17%), Postives = 1140/1455 (78.35%), Query Frame = 1
Query:  175 ARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAKIEFDTDPIEFKDPNKSNLTADVSTNYIQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIET-RNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSKSKTTI---IPSPKTIDFEPPXXXXXXXXXXXXXXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTSTEDFQNLDIPAATKLISDKFFDLVINLPNYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVESLDHVDLVTTDSLFNYQ 4527
            A + L +G    GYSFG+  S AGE+VFNTGL GYPE++TDP+Y+GQILT+  PI+GN G PDT A D  GL   +ES  I VSGL+V DYS+  +HW + KSL QWL +EKVPA++G+DTRMLTKI+RD G +L KIEF+  P++F DPNK NL A+VST  ++V+G+GNP K+V VDCGIK+N+I++L+ RGAEV LVPW++DFTK +YDG+ I+ GPG+PAL    ++N++ ++E+ R EPLFGI  GN + GLAAGA TYK+ + NRG NQPV+N+   QAFIT+QNHGY L+  +L   WK LF+N ND+TNEGIM+  KP F  QFHPE   GP DTE+LFD++  ++K    TTI   +P P  +     +V KVL+LGSGGLSIGQAGEFDYSGSQA+KA+KEE ++T+LMNPNIASVQTN  G KQAD VYFLP+T +FV +V++ E+PDG++L MGGQTALN G+EL ++G+L +Y VKVLGT ++SI+ATEDRQ F+D L EI  K+APS AV SIEDA++AA+ IGYPVM+R+A+ALGGLGSGI  N+E LMD+  +AFAMTNQ+L+E+S+ GWKE+EYEVVRDA DNC+TVCNMEN D +GVHTGDS+VVAP+QTLSN E+ MLR T++ V+RH GIVGECNIQ+ALHP S+EYCIIE+NARLSRSSALASKATGYPLAFIAAK+ALGI L +IKN  +  TSACFEPSLDY+ TKIPRWDLDRFH T   IGSSMKSVGEVMAIGRTFEES QKALRM HPS+ G T +L   K++  N DL K L  PS++RI+ I  A +   S+++I  LT ID WFL+K++ I+++   +  +N   +S++ E L  AK+ GFSDKQI   +G +E + RE+R    I PWVK IDT+AAEYP+VTNYLY +YNG EHDV FD  G+MVLGCGPYHIGSSVEFDWCAVS+IR LR+ G++TVV+N NPETVSTDFDE D+LYFEELSLER+LDIY  E   G IISVGGQIPNNLA+PL+KN V I+GT P +ID AEDRS FSA+LDE+ V QA W++++++++ALEFA  V YPCL+RPSY+LSGSAMNV ++ +E+  FL+ A ++SQ++PVV+TKF+EGA+E+E DA+ KDG ++ HA+SEH+E+AGVHSGDATL+LP  TIS+    ++++ + KIAK F ISGPFNVQFLVK  ++LVIECNLRASRS PFVSKT+G D I  ATKVM+   +DEK   T+D+P  P +Y+ IK+PMFSWPRL  ADP+LRCEM+STGEVACFGE ++TAFLKA+ S+ F++P+K   ILIG+Q  F+PRFL  A+ LH+ G+ ++ATEAT+++L  + +PA  V+WP  +++ QN  + +  KLI D   DLVINLPN  TK+V +NY+IRR A+DS  PL+ NF++ K+  E++     V + SLF+Y+
Sbjct:   46 AHIVLEDGTKMKGYSFGHPSSVAGEVVFNTGLGGYPEAITDPAYKGQILTMANPIIGNGGAPDTTALDELGLSKYLESNGIKVSGLLVLDYSKDYNHWLATKSLGQWLQEEKVPAIYGVDTRMLTKIIRDKGTMLGKIEFEGQPVDFVDPNKQNLIAEVSTKDVKVYGKGNPTKVVAVDCGIKNNVIRLLVKRGAEVHLVPWNHDFTKMEYDGILIAGGPGNPALAEPLIQNVRKILESDRKEPLFGISTGNLITGLAAGAKTYKMSMANRGQNQPVLNITNKQAFITAQNHGYALDN-TLPAGWKPLFVNVNDQTNEGIMHESKPFFAVQFHPEVTPGPIDTEYLFDSFFSLIKKGKATTITSVLPKPALVASRV-EVSKVLILGSGGLSIGQAGEFDYSGSQAVKAMKEENVKTVLMNPNIASVQTNEVGLKQADTVYFLPITPQFVTEVIKAEQPDGLILGMGGQTALNCGVELFKRGVLKEYGVKVLGTSVESIMATEDRQLFSDKLNEINEKIAPSFAVESIEDALKAADTIGYPVMIRSAYALGGLGSGICPNRETLMDLSTKAFAMTNQILVEKSVTGWKEIEYEVVRDADDNCVTVCNMENVDAMGVHTGDSVVVAPAQTLSNAEFQMLRRTSINVVRHLGIVGECNIQFALHPTSMEYCIIEVNARLSRSSALASKATGYPLAFIAAKIALGIPLPEIKNVVSGKTSACFEPSLDYMVTKIPRWDLDRFHGTSSRIGSSMKSVGEVMAIGRTFEESFQKALRMCHPSIEGFTPRLPMNKEWPSNLDLRKELSEPSSTRIYAIAKAIDDNMSLDEIEKLTYIDKWFLYKMRDILNMEKTLKGLNS--ESMTEETLKRAKEIGFSDKQISKCLGLTEAQTRELRLKKNIHPWVKQIDTLAAEYPSVTNYLYVTYNGQEHDVNFDDHGMMVLGCGPYHIGSSVEFDWCAVSSIRTLRQLGKKTVVVNCNPETVSTDFDECDKLYFEELSLERILDIYHQEACGGCIISVGGQIPNNLAVPLYKNGVKIMGTSPLQIDRAEDRSIFSAVLDELKVAQAPWKAVNTLNEALEFAKSVDYPCLLRPSYVLSGSAMNVVFSEDEMKKFLEEATRVSQEHPVVLTKFVEGAREVEMDAVGKDGRVISHAISEHVEDAGVHSGDATLMLPTQTISQGAIEKVKDATRKIAKAFAISGPFNVQFLVKGNDVLVIECNLRASRSFPFVSKTLGVDFIDVATKVMIGENVDEKHLPTLDHPIIPADYVAIKAPMFSWPRLRDADPILRCEMASTGEVACFGEGIHTAFLKAMLSTGFKIPQK--GILIGIQQSFRPRFLGVAEQLHNEGFKLFATEATSDWLNANNVPATPVAWP--SQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQKSRKVDSKSLFHYR 1492          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. UniProt/SwissProt
Match: sp|Q8C196|CPSM_MOUSE (Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Mus musculus OX=10090 GN=Cps1 PE=1 SV=2)

HSP 1 Score: 1845.86 bits (4780), Expect = 0.000e+0
Identity = 889/1455 (61.10%), Postives = 1143/1455 (78.56%), Query Frame = 1
Query:  175 ARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAKIEFDTDPIEFKDPNKSNLTADVSTNYIQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIET-RNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSKSKTTI---IPSPKTIDFEPPXXXXXXXXXXXXXXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTSTEDFQNLDIPAATKLISDKFFDLVINLPNYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVESLDHVDLVTTDSLFNYQ 4527
            A + L +G    GYSFG+  S AGE+VFNTGL GYPE+LTDP+Y+GQILT+  PI+GN G PDT ARD  GL   +ES+ I V+GL+V +YS   +HW + KSL QWL +EKVPA++G+DTRMLTKI+RD G +L KIEF+   ++F DPNK NL A+VST  ++VFG+GNP K+V VDCGIK+N+I++L+ RGAEV LVPW++DFT+ +YDGL I+ GPG+PAL    ++N+K ++E+ R EPLFGI  GN + GLAAGA +YK+ + NRG NQPV+N+   QAFIT+QNHGY L+  +L   WK LF+N ND+TNEGIM+  KP F  QFHPE   GPTDTE+LFD++  ++K    TTI   +P P  +     +V KVL+LGSGGLSIGQAGEFDYSGSQA+KA+KEE ++T+LMNPNIASVQTN  G KQAD VYFLP+T +FV +V++ ERPDG++L MGGQTALN G+EL ++G+L +Y VKVLGT ++SI+ATEDRQ F+D L EI  K+APS AV S+EDA++AA+ IGYPVM+R+A+ALGGLGSGI  NKE L+D+  +AFAMTNQ+L+E+S+ GWKE+EYEVVRDA DNC+TVCNMEN D +GVHTGDS+VVAP+QTLSN E+ MLR T++ V+RH GIVGECNIQ+ALHP S+EYCIIE+NARLSRSSALASKATGYPLAFIAAK+ALGI L +IKN  +  TSACFEPSLDY+ TKIPRWDLDRFH T   IGSSMKSVGEVMAIGRTFEES QKALRM HPS++G T +L   K++  N DL K L  PS++RI+ I  A E   S+++I  LT ID WFL+K++ I+++   +  +N +  S++ E L  AK+ GFSDKQI   +G +E + RE+R    I PWVK IDT+AAEYP+VTNYLY +YNG EHD+ FD+ G+MVLGCGPYHIGSSVEFDWCAVS+IR LR+ G++TVV+N NPETVSTDFDE D+LYFEELSLER+LDIY  E   G IISVGGQIPNNLA+PL+KN V I+GT P +ID AEDRS FSA+LDE+ V QA W++++++++ALEFA+ VGYPCL+RPSY+LSGSAMNV ++ +E+  FL+ A ++SQ++PVV+TKF+EGA+E+E DA+ K+G ++ HA+SEH+E+AGVHSGDATL+LP  TIS+    ++++ + KIAK F ISGPFNVQFLVK  ++LVIECNLRASRS PFVSKT+G D I  ATKVM+   +DEK   T++ P  P +Y+ IK+PMFSWPRL  ADP+LRCEM+STGEVACFGE ++TAFLKA+ S+ F++P+K   ILIG+Q  F+PRFL  A+ LH+ G+ ++ATEAT+++L  + +PA  V+WP  +++ QN  + +  KLI D   DLVINLPN  TK+V +NY+IRR A+DS   L+ NF++ K+  E++     V + SLF+Y+
Sbjct:   46 AHIVLEDGTKMKGYSFGHPSSVAGEVVFNTGLGGYPEALTDPAYKGQILTMANPIIGNGGAPDTTARDELGLNKYMESDGIKVAGLLVLNYSNDYNHWLATKSLGQWLQEEKVPAIYGVDTRMLTKIIRDKGTMLGKIEFEGQSVDFVDPNKQNLIAEVSTKDVKVFGKGNPTKVVAVDCGIKNNVIRLLVKRGAEVHLVPWNHDFTQMEYDGLLIAGGPGNPALAQPLIQNVKKILESDRKEPLFGISTGNIITGLAAGAKSYKMSMANRGQNQPVLNITNRQAFITAQNHGYALDN-TLPAGWKPLFVNVNDQTNEGIMHESKPFFAVQFHPEVSPGPTDTEYLFDSFFSLIKKGKGTTITSVLPKPALVASRV-EVSKVLILGSGGLSIGQAGEFDYSGSQAVKAMKEENVKTVLMNPNIASVQTNEVGLKQADAVYFLPITPQFVTEVIKAERPDGLILGMGGQTALNCGVELFKRGVLKEYGVKVLGTSVESIMATEDRQLFSDKLNEINEKIAPSFAVESMEDALKAADTIGYPVMIRSAYALGGLGSGICPNKETLIDLGTKAFAMTNQILVERSVTGWKEIEYEVVRDADDNCVTVCNMENVDAMGVHTGDSVVVAPAQTLSNAEFQMLRRTSVNVVRHLGIVGECNIQFALHPTSMEYCIIEVNARLSRSSALASKATGYPLAFIAAKIALGIPLPEIKNVVSGKTSACFEPSLDYMVTKIPRWDLDRFHGTSSRIGSSMKSVGEVMAIGRTFEESFQKALRMCHPSVDGFTPRLPMNKEWPANLDLKKELSEPSSTRIYAIAKALENNMSLDEIVRLTSIDKWFLYKMRDILNMDKTLKGLNSD--SVTEETLRKAKEIGFSDKQISKCLGLTEAQTRELRLKKNIHPWVKQIDTLAAEYPSVTNYLYVTYNGQEHDIKFDEHGIMVLGCGPYHIGSSVEFDWCAVSSIRTLRQLGKKTVVVNCNPETVSTDFDECDKLYFEELSLERILDIYHQEACNGCIISVGGQIPNNLAVPLYKNGVKIMGTSPLQIDRAEDRSIFSAVLDELKVAQAPWKAVNTLNEALEFANSVGYPCLLRPSYVLSGSAMNVVFSEDEMKRFLEEATRVSQEHPVVLTKFVEGAREVEMDAVGKEGRVISHAISEHVEDAGVHSGDATLMLPTQTISQGAIEKVKDATRKIAKAFAISGPFNVQFLVKGNDVLVIECNLRASRSFPFVSKTLGVDFIDVATKVMIGESIDEKRLPTLEQPIIPSDYVAIKAPMFSWPRLRDADPILRCEMASTGEVACFGEGIHTAFLKAMLSTGFKIPQK--GILIGIQQSFRPRFLGVAEQLHNEGFKLFATEATSDWLNANNVPATPVAWP--SQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIALLTNFQVTKLFAEAVQKSRTVDSKSLFHYR 1492          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. UniProt/SwissProt
Match: sp|P07756|CPSM_RAT (Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Rattus norvegicus OX=10116 GN=Cps1 PE=1 SV=1)

HSP 1 Score: 1845.09 bits (4778), Expect = 0.000e+0
Identity = 889/1455 (61.10%), Postives = 1141/1455 (78.42%), Query Frame = 1
Query:  175 ARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAKIEFDTDPIEFKDPNKSNLTADVSTNYIQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIET-RNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSKSKTTI---IPSPKTIDFEPPXXXXXXXXXXXXXXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTSTEDFQNLDIPAATKLISDKFFDLVINLPNYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVESLDHVDLVTTDSLFNYQ 4527
            A + L +G    GYSFG+  S AGE+VFNTGL GY E+LTDP+Y+GQILT+  PI+GN G PDT ARD  GL   +ES+ I V+GL+V +YS   +HW + KSL QWL +EKVPA++G+DTRMLTKI+RD G +L KIEF+   ++F DPNK NL A+VST  ++VFG+GNP K+V VDCGIK+N+I++L+ RGAEV LVPW++DFT+  YDGL I+ GPG+PAL    ++N+K ++E+ R EPLFGI  GN + GLAAGA +YK+ + NRG NQPV+N+   QAFIT+QNHGY L+  +L   WK LF+N ND+TNEGIM+  KP F  QFHPE   GPTDTE+LFD++  ++K    TTI   +P P  +     +V KVL+LGSGGLSIGQAGEFDYSGSQA+KA+KEE ++T+LMNPNIASVQTN  G KQAD VYFLP+T +FV +V++ ERPDG++L MGGQTALN G+EL ++G+L +Y VKVLGT ++SI+ATEDRQ F+D L EI  K+APS AV S+EDA++AA+ IGYPVM+R+A+ALGGLGSGI  NKE LMD+  +AFAMTNQ+L+E+S+ GWKE+EYEVVRDA DNC+TVCNMEN D +GVHTGDS+VVAP+QTLSN E+ MLR T++ V+RH GIVGECNIQ+ALHP S+EYCIIE+NARLSRSSALASKATGYPLAFIAAK+ALGI L +IKN  +  TSACFEPSLDY+ TKIPRWDLDRFH T   IGSSMKSVGEVMAIGRTFEES QKALRM HPS++G T +L   K++  N DL K L  PS++RI+ I  A E   S+++I  LT ID WFL+K++ I+++   +  +N   +S++ E L  AK+ GFSDKQI   +G +E + RE+R    I PWVK IDT+AAEYP+VTNYLY +YNG EHD+ FD+ G+MVLGCGPYHIGSSVEFDWCAVS+IR LR+ G++TVV+N NPETVSTDFDE D+LYFEELSLER+LDIY  E   G IISVGGQIPNNLA+PL+KN V I+GT P +ID AEDRS FSA+LDE+ V QA W++++++++ALEFA+ VGYPCL+RPSY+LSGSAMNV ++ +E+  FL+ A ++SQ++PVV+TKF+EGA+E+E DA+ K+G ++ HA+SEH+E+AGVHSGDATL+LP  TIS+    ++++ + KIAK F ISGPFNVQFLVK  ++LVIECNLRASRS PFVSKT+G D I  ATKVM+   +DEK   T++ P  P +Y+ IK+PMFSWPRL  ADP+LRCEM+STGEVACFGE ++TAFLKA+ S+ F++P+K   ILIG+Q  F+PRFL  A+ LH+ G+ ++ATEAT+++L  + +PA  V+WP  +++ QN  + +  KLI D   DLVINLPN  TK+V +NY+IRR A+DS   L+ NF++ K+  E++     V + SLF+Y+
Sbjct:   46 AHIVLEDGTKMKGYSFGHPSSVAGEVVFNTGLGGYSEALTDPAYKGQILTMANPIIGNGGAPDTTARDELGLNKYMESDGIKVAGLLVLNYSHDYNHWLATKSLGQWLQEEKVPAIYGVDTRMLTKIIRDKGTMLGKIEFEGQSVDFVDPNKQNLIAEVSTKDVKVFGKGNPTKVVAVDCGIKNNVIRLLVKRGAEVHLVPWNHDFTQMDYDGLLIAGGPGNPALAQPLIQNVKKILESDRKEPLFGISTGNIITGLAAGAKSYKMSMANRGQNQPVLNITNRQAFITAQNHGYALDN-TLPAGWKPLFVNVNDQTNEGIMHESKPFFAVQFHPEVSPGPTDTEYLFDSFFSLIKKGKGTTITSVLPKPALVASRV-EVSKVLILGSGGLSIGQAGEFDYSGSQAVKAMKEENVKTVLMNPNIASVQTNEVGLKQADAVYFLPITPQFVTEVIKAERPDGLILGMGGQTALNCGVELFKRGVLKEYGVKVLGTSVESIMATEDRQLFSDKLNEINEKIAPSFAVESMEDALKAADTIGYPVMIRSAYALGGLGSGICPNKETLMDLGTKAFAMTNQILVERSVTGWKEIEYEVVRDADDNCVTVCNMENVDAMGVHTGDSVVVAPAQTLSNAEFQMLRRTSINVVRHLGIVGECNIQFALHPTSMEYCIIEVNARLSRSSALASKATGYPLAFIAAKIALGIPLPEIKNVVSGKTSACFEPSLDYMVTKIPRWDLDRFHGTSSRIGSSMKSVGEVMAIGRTFEESFQKALRMCHPSVDGFTPRLPMNKEWPANLDLRKELSEPSSTRIYAIAKALENNMSLDEIVKLTSIDKWFLYKMRDILNMDKTLKGLNS--ESVTEETLRQAKEIGFSDKQISKCLGLTEAQTRELRLKKNIHPWVKQIDTLAAEYPSVTNYLYVTYNGQEHDIKFDEHGIMVLGCGPYHIGSSVEFDWCAVSSIRTLRQLGKKTVVVNCNPETVSTDFDECDKLYFEELSLERILDIYHQEACNGCIISVGGQIPNNLAVPLYKNGVKIMGTSPLQIDRAEDRSIFSAVLDELKVAQAPWKAVNTLNEALEFANSVGYPCLLRPSYVLSGSAMNVVFSEDEMKRFLEEATRVSQEHPVVLTKFIEGAREVEMDAVGKEGRVISHAISEHVEDAGVHSGDATLMLPTQTISQGAIEKVKDATRKIAKAFAISGPFNVQFLVKGNDVLVIECNLRASRSFPFVSKTLGVDFIDVATKVMIGESVDEKHLPTLEQPIIPSDYVAIKAPMFSWPRLRDADPILRCEMASTGEVACFGEGIHTAFLKAMLSTGFKIPQK--GILIGIQQSFRPRFLGVAEQLHNEGFKLFATEATSDWLNANNVPATPVAWP--SQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIALLTNFQVTKLFAEAVQKARTVDSKSLFHYR 1492          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. UniProt/SwissProt
Match: sp|Q91293|CPSM_LITCT (Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Lithobates catesbeianus OX=8400 PE=2 SV=1)

HSP 1 Score: 1815.82 bits (4702), Expect = 0.000e+0
Identity = 885/1461 (60.57%), Postives = 1127/1461 (77.14%), Query Frame = 1
Query:  175 ARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDS-GNVLAKIEFDTDPIEFKDPNKSNLTADVSTNYIQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIET-RNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSKSKTT---IIPSP----KTIDFEPPXXXXXXXXXXXXXXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTSTEDFQNLDIPAAT-KLISDKFFDLVINLPNYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVESLDHVDLVTTDSLFNYQ 4527
            A L L +G    GYSFG+  S AGE++FNTGL GY E++TDPSY GQILTLT PI+GN G PDT ARD+ GLM  +ESE I  SGL+V DYS   SHW +VKSLS+WL +EKVPAL GIDTRML K +RD+ G VL KIEF+  P+EF DPNK NL A+VST   +VFG+GNP +IV VDCG+KHN+I+ L+ RGAEV LVPW++DF++ +YDGL I++GPG+P L    ++N+K V ++ R EP+FGIC GN++  LAAG  TY+LP+ NRG NQPV+  +  QAFIT+QNH Y ++  SL   WK LF+N ND++NEGIM+  KPIFT+QFHPEA  GP DTEFLFD YM ++K    TT   ++P P    K ID       KVL+LGSGGLSIGQAGEFDYSGSQA+KA+KEE ++T+LMNPNIASVQTN  G KQAD VYFLP+T +FV +V++ E+ DGI+L MGGQTALN G+EL ++G+L +Y V+VLGT ++SI+ TEDRQ F+D L EI   +APS AV S++DA+EAA++IGYPVM+R+A+ALGGLGSG+  +KE L D+  +A AMTNQ+L+E+S++GWKE+EYEVVRDAADNC+TVCNMEN D +GVHTGDSIVVAP QTLSN E  MLR  ++KV+RH GIVGECNIQ+ALHP SLEY IIE+NARLSRSSALASKATGYPLAFIAAK+ALGI L +IKN  +  T+ACFEPSLDY+ TKIPRWDLDRFH     IGSSMKSVGEVMAIGRTFEES QKALRM HPS++G TS L   K +S + +L K +  P+++R++ +  A + G S+++I+ LT ID WFL+K++ I+++   +       +S+  E L  AKQ GFSD+ IG  +G SE + RE+R +  + PWVK IDT+AAEYP +TNYLY +YNG EHD+ FD  G+MVLGCGPYHIGSSVEFDWCAVS+IR LR  G++TVV+N NPETVSTDFDE D+LYFEELS ER++D++Q E   G IISVGGQIPNNLA+PL+KN V I+GT P +ID AEDRS FSA+LDE+ + QA W++++S+DDAL+F   VGYPCL+RPSY+LSGSAMNV Y   EL  FL  A ++SQ++PVVITKF+EGA+E+E DA+ K+G ++ HA+SEH+E+AGVHSGDATL++P  +IS+    +++  + KIA  F ISGPFNVQFLV+  ++LVIECNLRASRS PFVSKT+G D I  ATKVM+   +DE    T++ P  P +Y+GIK+PMFSWPRL  ADPVL+CEM+STGEVACFG+NVY+AFLKA+ S+ F+LP+K   ILIG+QH F+P FL TA++L D G+ +YATEATA++L  + I A  V+WP+     +    P++  KLI +   D+VINLPN  TKYV +N+ IRR A+D+ T L+ NF++VKM  E++ +   +   SLF+Y+
Sbjct:   41 ANLVLEDGTKIKGYSFGHPASVAGEVIFNTGLGGYVEAVTDPSYHGQILTLTNPIIGNGGAPDTKARDAYGLMKYIESENIQASGLLVLDYSHEYSHWGAVKSLSEWLHEEKVPALCGIDTRMLAKKIRDNKGAVLGKIEFEGQPVEFIDPNKRNLIAEVSTKETKVFGKGNPVRIVAVDCGVKHNIIRQLVKRGAEVHLVPWNHDFSQMEYDGLLITSGPGNPELAKPLIQNLKKVFQSDRPEPIFGICKGNEIAALAAGGKTYRLPMANRGQNQPVMITLNGQAFITAQNHAYAVDNNSLPAGWKPLFVNINDQSNEGIMHETKPIFTSQFHPEANPGPVDTEFLFDVYMSLIKKGKGTTLTSVMPKPALQSKRIDV-----AKVLILGSGGLSIGQAGEFDYSGSQAVKAMKEENVKTVLMNPNIASVQTNEVGLKQADTVYFLPITPQFVTEVIKAEKTDGIILGMGGQTALNCGVELFKRGVLKEYGVRVLGTSVESIMFTEDRQLFSDKLNEIKEPIAPSFAVESVKDALEAADKIGYPVMIRSAYALGGLGSGLCPDKETLTDLATKALAMTNQILVERSVVGWKEIEYEVVRDAADNCVTVCNMENVDAMGVHTGDSIVVAPCQTLSNEECQMLRAVSIKVVRHLGIVGECNIQFALHPTSLEYVIIEVNARLSRSSALASKATGYPLAFIAAKIALGIPLPEIKNVVSGKTTACFEPSLDYMVTKIPRWDLDRFHGASGLIGSSMKSVGEVMAIGRTFEESFQKALRMCHPSVDGFTSNLPMNKAWSSDVNLRKEMAEPTSTRMYSMAKAIQSGISLDEINKLTAIDKWFLYKMQGILNMEKTLK--GSRSESVPEETLRRAKQIGFSDRYIGKCLGLSETQTRELRLNKNVKPWVKQIDTLAAEYPAITNYLYLTYNGQEHDIKFDDHGMMVLGCGPYHIGSSVEFDWCAVSSIRTLRHVGKKTVVVNCNPETVSTDFDECDKLYFEELSQERIMDVFQLEQCDGCIISVGGQIPNNLAVPLYKNGVKIMGTSPMQIDRAEDRSIFSAVLDELQIAQAPWKAVNSLDDALQFTKTVGYPCLLRPSYVLSGSAMNVVYGEEELKTFLAEATRVSQEHPVVITKFIEGAREVEMDAVGKEGRVISHAISEHVEDAGVHSGDATLMIPTQSISQGAIEKVKIATKKIATAFAISGPFNVQFLVRGNDVLVIECNLRASRSFPFVSKTLGVDFIDVATKVMIGEKIDESSLPTLERPVIPADYVGIKAPMFSWPRLRGADPVLKCEMASTGEVACFGQNVYSAFLKAMISTGFKLPQK--GILIGIQHSFRPHFLGTAQTLKDEGFKLYATEATADWLNANDITATPVAWPSQ----EGQSGPSSIYKLIKEGNIDMVINLPNNNTKYVRDNFAIRRTAVDTGTALLTNFQVVKMFAEAIKYSGDLDAKSLFHYR 1488          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. UniProt/SwissProt
Match: sp|Q09794|PYR1_SCHPO (Protein ura1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ura1 PE=1 SV=1)

HSP 1 Score: 1504.58 bits (3894), Expect = 0.000e+0
Identity = 781/1480 (52.77%), Postives = 1033/1480 (69.80%), Query Frame = 1
Query:  181 LHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDS-NGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAK--IEFDTDPIE-------------------FKDPNKSNLTADVSTNYIQVF----------GRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIETRNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSKSKTTIIPSPK----TIDFEPPX-----XXXXXXXXXXXXXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTSTEDFQNLDIPAATKLISDKFFDLVINLPN---YK--TKYVTENYLIRRAAIDSATPLMINFELVKMLVESL 4482
            L L +  V  GYSFG D S +GELVF TG+ GYPESLTDPSYRGQIL  T+P VGNYGVPD    D  +GL    ES +IHV+ +I+  YS+  SH+ +  SL +WL ++ +P +FGIDTR LTK +RD G++L +  I+ D  PI                    +K+PN  NLT+ VS    +++            G   +I+ +D G+K+N I+  + RG E+ +VPWDYDFTK+ YDGLFISNGPGDP+L+   V  +K V+E++  P+FGICFG+Q++  AAGA+T K+  GNRGHN P   +I+ + +ITSQNHGY ++  SLS+ WK LF+NAND +NEGI NT+ P F+ QFHPE+  GP DTEFLFD ++++VK  +    +   K    TI+    +      K+VL+LGSGGLSIGQAGEFDYSGSQAIKAL+EEGI TIL+NPNIA++QT+      AD VYFLPV A+FV KV+++ERPD I ++ GGQTALNVGIEL ++    +  VKVLGTPI +II TEDR+ FA  + EI  K A S +  SIE+AI+ +  I +PV+VRAA+ALGGLGSG ADN+ +L+D+C  AFA + QVLIE+S+ GWKE+EYEVVRDA DNCITVCNMENFDPLG+HTGDSIVVAPSQTL++ +Y+MLR TA+ VIRH G+VGECNIQYAL+P + EYCIIE+NARLSRSSALASKATGYPLAF AAKL L I L ++KN+ T++T ACFEPSLDY+  KIPRWDL +F     ++ S+MKSVGEVM+IGRTFEE++QKA+R    S  G   K            +D  L TPS+ R+  I NA   GYSV++I  LT+ID WFL K+  ++  +  IS+   ++ SL    L  AKQ GF+D QI   +  +E+ VR IR    I P+VK IDT+AAE+P  TNYLY +YN +EHD+ F+ +GVMVLG G Y IGSSVEFDWCAV A+R LR  G +T+++N+NPETVSTD+DE+DRLYFE + LE VLDIY+ E+  G II++GGQ  NN+ALPL + +V ILGT P  ID AE+R KFS +LD+I V Q  W+ L+S D+A +F   VGYP LVRPSY+LSG+AMN  Y+ ++L  +L+ A  I++D+PVVI+K++E AKEIE DA+A++G +V H +SEH+ENAGVHSGDATLVLPP  ++     +I + ++KI +   I+GP+N+QF+ K+ EI VIECN+RASRS PFVSK IG DMI+ AT V+M  P+  + Y  +D PR+   Y+ +K P FS+ RL+ ADPVL  EM+STGEVACFG N + A+LKA+ S+ FRLP+KN  I IG   E +   LP  K L+++ YNI+AT  T++Y     +P   ++   + E      + A    +++   D+ INLP+   Y+    Y++  Y  RR AID + PL+ N +  K+++E++
Sbjct:   61 LELEDKSVLQGYSFGADHSVSGELVFQTGMVGYPESLTDPSYRGQILVFTFPTVGNYGVPDRRILDEISGLPKYFESNQIHVAAIIISSYSQNYSHFLAHSSLGEWLKEQGIPGIFGIDTRALTKKIRDQGSMLGRLLIQKDESPINPSSITGLGKDWSTAFEDIPWKNPNTENLTSQVSIKEPKLYEPHPTTAIKKADGKIIRILVIDVGMKYNQIRCFLNRGVELLVVPWDYDFTKETYDGLFISNGPGDPSLMDLVVDRVKRVLESKTVPVFGICFGHQIMARAAGASTTKMKFGNRGHNIPCTCMISGRCYITSQNHGYAVDASSLSNGWKELFVNANDGSNEGIYNTEYPFFSVQFHPESTPGPRDTEFLFDVFIDVVKRSADAKSLQPFKLPGGTIEENRSRHPLVDAKRVLILGSGGLSIGQAGEFDYSGSQAIKALREEGIYTILINPNIATIQTSK---GLADKVYFLPVNADFVRKVIKQERPDSIYVTFGGQTALNVGIELKDE--FEQLGVKVLGTPIDTIITTEDRELFARAMDEINEKCAKSASASSIEEAIKVSKDISFPVIVRAAYALGGLGSGFADNEAELIDLCTLAFATSPQVLIERSMKGWKEIEYEVVRDAFDNCITVCNMENFDPLGIHTGDSIVVAPSQTLTDEDYNMLRTTAVNVIRHLGVVGECNIQYALNPFTKEYCIIEVNARLSRSSALASKATGYPLAFTAAKLGLNIPLNEVKNSVTKVTCACFEPSLDYVVVKIPRWDLKKFTRVSTQLSSAMKSVGEVMSIGRTFEEAIQKAIRAIDYSNTGFNVK-------DALMSIDTELQTPSDQRLFAIANAMASGYSVDRIWELTRIDKWFLEKLMGLIRTSQLISK--HDISSLPISLLKTAKQLGFADVQIAAFMNSTELAVRRIRTEAGIRPFVKQIDTVAAEFPAFTNYLYTTYNAVEHDIHFNDKGVMVLGSGVYRIGSSVEFDWCAVRAVRTLRDRGVKTIMVNYNPETVSTDYDEADRLYFENIGLETVLDIYEQESSSGIIIAMGGQTANNIALPLHRENVKILGTSPEMIDGAENRFKFSRMLDDIGVDQPKWKELTSFDEADKFCDTVGYPVLVRPSYVLSGAAMNTVYSQSDLHSYLQQAVAINKDHPVVISKYIENAKEIELDAVAREGKMVMHVISEHVENAGVHSGDATLVLPPQDLAPTTIERIVDAAAKIGEALNITGPYNIQFIAKDNEIKVIECNVRASRSFPFVSKVIGVDMISMATDVIMGNPI--QPYPDVDLPRD---YVAVKVPQFSFSRLSGADPVLGVEMASTGEVACFGHNKFEAYLKAMISTGFRLPKKNILISIGSYKE-KAELLPYVKKLYENNYNIFATAGTSDYFMESGVPCKYLADLPAEEANNEYSLSAH---LANNMIDMYINLPSNNRYRRPANYISSGYKSRRLAIDYSVPLVTNVKCAKLMIEAI 1517          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. TrEMBL
Match: A0A267E8J7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018998g1 PE=3 SV=1)

HSP 1 Score: 2120.12 bits (5492), Expect = 0.000e+0
Identity = 1036/1472 (70.38%), Postives = 1223/1472 (83.08%), Query Frame = 1
Query:  133 ISAFLSKRINMPTKARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAKIEFDTDPI-EFKDPNKSNLTADVSTNYIQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIETRNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSKSKTTIIPSPKTIDFEPPXXXXXXXXXXXXXXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKG-YSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVK-EGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIP-ANLVSWPTSTEDFQNLD--IPAATKLISDKFFDLVINLPNYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVESLDHVDLVTTDSLFNYQA 4530
            +S  +++R+ +P KARL L +G  FSGYSFG D+S++GE+VFNTGLTGYPESLTDPSYRGQIL LTYPIVGNYGVPDT A D NGL LNVES+ +HV+GLIVQDYS   SHW S  SLS WL  E VPAL GIDTR+LTK +RD G +L KIEF   P+ EF +PN  NLTA+VST  ++VFG+GNP+KIV VDCG+KHNMIKML ARGAEV LVPWDYDFT++ YDGLFI+NGPGDPAL+  T+ NI+ VI TRNEP FGIC GNQLVGLAAG T+YK+PLGNRGHNQ V+N++T QAFITSQNHG+ +NT++L   W+ LFINAND +NEG+M T+KPIFTAQFHPEACGGPTDT+FLFDA++EMVK+KS T I+P P+ +D     V KVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEG++T+LMNPNIASVQTNAEG+KQAD VYFLPVTAEFV KV+E+E+PDGILLSMGGQTALNVGIELHE GIL +++V+VLGT I  I  TEDR++FA+ L  I  KLAPS AV  + +AI+AA+ IGYPVMVRAAFALGGLGSG+A ++  L+DIC++AFA+TNQVLIE+SLLGWKEVEYEVVRDAA+NCITVCNMENFDPLGVHTGDSIVVAPSQTLSN EYHMLRETALKVIRHF IVGECNIQYALHP SLEYCIIEINARLSRSSALASKATGYPLAFIAAKL+LGI L +IKNATT++T+ACFEPSLDYITTKIPRWDLDRFHHTPKEIGS+MKSVGE+MAIGRTFEESLQKALRMTHPS+ G  SKL  GK Y +NFDL + L  PSN+RIH+I  A E+   +V++IH  T+ID WFLHK+KRIVD   D+ ++ G     + E+  LAK+ GFSDKQ+G +  K   EVR  R S+ +TP+VK IDTMAAEYP+ TNYLYCSYN  EHDV F  +G+MVLGCGPYHIGSSVEFDWC+VSAIR L   G +++V+N+NPETVSTDFDE DRLYFEELS ERVLDIYQ E+    I+SVGGQIPN LALPL K  V ILGTHP KIDDAEDR+KFS ILDEI V QA WR+L+S  +ALEFA +VGYPCLVRPSYILSGSAMNVAY P EL GFL  A  ++ ++PVV+TKF+E ++E+ECDA+A +G +V HAL EH+ENAGVHSGDATLVLPPHTI++D+  QIR++  +IA++F I+GPFN QFLV  E ++LVIE NLRASRS PFVSKT+GTD IATATKVM+ +  D+KD +T++NPREP  ++GIK+ MFSWPRL  ADP+LRCEMSSTGEVAC+G N+YTAFLKALQS+ FR+P K S+ILIG+Q EFQ  FLPTAK L D GY +YATEATA++L  + I     V W  +    QN+D  IP ATKL+ DK F LVINLPN ++K++ +NYLIRR AIDSATPL+ NF++  +LVE+L H+D V  +SL++Y++
Sbjct:   31 LSGGVARRLVLPNKARLVLEDGTEFSGYSFGADRSSSGEVVFNTGLTGYPESLTDPSYRGQILVLTYPIVGNYGVPDTQAVDENGLRLNVESDAVHVTGLIVQDYSVDHSHWKSAHSLSHWLKREGVPALSGIDTRLLTKRIRDRGTLLGKIEFSDQPLAEFDNPNLRNLTAEVSTKEVRVFGKGNPHKIVAVDCGVKHNMIKMLCARGAEVHLVPWDYDFTEEPYDGLFITNGPGDPALIKTTIDNIRKVINTRNEPAFGICCGNQLVGLAAGCTSYKMPLGNRGHNQSVLNLVTKQAFITSQNHGFAINTDNLPFGWRPLFINANDGSNEGLMCTEKPIFTAQFHPEACGGPTDTQFLFDAFIEMVKTKSATVIMPEPRLMDARRVPVAKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGVKTVLMNPNIASVQTNAEGEKQADMVYFLPVTAEFVTKVIEREKPDGILLSMGGQTALNVGIELHESGILEQHNVRVLGTQIHDIKLTEDRETFAEELMRINEKLAPSVAVTRVSEAIKAAHDIGYPVMVRAAFALGGLGSGLAKDEASLVDICRKAFAITNQVLIEKSLLGWKEVEYEVVRDAANNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNEEYHMLRETALKVIRHFNIVGECNIQYALHPHSLEYCIIEINARLSRSSALASKATGYPLAFIAAKLSLGISLPEIKNATTKVTTACFEPSLDYITTKIPRWDLDRFHHTPKEIGSAMKSVGEIMAIGRTFEESLQKALRMTHPSVGGFESKLPMGKQYPDNFDLLEGLQVPSNARIHYICRALEQDLMTVDEIHRFTQIDRWFLHKLKRIVDYRKDLEQL-GQANETTSEDWGLAKKLGFSDKQLGEVFRKPVSEVRAHRLSLGLTPYVKQIDTMAAEYPSYTNYLYCSYNAAEHDVAFTDKGIMVLGCGPYHIGSSVEFDWCSVSAIRCLNALGMKSIVVNYNPETVSTDFDECDRLYFEELSQERVLDIYQLESASNCIVSVGGQIPNTLALPLHKAGVRILGTHPTKIDDAEDRAKFSRILDEIGVGQAPWRALTSEKEALEFAEQVGYPCLVRPSYILSGSAMNVAYGPQELRGFLGQAAAVNAEHPVVLTKFIENSREVECDAVASNGQVVAHALCEHVENAGVHSGDATLVLPPHTINEDVKAQIRDVVKRIAERFSITGPFNTQFLVTPEQKVLVIETNLRASRSFPFVSKTLGTDFIATATKVMLGVEPDQKDLYTMENPREPVGFVGIKASMFSWPRLKAADPLLRCEMSSTGEVACYGSNLYTAFLKALQSTGFRVPPKGSSILIGVQKEFQAVFLPTAKRLCDMGYQLYATEATAQWLSQNGIENVRPVGWAFA----QNIDKNIPVATKLVEDKVFSLVINLPNNRSKFLQDNYLIRRTAIDSATPLITNFQVCALLVEALSHLDSVKPESLYHYRS 1497          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. TrEMBL
Match: A0A267G4B6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018998g2 PE=3 SV=1)

HSP 1 Score: 2119.74 bits (5491), Expect = 0.000e+0
Identity = 1035/1472 (70.31%), Postives = 1223/1472 (83.08%), Query Frame = 1
Query:  133 ISAFLSKRINMPTKARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAKIEFDTDPI-EFKDPNKSNLTADVSTNYIQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIETRNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSKSKTTIIPSPKTIDFEPPXXXXXXXXXXXXXXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKG-YSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVK-EGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIP-ANLVSWPTSTEDFQNLD--IPAATKLISDKFFDLVINLPNYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVESLDHVDLVTTDSLFNYQA 4530
            +S  +++R+ +P KARL L +G  FSGYSFG D+S++GE+VFNTGLTGYPESLTDPSYRGQIL LTYPIVGNYGVPDT A D NGL LNVES+ +HV+GLIVQDYS   SHW S  SLS WL  E VPAL GIDTR+LTK +RD G +L KIEF   P+ EF +PN  NLTA+VST  +++FG+GNP+KIV VDCG+KHNMIKML ARGAEV LVPWDYDFT++ YDGLFI+NGPGDPAL+  T+ NI+ VI TRNEP FGIC GNQLVGLAAG T+YK+PLGNRGHNQ V+N++T QAFITSQNHG+ +NT++L   W+ LFINAND +NEG+M T+KPIFTAQFHPEACGGPTDT+FLFDA++EMVK+KS T I+P P+ +D     V KVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEG++T+LMNPNIASVQTNAEG+KQAD VYFLPVTAEFV KV+E+E+PDGILLSMGGQTALNVGIELHE GIL +++V+VLGT I  I  TEDR++FA+ L  I  KLAPS AV  + +AI+AA+ IGYPVMVRAAFALGGLGSG+A ++  L+DIC++AFA+TNQVLIE+SLLGWKEVEYEVVRDAA+NCITVCNMENFDPLGVHTGDSIVVAPSQTLSN EYHMLRETALKVIRHF IVGECNIQYALHP SLEYCIIEINARLSRSSALASKATGYPLAFIAAKL+LGI L +IKNATT++T+ACFEPSLDYITTKIPRWDLDRFHHTPKEIGS+MKSVGE+MAIGRTFEESLQKALRMTHPS+ G  SKL  GK Y +NFDL + L  PSN+RIH+I  A E+   +V++IH  T+ID WFLHK+KRIVD   D+ ++ G     + E+  LAK+ GFSDKQ+G +  K   EVR  R S+ +TP+VK IDTMAAEYP+ TNYLYCSYN  EHDV F  +G+MVLGCGPYHIGSSVEFDWC+VSAIR L   G +++V+N+NPETVSTDFDE DRLYFEELS ERVLDIYQ E+    I+SVGGQIPN LALPL K  V ILGTHP KIDDAEDR+KFS ILDEI V QA WR+L+S  +ALEFA +VGYPCLVRPSYILSGSAMNVAY P EL GFL  A  ++ ++PVV+TKF+E ++E+ECDA+A +G +V HAL EH+ENAGVHSGDATLVLPPHTI++D+  QIR++  +IA++F I+GPFN QFLV  E ++LVIE NLRASRS PFVSKT+GTD IATATKVM+ +  D+KD +T++NPREP  ++GIK+ MFSWPRL  ADP+LRCEMSSTGEVAC+G N+YTAFLKALQS+ FR+P K S+ILIG+Q EFQ  FLPTAK L D GY +YATEATA++L  + I     V W  +    QN+D  IP ATKL+ DK F LVINLPN ++K++ +NYLIRR AIDSATPL+ NF++  +LVE+L H+D V  +SL++Y++
Sbjct:   31 LSGGVARRLVLPNKARLVLEDGTEFSGYSFGADRSSSGEVVFNTGLTGYPESLTDPSYRGQILVLTYPIVGNYGVPDTQAVDENGLRLNVESDAVHVTGLIVQDYSVDHSHWKSAHSLSHWLKREGVPALSGIDTRLLTKRIRDRGTLLGKIEFSDQPLAEFDNPNLRNLTAEVSTKEVRIFGKGNPHKIVAVDCGVKHNMIKMLCARGAEVHLVPWDYDFTEEPYDGLFITNGPGDPALIKTTIDNIRKVINTRNEPAFGICCGNQLVGLAAGCTSYKMPLGNRGHNQSVLNLVTKQAFITSQNHGFAINTDNLPFGWRPLFINANDGSNEGLMCTEKPIFTAQFHPEACGGPTDTQFLFDAFIEMVKTKSATVIMPEPRLMDARRVPVAKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGVKTVLMNPNIASVQTNAEGEKQADMVYFLPVTAEFVTKVIEREKPDGILLSMGGQTALNVGIELHESGILEQHNVRVLGTQIHDIKLTEDRETFAEELMRINEKLAPSVAVTRVSEAIKAAHDIGYPVMVRAAFALGGLGSGLAKDEASLVDICRKAFAITNQVLIEKSLLGWKEVEYEVVRDAANNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNEEYHMLRETALKVIRHFNIVGECNIQYALHPHSLEYCIIEINARLSRSSALASKATGYPLAFIAAKLSLGISLPEIKNATTKVTTACFEPSLDYITTKIPRWDLDRFHHTPKEIGSAMKSVGEIMAIGRTFEESLQKALRMTHPSVGGFESKLPMGKQYPDNFDLLEGLQVPSNARIHYICRALEQDLMTVDEIHRFTQIDRWFLHKLKRIVDYRKDLEQL-GQANETTSEDWGLAKKLGFSDKQLGEVFRKPVSEVRAHRLSLGLTPYVKQIDTMAAEYPSYTNYLYCSYNAAEHDVAFTDKGIMVLGCGPYHIGSSVEFDWCSVSAIRCLNALGMKSIVVNYNPETVSTDFDECDRLYFEELSQERVLDIYQLESASNCIVSVGGQIPNTLALPLHKAGVRILGTHPTKIDDAEDRAKFSRILDEIGVGQAPWRALTSEKEALEFAEQVGYPCLVRPSYILSGSAMNVAYGPQELRGFLGQAAAVNAEHPVVLTKFIENSREVECDAVASNGQVVAHALCEHVENAGVHSGDATLVLPPHTINEDVKAQIRDVVKRIAERFSITGPFNTQFLVTPEQKVLVIETNLRASRSFPFVSKTLGTDFIATATKVMLGVEPDQKDLYTMENPREPVGFVGIKASMFSWPRLKAADPLLRCEMSSTGEVACYGSNLYTAFLKALQSTGFRVPPKGSSILIGVQKEFQAVFLPTAKRLCDMGYQLYATEATAQWLSQNGIENVRPVGWAFA----QNIDKNIPVATKLVEDKVFSLVINLPNNRSKFLQDNYLIRRTAIDSATPLITNFQVCALLVEALSHLDSVKPESLYHYRS 1497          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. TrEMBL
Match: A0A1I8JML0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 2097.78 bits (5434), Expect = 0.000e+0
Identity = 1028/1472 (69.84%), Postives = 1216/1472 (82.61%), Query Frame = 1
Query:  133 ISAFLSKRINMPTKARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAKIEFDTDPI-EFKDPNKSNLTADVSTNYIQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIETRNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSKSKTTIIPSPKTIDFEPPXXXXXXXXXXXXXXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKG-YSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVK-EGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIP-ANLVSWPTSTEDFQNLD--IPAATKLISDKFFDLVINLPNYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVESLDHVDLVTTDSLFNYQA 4530
            +S  +++R+ +P KARL L +G  FSGYSFG D+S++GE+VFNTGLTGYPESLTDPSYRGQIL LTYPIVGNYGVPDT A D NGL LNVES+ +HV+GLIVQDYS   SHW S  SLS WL  E VPAL GIDTR+LTK +RD G +L KIEF   P+ EF +PN  NLTA+VST  +++FG+GNP+KIV VDCG+KHNMIKML ARGAEV LVPWDYDFT++ YDGLFI+NGPGDPAL+  T+ NI+ VI TRNEP FGIC GNQLVGLAAG T+YK+PLGNRGHNQ V+N++T QAFITSQNHG+ +NT++L   W+ LFINAND +NEG+M T+KPIFTAQFHPEACGGPTDT+FLFDA++EMVK+KS T I+P P+ +D     V KVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEG++T+LMNPNIASVQTNAEG+KQAD VYFLPV        +E+E+PDGILLSMGGQTALNVGIELHE GIL +++V+VLGT I  I  TEDR++FA+ L  I  KLAPS AV  + +AI+AA+ IGYPVMVRAAFALGGLGSG+A ++  L+DIC++AFA+TNQVLIE+SLLGWKEVEYEVVRDAA+NCITVCNMENFDPLGVHTGDSIVVAPSQTLSN EYHMLRETALKVIRHF IVGECNIQYALHP SLEYCIIEINARLSRSSALASKATGYPLAFIAAKL+LGI L +IKNATT++T+ACFEPSLDYITTKIPRWDLDRFHHTPKEIGS+MKSVGE+MAIGRTFEESLQKALRMTHPS+ G  SKL  GK Y +NFDL + L  PSN+RIH+I  A E+   +V++IH  T+ID WFLHK+KRIVD   D+ ++ G     + E+  LAK+ GFSDKQ+G +  K   EVR  R S+ +TP+VK IDTMAAEYP+ TNYLYCSYN  EHDV F  +G+MVLGCGPYHIGSSVEFDWC+VSAIR L   G +++V+N+NPETVSTDFDE DRLYFEELS ERVLDIYQ E+    I+SVGGQIPN LALPL K  V ILGTHP KIDDAEDR+KFS ILDEI V QA WR+L+S  +ALEFA +VGYPCLVRPSYILSGSAMNVAY P EL GFL  A  ++ ++PVV+TKF+E ++E+ECDA+A +G +V HAL EH+ENAGVHSGDATLVLPPHTI++D+  QIR++  +IA++F I+GPFN QFLV  E ++LVIE NLRASRS PFVSKT+GTD IATATKVM+ +  D+KD +T++NPREP  ++GIK+ MFSWPRL  ADP+LRCEMSSTGEVAC+G N+YTAFLKALQS+ FR+P K S+ILIG+Q EFQ  FLPTAK L D GY +YATEATA++L  + I     V W  +    QN+D  IP ATKL+ DK F LVINLPN ++K++ +NYLIRR AIDSATPL+ NF++  +LVE+L H+D V  +SL++Y++
Sbjct:   31 LSGGVARRLVLPNKARLVLEDGTEFSGYSFGADRSSSGEVVFNTGLTGYPESLTDPSYRGQILVLTYPIVGNYGVPDTQAVDENGLRLNVESDAVHVTGLIVQDYSVDHSHWKSAHSLSHWLKREGVPALSGIDTRLLTKRIRDRGTLLGKIEFSDQPLAEFDNPNLRNLTAEVSTKEVRIFGKGNPHKIVAVDCGVKHNMIKMLCARGAEVHLVPWDYDFTEEPYDGLFITNGPGDPALIKTTIDNIRKVINTRNEPAFGICCGNQLVGLAAGCTSYKMPLGNRGHNQSVLNLVTKQAFITSQNHGFAINTDNLPFGWRPLFINANDGSNEGLMCTEKPIFTAQFHPEACGGPTDTQFLFDAFIEMVKTKSATVIMPEPRLMDARRVPVAKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGVKTVLMNPNIASVQTNAEGEKQADMVYFLPV--------IEREKPDGILLSMGGQTALNVGIELHESGILEQHNVRVLGTQIHDIKLTEDRETFAEELMRINEKLAPSVAVTRVSEAIKAAHDIGYPVMVRAAFALGGLGSGLAKDEASLVDICRKAFAITNQVLIEKSLLGWKEVEYEVVRDAANNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNEEYHMLRETALKVIRHFNIVGECNIQYALHPHSLEYCIIEINARLSRSSALASKATGYPLAFIAAKLSLGISLPEIKNATTKVTTACFEPSLDYITTKIPRWDLDRFHHTPKEIGSAMKSVGEIMAIGRTFEESLQKALRMTHPSVGGFESKLPMGKQYPDNFDLLEGLQVPSNARIHYICRALEQDLMTVDEIHRFTQIDRWFLHKLKRIVDYRKDLEQL-GQANETTSEDWGLAKKLGFSDKQLGEVFRKPVSEVRAHRLSLGLTPYVKQIDTMAAEYPSYTNYLYCSYNAAEHDVAFTDKGIMVLGCGPYHIGSSVEFDWCSVSAIRCLNALGMKSIVVNYNPETVSTDFDECDRLYFEELSQERVLDIYQLESASNCIVSVGGQIPNTLALPLHKAGVRILGTHPTKIDDAEDRAKFSRILDEIGVGQAPWRALTSEKEALEFAEQVGYPCLVRPSYILSGSAMNVAYGPQELRGFLGQAAAVNAEHPVVLTKFIENSREVECDAVASNGQVVAHALCEHVENAGVHSGDATLVLPPHTINEDVKAQIRDVVKRIAERFSITGPFNTQFLVTPEQKVLVIETNLRASRSFPFVSKTLGTDFIATATKVMLGVEPDQKDLYTMENPREPVGFVGIKASMFSWPRLKAADPLLRCEMSSTGEVACYGSNLYTAFLKALQSTGFRVPPKGSSILIGVQKEFQAVFLPTAKRLCDMGYQLYATEATAQWLSQNGIENVRPVGWAFA----QNIDKNIPVATKLVEDKVFSLVINLPNNRSKFLQDNYLIRRTAIDSATPLITNFQVCALLVEALSHLDSVKPESLYHYRS 1489          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. TrEMBL
Match: A0A1S3JDD2 (carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Lingula unguis OX=7574 GN=LOC106172324 PE=3 SV=1)

HSP 1 Score: 2068.12 bits (5357), Expect = 0.000e+0
Identity = 1013/1490 (67.99%), Postives = 1205/1490 (80.87%), Query Frame = 1
Query:   91 RDVSLFKMHK--NSLSISAFLSK-------RINMPTKARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAKIEFDTDPIEFKDPNKSNLTADVSTNYIQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIETRNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKS---KSKTTIIPSPKTIDFEPPXXXXXXXXXXXXXXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTSTEDFQNLDIPAATKLISDKFFDLVINLPNYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVESLDHVDLVTTDSLFNY 4524
            R V L K H   N ++ + ++S         ++ P +A L L +G  F GYSFG++ S AGE+VFNTGL GYPE+LTDPSY GQILTLTYPIVGNYGVPDT ARD  GLMLNVES+RIH SGL+VQDYS   SHWNSVKSLSQWL +EKVP L+GIDTRM+TK++RD G VL KIEFD  PIEF DPN  NL   V+T  I V+G+GNP K+V VDCGIKHNMI+ML+ +GAEVTLVPWDYDFT+DK+DGLFISNGPGDPA+  E V N+K V++ R EP+FGIC GNQ+  LAAGA +YKLPLGNRGHNQPVIN+++ QAFITSQNHG+ ++ ++L   W  LFINAND TNEGI +  +PIFTAQFHPEA GGPTD+EFLFD +++M+KS   K    + P P   D +P  V KVLVLGSGGLSIGQAGEFDYSGSQAIKALKEE I+ +LMNPNIASVQTNAEG+KQA+ VY+LP+TAEFV +V++KE+PDGILLSMGGQTALN G++LH+ G+  ++ V+VLGT I SI ATEDRQ FAD LK+I  +LAPS AV ++ DA+ AA +IGYPVMVRAA+ALGGLGSG A +KE+L DI  RA A++NQ+L+E+SLLGWKEVEYEVVRD+ADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETA+KV++HFGIVGECNIQYALHPESLEYCIIEINARLSRSSALASKATGYPLAFIAAKLALGI L  I+NATT+ T+ACFEPSLDYI TKIPRWDLDRFH T KEIGSSMKSVGEVMAIGRTFEESLQKALRMTHP++ GLT  L  GK Y+ + DL+  L  P NSRIH IT AF +GY+V+ IH LT ID WFL+K+ +IV +   +    G L   +H  L  AKQ GF+D+QIG  +G +E E R++R S  I PWVK IDTMAAEYP  TNYLY SYNGMEHD+TF+  G+ VLGCGPYHIGSSVEFDWCAVS IR+LR  G++T+VINHNPETVSTDFDE DRLYFEELSLERVLDIYQ E  KG ++SVGGQIPNNLALPL+KN VNI GT+P  ID AE+RS FSAILD+I V QA W++L+S+D+AL+FA+ VGYPCL+RPS++LSGSAMNVAY P EL  FL+ A ++SQ++PVVITKF++GA+EIE DA+A++GV+V HA+SEH+ENAGVHSGDATL+LP  TIS+     I++ + KIAK+F ISGP N+QFL K+ +++VIECNLRASRS PF+SKTIGTD+I+ ATKVM++  +D +D  T++ P  P  Y+GIK+PMFSWPRL  ADP+LRCEM+STGEVACFG +VYTAFLKAL S+ FR+P+KN ++LIG+Q  FQP+FLPTAK L D GY + ATE TA YL  H IPA  V W  S    Q+L  P AT LI D+  DLVINLPN+ TKYV +NYLIRR+AID   PL+ NFE+V++L E+ DH   V   SLF+Y
Sbjct:    5 RAVCLMKKHAYLNGVAGARYMSSVHGASKSTLDKPRRAHLVLEDGSEFRGYSFGHEASIAGEVVFNTGLVGYPEALTDPSYHGQILTLTYPIVGNYGVPDTQARDEYGLMLNVESDRIHASGLLVQDYSHGYSHWNSVKSLSQWLKEEKVPGLYGIDTRMITKMIRDKGTVLGKIEFDEQPIEFMDPNTMNLIDKVATKDIIVYGKGNPLKVVAVDCGIKHNMIRMLVKKGAEVTLVPWDYDFTQDKFDGLFISNGPGDPAVAGELVANVKKVLDNRPEPIFGICMGNQITCLAAGAQSYKLPLGNRGHNQPVINLLSGQAFITSQNHGFAIDNKTLPPGWLPLFINANDGTNEGIYHENRPIFTAQFHPEARGGPTDSEFLFDMFLDMIKSGEQKVAKIVKPMPPKPDLKP--VSKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEENIDVVLMNPNIASVQTNAEGEKQANTVYYLPITAEFVTEVIKKEKPDGILLSMGGQTALNCGVQLHDAGVFQEHGVQVLGTQISSIKATEDRQVFADMLKDINERLAPSIAVETVPDALAAAEEIGYPVMVRAAYALGGLGSGWAPDKEKLKDIATRALALSNQILVEKSLLGWKEVEYEVVRDSADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETAIKVVKHFGIVGECNIQYALHPESLEYCIIEINARLSRSSALASKATGYPLAFIAAKLALGIDLPSIQNATTEQTTACFEPSLDYIVTKIPRWDLDRFHQTSKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPTVPGLTPALPAGKSYAPDMDLEALLKVPHNSRIHCITKAFHEGYTVDDIHKLTAIDKWFLYKLDKIVHMENTLKSYKGALTVPTHL-LAQAKQDGFADRQIGQALGITESEARDMRLSKNIRPWVKQIDTMAAEYPARTNYLYVSYNGMEHDLTFNDNGITVLGCGPYHIGSSVEFDWCAVSCIRSLRDMGKKTIVINHNPETVSTDFDECDRLYFEELSLERVLDIYQQEVSKGIVVSVGGQIPNNLALPLYKNGVNIFGTNPTMIDAAEERSVFSAILDKIGVGQAPWKALTSLDEALDFAASVGYPCLLRPSFVLSGSAMNVAYGPVELKKFLEQASEVSQEHPVVITKFVDGAREIEMDAVARNGVVVAHAISEHVENAGVHSGDATLILPSQTISQHCLDLIKDATRKIAKEFNISGPCNIQFLAKDDQVMVIECNLRASRSFPFISKTIGTDLISVATKVMLHEHIDIEDMPTLETPHNPVGYVGIKAPMFSWPRLRDADPLLRCEMASTGEVACFGPDVYTAFLKALMSAGFRIPKKNGSVLIGIQQSFQPKFLPTAKKLSDLGYQLCATEGTAAYLNTHHIPAQAVGWTLSENKDQSL--PHATTLIQDRKVDLVINLPNHNTKYVKDNYLIRRSAIDFGVPLLTNFEIVRLLAEAFDHTGNVEATSLFHY 1489          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. TrEMBL
Match: A0A1S3JJ36 (carbamoyl-phosphate synthase [ammonia], mitochondrial-like OS=Lingula unguis OX=7574 GN=LOC106173741 PE=3 SV=1)

HSP 1 Score: 2066.97 bits (5354), Expect = 0.000e+0
Identity = 1013/1490 (67.99%), Postives = 1205/1490 (80.87%), Query Frame = 1
Query:   91 RDVSLFKMHK--NSLSISAFLSK-------RINMPTKARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAKIEFDTDPIEFKDPNKSNLTADVSTNYIQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIETRNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKS---KSKTTIIPSPKTIDFEPPXXXXXXXXXXXXXXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTSTEDFQNLDIPAATKLISDKFFDLVINLPNYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVESLDHVDLVTTDSLFNY 4524
            R V L K H   N ++ + ++S         ++ P +A L L +G  F GYSFG++ S AGE+VFNTGL GYPE+LTDPSY GQILTLTYPIVGNYGVPDT ARD  GLMLNVES+RIH SGL+VQDYS   SHWNSVKSLSQWL +EKVP L+GIDTRM+TK++RD G VL KIEFD  PIEF DPN  NL   V+T  I V+G+GNP K+V VDCGIKHNMI+ML+ +GAEVTLVPW+YDFT+DK+DGLFISNGPGDPA+  E V N+K V++ R EP+FGIC GNQ+  LAAGA +YKLPLGNRGHNQPVIN+++ QAFITSQNHG+ ++ ++L   W  LFINAND TNEGI +  +PIFTAQFHPEA GGPTD+EFLFD +++M+KS   K    + P P   D +P  V KVLVLGSGGLSIGQAGEFDYSGSQAIKALKEE I+ +LMNPNIASVQTNAEG+KQA+ VY+LP+TAEFV +V++KE+PDGILLSMGGQTALN G++LH+ G+  K+ V+VLGT I SI ATEDRQ FAD LK+I  +LAPS AV ++ DA+ AA +IGYPVMVRAA+ALGGLGSG A +KE+L DI  RA A++NQ+L+E+SLLGWKEVEYEVVRD+ADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETA+KV++HFGIVGECNIQYALHPESLEYCIIEINARLSRSSALASKATGYPLAFIAAKLALGI L  I+NATT+ T+ACFEPSLDYI TKIPRWDLDRFH T KEIGSSMKSVGEVMAIGRTFEESLQKALRMTHP++ GLT  L  GK Y+ + DL+  L  P NSRIH IT AF +GY+V+ IH LT ID WFL+K+ +IV +   +    G L   +H  L  AKQ GF+D+QIG  +G +E E R++R S  I PWVK IDTMAAEYP  TNYLY SYNGMEHD+TF+  G+ VLGCGPYHIGSSVEFDWCAVS IR+LR  G++T+VINHNPETVSTDFDE DRLYFEELSLERVLDIYQ E  KG ++SVGGQIPNNLALPL+KN VNI GT+P  ID AE+RS FSAILD+I V QA W++L+S+D+AL+FA+ VGYPCL+RPS++LSGSAMNVAY P EL  FL+ A ++SQ++PVVITKF++GA+EIE DA+A++GV+V HA+SEH+ENAGVHSGDATL+LP  TIS+     I++ + KIAK+F ISGP N+QFL K+ +++VIECNLRASRS PF+SKTIGTD+I+ ATKVM++  +D +D  T++ P  P  Y+GIK+PMFSWPRL  ADP+LRCEM+STGEVACFG +VYTAFLKAL S+ FR+P+KN ++LIG+Q  FQP+FLPTAK L D GY + ATE TA YL  H IPA  V W  S    Q+L  P AT LI D+  DLVINLPN+ TKYV +NYLIRR+AID   PL+ NFE+V++L E+ DH   V   SLF+Y
Sbjct:    5 RAVCLMKKHAYLNGVAGARYMSSVHGASKSTLDKPRRAHLVLEDGSEFRGYSFGHEASIAGEVVFNTGLVGYPEALTDPSYHGQILTLTYPIVGNYGVPDTQARDEYGLMLNVESDRIHASGLLVQDYSHGYSHWNSVKSLSQWLKEEKVPGLYGIDTRMITKMIRDKGTVLGKIEFDEQPIEFMDPNTMNLIDKVATKDIIVYGKGNPLKVVAVDCGIKHNMIRMLVKKGAEVTLVPWNYDFTQDKFDGLFISNGPGDPAVAGELVANVKKVLDNRPEPIFGICMGNQITCLAAGAQSYKLPLGNRGHNQPVINLLSGQAFITSQNHGFAIDNKTLPPGWLPLFINANDGTNEGIYHENRPIFTAQFHPEARGGPTDSEFLFDMFLDMIKSGEQKVSKIVKPMPPKPDLKP--VSKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEENIDVVLMNPNIASVQTNAEGEKQANTVYYLPITAEFVTEVIKKEKPDGILLSMGGQTALNCGVQLHDAGVFQKHGVQVLGTQISSIKATEDRQVFADMLKDINERLAPSIAVETVPDALAAAEEIGYPVMVRAAYALGGLGSGWAPDKEKLKDIATRALALSNQILVEKSLLGWKEVEYEVVRDSADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETAIKVVKHFGIVGECNIQYALHPESLEYCIIEINARLSRSSALASKATGYPLAFIAAKLALGIDLPSIQNATTEQTTACFEPSLDYIVTKIPRWDLDRFHQTSKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPTVPGLTPALPAGKSYAPDMDLEALLKVPHNSRIHCITKAFHEGYTVDDIHKLTAIDKWFLYKLDKIVHMENTLKSYKGALTVPTHL-LAQAKQDGFADRQIGQALGITESEARDMRLSKNIRPWVKQIDTMAAEYPARTNYLYVSYNGMEHDLTFNDNGITVLGCGPYHIGSSVEFDWCAVSCIRSLRDMGKKTIVINHNPETVSTDFDECDRLYFEELSLERVLDIYQQEVSKGIVVSVGGQIPNNLALPLYKNGVNIFGTNPTMIDAAEERSVFSAILDKIGVGQAPWKALTSLDEALDFAASVGYPCLLRPSFVLSGSAMNVAYGPVELKKFLEQASEVSQEHPVVITKFVDGAREIEMDAVARNGVVVAHAISEHVENAGVHSGDATLILPSQTISQHCLDLIKDATRKIAKEFNISGPCNIQFLAKDDQVMVIECNLRASRSFPFISKTIGTDLISVATKVMLHEHIDIEDMPTLETPHNPVGYVGIKAPMFSWPRLRDADPLLRCEMASTGEVACFGPDVYTAFLKALMSAGFRIPKKNGSVLIGIQQSFQPKFLPTAKKLSDLGYQLCATEGTAAYLNTHHIPAQAVGWTLSENKDQSL--PHATTLIQDRKVDLVINLPNHNTKYVKDNYLIRRSAIDFGVPLLTNFEIVRLLAEAFDHTGNVEATSLFHY 1489          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Cavefish
Match: cps1 (carbamoyl-phosphate synthase 1 [Source:NCBI gene;Acc:103026142])

HSP 1 Score: 1948.71 bits (5047), Expect = 0.000e+0
Identity = 935/1454 (64.31%), Postives = 1165/1454 (80.12%), Query Frame = 1
Query:  175 ARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAKIEFDTDPIEFKDPNKSNLTADVSTNYIQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIET-RNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSKSKTTIIP--SPKTIDFEPPXXXXXXXXXXXXXXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTSTEDFQNLDIPAATKLISDKFFDLVINLPNYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVESLDHVDLVTTDSLFNYQ 4527
            A L L +G V  GYSFG+ +S+AGELVFNTGL GYPE+LTDPSYRGQILTLTYPIVGNYGVP+T   D  GL  NVES+RI VSGL+VQDYS   SHWNSVKSL QWL +EKVPAL+G+DTRMLTKI+RD G VL KIEF+  P++  +PN+ NL A+VST   QVFG+GNP K+V VDCGIKHN+I++L+ RGAEV LVPW++D    +YDGLFISNGPGDP+L    ++N++ V+E+ R +P+FGIC GNQ+  LAAGA +YKLP+GNRG NQPV+NV+T QAFIT+QNHGYG+++ESL   W  LF+NAND TNEGIM+  KPIFTAQFHPEA GGPTDTEFLFD+++ ++K     +I+     K +  +  +V KVLVLGSGGLSIGQAGEFDYSGSQA+KA+KEE ++T+LMNPNIASVQTN  G KQAD VYFLPVT +FV +V++ ERPDGILLSMGGQTALN G+EL   G+L KY VKVLGTP++SI+ATEDRQ FAD L EI  K+APS AV S+ DA++AA +IGYPVM+R+A+ALGGLGSG+  ++++L +   +A AM++Q+L+E+SLLGWKEVEYEVVRD ADNC+TVCNMENFDPLG+HTGDSIVVAPSQTLSN EYHMLRETA+KV+RH GIVGECNIQYALHP SLEYCIIE+NARLSRSSALASKATGYPLAF+AAKLALGI L +IKNA ++ T+ACFEPSLDYI TKIPRWDLDRF    +EIGS+MKSVGEVMA+GRTFEES+QKALRM HPS++G   +L   + +SE  DL + L  PS++RI  +  A   G +V++IH LT ID WFLHK++RI +L   +S+ + +  ++  + L  AKQ GFSD+Q+G  +G SE E R +R S  I PWVK IDT+AAEYP VTNYLYC+Y+G EHD+ F  QGVMVLGCGPYHIGSSVEFDWCAVS+IR LR+ G++TVV+NHNPETVSTDFDE DRLYFEEL+LER+LDI Q E+  G I+SVGGQIPNNLA+PL +N V ILGT P +ID AE+RS FS ILD++ V QA WR+LSS++DA  FA++VGYPCL+RPSY+LSGSAMNVAY   E+  FL+ A Q+SQ++PVVITKF+ GA+E+E DA+AK G ++ HA++EH+E+AGVHSGDATL+LP  TIS+    +++  + KIAK FEISGPFN QFLVK  +++VIECNLRASRS PFVSKTIG D I  AT+VM+  P++E    T++NP  P +Y+GIK+PMFSWPRL  ADPVLRCEM+STGEVACFG N+Y+AFLKA+ S+ F+LP+K   ILIG+QH F+P FL TA  L + G+ +YATEAT+ +L  + +    V+WP    + +   +P+ ++L+SD   DLV+NLPN  TK++ +N+LIRR A+D   PL+ NF++VK+ VE++ +   + T SLF+Y+
Sbjct:   30 AHLVLEDGTVMKGYSFGHRQSSAGELVFNTGLVGYPEALTDPSYRGQILTLTYPIVGNYGVPNTQELDELGLRKNVESDRIQVSGLLVQDYSHEFSHWNSVKSLGQWLQEEKVPALYGVDTRMLTKIIRDKGTVLGKIEFEGQPVDIINPNERNLVAEVSTKETQVFGKGNPIKVVAVDCGIKHNIIRLLVKRGAEVHLVPWNHDLMSLEYDGLFISNGPGDPSLAETLIQNVRKVLESDRPQPVFGICMGNQITALAAGAQSYKLPMGNRGQNQPVLNVMTGQAFITAQNHGYGIDSESLPPGWSPLFVNANDGTNEGIMHNNKPIFTAQFHPEAKGGPTDTEFLFDSFLSLIKKGKDASIVSVMPKKPVLPQRAQVSKVLVLGSGGLSIGQAGEFDYSGSQAVKAMKEENLKTVLMNPNIASVQTNEVGTKQADSVYFLPVTPQFVTEVIKTERPDGILLSMGGQTALNCGVELFRSGVLQKYGVKVLGTPVESIMATEDRQLFADKLMEINEKIAPSIAVESVADALKAAEEIGYPVMLRSAYALGGLGSGLCADQQKLEETAHKALAMSSQILVEKSLLGWKEVEYEVVRDVADNCVTVCNMENFDPLGIHTGDSIVVAPSQTLSNEEYHMLRETAIKVVRHLGIVGECNIQYALHPSSLEYCIIEVNARLSRSSALASKATGYPLAFVAAKLALGIPLPEIKNAVSEKTTACFEPSLDYIVTKIPRWDLDRFQGMSREIGSAMKSVGEVMAVGRTFEESIQKALRMCHPSVDGFVPRLPLKRAWSEQCDLRQELAVPSSTRIFSLAKALHDGVTVDQIHQLTAIDKWFLHKLRRITELEKHLSQYDSS--TVPGDVLLKAKQEGFSDRQVGQALGSSEGEARALRHSRNIQPWVKQIDTLAAEYPAVTNYLYCTYHGQEHDLDFRDQGVMVLGCGPYHIGSSVEFDWCAVSSIRTLRQMGKRTVVVNHNPETVSTDFDECDRLYFEELTLERILDITQQESCTGCIVSVGGQIPNNLAVPLHQNGVRILGTSPLQIDRAEERSVFSTILDDLGVSQAPWRALSSLEDAFAFANKVGYPCLLRPSYVLSGSAMNVAYGEEEMKRFLEEAAQVSQEHPVVITKFIRGAREVEVDAVAKAGKVLVHAITEHVEDAGVHSGDATLMLPTQTISQGALEKVKTATRKIAKAFEISGPFNTQFLVKGNDVMVIECNLRASRSFPFVSKTIGVDFINVATRVMVGEPVNESQLPTLENPIIPVDYVGIKAPMFSWPRLRDADPVLRCEMASTGEVACFGPNIYSAFLKAMLSTGFKLPQK--GILIGIQHSFRPDFLSTAHQLQEEGFKLYATEATSAWLNANDVSTTPVAWP--RHEGKETTLPSISRLLSDGHIDLVVNLPNNNTKFLKDNFLIRRMAVDYGVPLITNFQVVKLFVEAIKYSSELDTTSLFHYR 1477          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Cavefish
Match: cps1 (carbamoyl-phosphate synthase 1 [Source:NCBI gene;Acc:103026142])

HSP 1 Score: 1931.76 bits (5003), Expect = 0.000e+0
Identity = 926/1431 (64.71%), Postives = 1149/1431 (80.29%), Query Frame = 1
Query:  175 ARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAKIEFDTDPIEFKDPNKSNLTADVSTNYIQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIET-RNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSKSKTTIIP--SPKTIDFEPPXXXXXXXXXXXXXXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTSTEDFQNLDIPAATKLISDKFFDLVINLPNYKTKYVTENYLIRRAAIDSATPLMINFEL 4458
            A L L +G V  GYSFG+ +S+AGELVFNTGL GYPE+LTDPSYRGQILTLTYPIVGNYGVP+T   D  GL  NVES+RI VSGL+VQDYS   SHWNSVKSL QWL +EKVPAL+G+DTRMLTKI+RD G VL KIEF+  P++  +PN+ NL A+VST   QVFG+GNP K+V VDCGIKHN+I++L+ RGAEV LVPW++D    +YDGLFISNGPGDP+L    ++N++ V+E+ R +P+FGIC GNQ+  LAAGA +YKLP+GNRG NQPV+NV+T QAFIT+QNHGYG+++ESL   W  LF+NAND TNEGIM+  KPIFTAQFHPEA GGPTDTEFLFD+++ ++K     +I+     K +  +  +V KVLVLGSGGLSIGQAGEFDYSGSQA+KA+KEE ++T+LMNPNIASVQTN  G KQAD VYFLPVT +FV +V++ ERPDGILLSMGGQTALN G+EL   G+L KY VKVLGTP++SI+ATEDRQ FAD L EI  K+APS AV S+ DA++AA +IGYPVM+R+A+ALGGLGSG+  ++++L +   +A AM++Q+L+E+SLLGWKEVEYEVVRD ADNC+TVCNMENFDPLG+HTGDSIVVAPSQTLSN EYHMLRETA+KV+RH GIVGECNIQYALHP SLEYCIIE+NARLSRSSALASKATGYPLAF+AAKLALGI L +IKNA ++ T+ACFEPSLDYI TKIPRWDLDRF    +EIGS+MKSVGEVMA+GRTFEES+QKALRM HPS++G   +L   + +SE  DL + L  PS++RI  +  A   G +V++IH LT ID WFLHK++RI +L   +S+ + +  ++  + L  AKQ GFSD+Q+G  +G SE E R +R S  I PWVK IDT+AAEYP VTNYLYC+Y+G EHD+ F  QGVMVLGCGPYHIGSSVEFDWCAVS+IR LR+ G++TVV+NHNPETVSTDFDE DRLYFEEL+LER+LDI Q E+  G I+SVGGQIPNNLA+PL +N V ILGT P +ID AE+RS FS ILD++ V QA WR+LSS++DA  FA++VGYPCL+RPSY+LSGSAMNVAY   E+  FL+ A Q+SQ++PVVITKF+ GA+E+E DA+AK G ++ HA++EH+E+AGVHSGDATL+LP  TIS+    +++  + KIAK FEISGPFN QFLVK  +++VIECNLRASRS PFVSKTIG D I  AT+VM+  P++E    T++NP  P +Y+GIK+PMFSWPRL  ADPVLRCEM+STGEVACFG N+Y+AFLKA+ S+ F+LP+K   ILIG+QH F+P FL TA  L + G+ +YATEAT+ +L  + +    V+WP    + +   +P+ ++L+SD   DLV+NLPN  TK++ +N+LIRR A+D   PL+ NF++
Sbjct:   30 AHLVLEDGTVMKGYSFGHRQSSAGELVFNTGLVGYPEALTDPSYRGQILTLTYPIVGNYGVPNTQELDELGLRKNVESDRIQVSGLLVQDYSHEFSHWNSVKSLGQWLQEEKVPALYGVDTRMLTKIIRDKGTVLGKIEFEGQPVDIINPNERNLVAEVSTKETQVFGKGNPIKVVAVDCGIKHNIIRLLVKRGAEVHLVPWNHDLMSLEYDGLFISNGPGDPSLAETLIQNVRKVLESDRPQPVFGICMGNQITALAAGAQSYKLPMGNRGQNQPVLNVMTGQAFITAQNHGYGIDSESLPPGWSPLFVNANDGTNEGIMHNNKPIFTAQFHPEAKGGPTDTEFLFDSFLSLIKKGKDASIVSVMPKKPVLPQRAQVSKVLVLGSGGLSIGQAGEFDYSGSQAVKAMKEENLKTVLMNPNIASVQTNEVGTKQADSVYFLPVTPQFVTEVIKTERPDGILLSMGGQTALNCGVELFRSGVLQKYGVKVLGTPVESIMATEDRQLFADKLMEINEKIAPSIAVESVADALKAAEEIGYPVMLRSAYALGGLGSGLCADQQKLEETAHKALAMSSQILVEKSLLGWKEVEYEVVRDVADNCVTVCNMENFDPLGIHTGDSIVVAPSQTLSNEEYHMLRETAIKVVRHLGIVGECNIQYALHPSSLEYCIIEVNARLSRSSALASKATGYPLAFVAAKLALGIPLPEIKNAVSEKTTACFEPSLDYIVTKIPRWDLDRFQGMSREIGSAMKSVGEVMAVGRTFEESIQKALRMCHPSVDGFVPRLPLKRAWSEQCDLRQELAVPSSTRIFSLAKALHDGVTVDQIHQLTAIDKWFLHKLRRITELEKHLSQYDSS--TVPGDVLLKAKQEGFSDRQVGQALGSSEGEARALRHSRNIQPWVKQIDTLAAEYPAVTNYLYCTYHGQEHDLDFRDQGVMVLGCGPYHIGSSVEFDWCAVSSIRTLRQMGKRTVVVNHNPETVSTDFDECDRLYFEELTLERILDITQQESCTGCIVSVGGQIPNNLAVPLHQNGVRILGTSPLQIDRAEERSVFSTILDDLGVSQAPWRALSSLEDAFAFANKVGYPCLLRPSYVLSGSAMNVAYGEEEMKRFLEEAAQVSQEHPVVITKFIRGAREVEVDAVAKAGKVLVHAITEHVEDAGVHSGDATLMLPTQTISQGALEKVKTATRKIAKAFEISGPFNTQFLVKGNDVMVIECNLRASRSFPFVSKTIGVDFINVATRVMVGEPVNESQLPTLENPIIPVDYVGIKAPMFSWPRLRDADPVLRCEMASTGEVACFGPNIYSAFLKAMLSTGFKLPQK--GILIGIQHSFRPDFLSTAHQLQEEGFKLYATEATSAWLNANDVSTTPVAWP--RHEGKETTLPSISRLLSDGHIDLVVNLPNNNTKFLKDNFLIRRMAVDYGVPLITNFQV 1454          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Cavefish
Match: cps1 (carbamoyl-phosphate synthase 1 [Source:NCBI gene;Acc:103026142])

HSP 1 Score: 1931.76 bits (5003), Expect = 0.000e+0
Identity = 926/1431 (64.71%), Postives = 1149/1431 (80.29%), Query Frame = 1
Query:  175 ARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAKIEFDTDPIEFKDPNKSNLTADVSTNYIQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIET-RNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSKSKTTIIP--SPKTIDFEPPXXXXXXXXXXXXXXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTSTEDFQNLDIPAATKLISDKFFDLVINLPNYKTKYVTENYLIRRAAIDSATPLMINFEL 4458
            A L L +G V  GYSFG+ +S+AGELVFNTGL GYPE+LTDPSYRGQILTLTYPIVGNYGVP+T   D  GL  NVES+RI VSGL+VQDYS   SHWNSVKSL QWL +EKVPAL+G+DTRMLTKI+RD G VL KIEF+  P++  +PN+ NL A+VST   QVFG+GNP K+V VDCGIKHN+I++L+ RGAEV LVPW++D    +YDGLFISNGPGDP+L    ++N++ V+E+ R +P+FGIC GNQ+  LAAGA +YKLP+GNRG NQPV+NV+T QAFIT+QNHGYG+++ESL   W  LF+NAND TNEGIM+  KPIFTAQFHPEA GGPTDTEFLFD+++ ++K     +I+     K +  +  +V KVLVLGSGGLSIGQAGEFDYSGSQA+KA+KEE ++T+LMNPNIASVQTN  G KQAD VYFLPVT +FV +V++ ERPDGILLSMGGQTALN G+EL   G+L KY VKVLGTP++SI+ATEDRQ FAD L EI  K+APS AV S+ DA++AA +IGYPVM+R+A+ALGGLGSG+  ++++L +   +A AM++Q+L+E+SLLGWKEVEYEVVRD ADNC+TVCNMENFDPLG+HTGDSIVVAPSQTLSN EYHMLRETA+KV+RH GIVGECNIQYALHP SLEYCIIE+NARLSRSSALASKATGYPLAF+AAKLALGI L +IKNA ++ T+ACFEPSLDYI TKIPRWDLDRF    +EIGS+MKSVGEVMA+GRTFEES+QKALRM HPS++G   +L   + +SE  DL + L  PS++RI  +  A   G +V++IH LT ID WFLHK++RI +L   +S+ + +  ++  + L  AKQ GFSD+Q+G  +G SE E R +R S  I PWVK IDT+AAEYP VTNYLYC+Y+G EHD+ F  QGVMVLGCGPYHIGSSVEFDWCAVS+IR LR+ G++TVV+NHNPETVSTDFDE DRLYFEEL+LER+LDI Q E+  G I+SVGGQIPNNLA+PL +N V ILGT P +ID AE+RS FS ILD++ V QA WR+LSS++DA  FA++VGYPCL+RPSY+LSGSAMNVAY   E+  FL+ A Q+SQ++PVVITKF+ GA+E+E DA+AK G ++ HA++EH+E+AGVHSGDATL+LP  TIS+    +++  + KIAK FEISGPFN QFLVK  +++VIECNLRASRS PFVSKTIG D I  AT+VM+  P++E    T++NP  P +Y+GIK+PMFSWPRL  ADPVLRCEM+STGEVACFG N+Y+AFLKA+ S+ F+LP+K   ILIG+QH F+P FL TA  L + G+ +YATEAT+ +L  + +    V+WP    + +   +P+ ++L+SD   DLV+NLPN  TK++ +N+LIRR A+D   PL+ NF++
Sbjct:   30 AHLVLEDGTVMKGYSFGHRQSSAGELVFNTGLVGYPEALTDPSYRGQILTLTYPIVGNYGVPNTQELDELGLRKNVESDRIQVSGLLVQDYSHEFSHWNSVKSLGQWLQEEKVPALYGVDTRMLTKIIRDKGTVLGKIEFEGQPVDIINPNERNLVAEVSTKETQVFGKGNPIKVVAVDCGIKHNIIRLLVKRGAEVHLVPWNHDLMSLEYDGLFISNGPGDPSLAETLIQNVRKVLESDRPQPVFGICMGNQITALAAGAQSYKLPMGNRGQNQPVLNVMTGQAFITAQNHGYGIDSESLPPGWSPLFVNANDGTNEGIMHNNKPIFTAQFHPEAKGGPTDTEFLFDSFLSLIKKGKDASIVSVMPKKPVLPQRAQVSKVLVLGSGGLSIGQAGEFDYSGSQAVKAMKEENLKTVLMNPNIASVQTNEVGTKQADSVYFLPVTPQFVTEVIKTERPDGILLSMGGQTALNCGVELFRSGVLQKYGVKVLGTPVESIMATEDRQLFADKLMEINEKIAPSIAVESVADALKAAEEIGYPVMLRSAYALGGLGSGLCADQQKLEETAHKALAMSSQILVEKSLLGWKEVEYEVVRDVADNCVTVCNMENFDPLGIHTGDSIVVAPSQTLSNEEYHMLRETAIKVVRHLGIVGECNIQYALHPSSLEYCIIEVNARLSRSSALASKATGYPLAFVAAKLALGIPLPEIKNAVSEKTTACFEPSLDYIVTKIPRWDLDRFQGMSREIGSAMKSVGEVMAVGRTFEESIQKALRMCHPSVDGFVPRLPLKRAWSEQCDLRQELAVPSSTRIFSLAKALHDGVTVDQIHQLTAIDKWFLHKLRRITELEKHLSQYDSS--TVPGDVLLKAKQEGFSDRQVGQALGSSEGEARALRHSRNIQPWVKQIDTLAAEYPAVTNYLYCTYHGQEHDLDFRDQGVMVLGCGPYHIGSSVEFDWCAVSSIRTLRQMGKRTVVVNHNPETVSTDFDECDRLYFEELTLERILDITQQESCTGCIVSVGGQIPNNLAVPLHQNGVRILGTSPLQIDRAEERSVFSTILDDLGVSQAPWRALSSLEDAFAFANKVGYPCLLRPSYVLSGSAMNVAYGEEEMKRFLEEAAQVSQEHPVVITKFIRGAREVEVDAVAKAGKVLVHAITEHVEDAGVHSGDATLMLPTQTISQGALEKVKTATRKIAKAFEISGPFNTQFLVKGNDVMVIECNLRASRSFPFVSKTIGVDFINVATRVMVGEPVNESQLPTLENPIIPVDYVGIKAPMFSWPRLRDADPVLRCEMASTGEVACFGPNIYSAFLKAMLSTGFKLPQK--GILIGIQHSFRPDFLSTAHQLQEEGFKLYATEATSAWLNANDVSTTPVAWP--RHEGKETTLPSISRLLSDGHIDLVVNLPNNNTKFLKDNFLIRRMAVDYGVPLITNFQV 1454          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Cavefish
Match: cps1 (carbamoyl-phosphate synthase 1 [Source:NCBI gene;Acc:103026142])

HSP 1 Score: 1907.88 bits (4941), Expect = 0.000e+0
Identity = 924/1455 (63.51%), Postives = 1154/1455 (79.31%), Query Frame = 1
Query:  175 ARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAKIEFDTDPIEFKDPNKSNLTADVSTNYIQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIET-RNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSKSKTTIIP--SPKTIDFEPPXXXXXXXXXXXXXXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATE-ATAEYLKMHKIPANLVSWPTSTEDFQNLDIPAATKLISDKFFDLVINLPNYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVESLDHVDLVTTDSLFNYQ 4527
            A L L +G V  GYSFG+ +S+AGELVFNTGL GYPE+LTDPSYRGQILTLTYPIVGNYGVP+T   D  GL  NVES+RI VSGL+VQDYS   SHWNSVKSL QWL +EKVPAL+G+DTRMLTKI+RD G VL KIEF+  P++  +PN+ NL A+VST   QVFG+GNP K+V VDCGIKHN+I++L+ RGAEV LVPW++D    +YDGLFISNGPGDP+L    ++N++ V+E+ R +P+FGIC GNQ+  LAAGA +YKLP+GNRG NQPV+NV+T QAFIT+QNHGYG+++ESL   W  LF+NAND TNEGIM+  KPIFTAQFHPEA GGPTDTEFLFD+++ ++K     +I+     K +  +  +V KVLVLGSGGLSIGQAGEFDYSGSQA+KA+KEE ++T+LMNPNIASVQTN  G KQAD VYFLPVT +FV +V++ ERPDGILLSMGGQTALN G+EL   G+L KY VKVLGTP++SI+ATEDRQ FAD L EI  K+APS AV S+ DA++AA +IGYPVM+R+A+ALGGLGSG+  ++++L +   +A AM++Q+L+E+SLLGWKEVEYEVVRD ADNC+TVCNMENFDPLG+HTGDSIVVAPSQTLSN EYHMLRETA+KV+RH GIVGECNIQYALHP SLEYCIIE+NARLSRSSALASKATGYPLAF+AAKLALGI L +IKNA ++ T+ACFEPSLDYI TKIPRWDLDRF    +EIGS+MKSVGEVMA+GRTFEES+QKALRM HPS++G   +L   + +SE  DL + L  PS++RI  +  A   G +V++IH LT ID WFLHK++RI +L   +S+ + +  ++  + L  AKQ GFSD+Q+G  +G SE E R +R S  I PWVK IDT+AAEYP VTNYLYC+Y+G EHD+ F  QGVMVLGCGPYHIGSSVEFDWCAVS+IR LR+ G++TVV+NHNPETVSTDFDE DRLYFEEL+LER+LDI Q E+  G I+SVGGQIPNNLA+PL +N V ILGT P +ID AE+RS FS ILD++ V QA WR+LSS++DA  FA++VGYPCL+RPSY+LSGSAMNVAY   E+  FL+ A Q+SQ++PVVITKF+ GA+E+E DA+AK G ++ HA++EH+E+AGVHSGDATL+LP  TIS+    +++  + KIAK FEISGPFN QFLVK  +++VIECNLRASRS PFVSKTIG D I  AT+VM+  P++E    T++NP  P +Y+GIK+PMFSWPRL  ADPVLRCEM+STGEVACFG N+Y+AFLKA+ S+ F+LP+K   ILIG+Q             + + G+ +   E AT+ +L  + +    V+WP    + +   +P+ ++L+SD   DLV+NLPN  TK++ +N+LIRR A+D   PL+ NF++VK+ VE++ +   + T SLF+Y+
Sbjct:   31 AHLVLEDGTVMKGYSFGHRQSSAGELVFNTGLVGYPEALTDPSYRGQILTLTYPIVGNYGVPNTQELDELGLRKNVESDRIQVSGLLVQDYSHEFSHWNSVKSLGQWLQEEKVPALYGVDTRMLTKIIRDKGTVLGKIEFEGQPVDIINPNERNLVAEVSTKETQVFGKGNPIKVVAVDCGIKHNIIRLLVKRGAEVHLVPWNHDLMSLEYDGLFISNGPGDPSLAETLIQNVRKVLESDRPQPVFGICMGNQITALAAGAQSYKLPMGNRGQNQPVLNVMTGQAFITAQNHGYGIDSESLPPGWSPLFVNANDGTNEGIMHNNKPIFTAQFHPEAKGGPTDTEFLFDSFLSLIKKGKDASIVSVMPKKPVLPQRAQVSKVLVLGSGGLSIGQAGEFDYSGSQAVKAMKEENLKTVLMNPNIASVQTNEVGTKQADSVYFLPVTPQFVTEVIKTERPDGILLSMGGQTALNCGVELFRSGVLQKYGVKVLGTPVESIMATEDRQLFADKLMEINEKIAPSIAVESVADALKAAEEIGYPVMLRSAYALGGLGSGLCADQQKLEETAHKALAMSSQILVEKSLLGWKEVEYEVVRDVADNCVTVCNMENFDPLGIHTGDSIVVAPSQTLSNEEYHMLRETAIKVVRHLGIVGECNIQYALHPSSLEYCIIEVNARLSRSSALASKATGYPLAFVAAKLALGIPLPEIKNAVSEKTTACFEPSLDYIVTKIPRWDLDRFQGMSREIGSAMKSVGEVMAVGRTFEESIQKALRMCHPSVDGFVPRLPLKRAWSEQCDLRQELAVPSSTRIFSLAKALHDGVTVDQIHQLTAIDKWFLHKLRRITELEKHLSQYDSS--TVPGDVLLKAKQEGFSDRQVGQALGSSEGEARALRHSRNIQPWVKQIDTLAAEYPAVTNYLYCTYHGQEHDLDFRDQGVMVLGCGPYHIGSSVEFDWCAVSSIRTLRQMGKRTVVVNHNPETVSTDFDECDRLYFEELTLERILDITQQESCTGCIVSVGGQIPNNLAVPLHQNGVRILGTSPLQIDRAEERSVFSTILDDLGVSQAPWRALSSLEDAFAFANKVGYPCLLRPSYVLSGSAMNVAYGEEEMKRFLEEAAQVSQEHPVVITKFIRGAREVEVDAVAKAGKVLVHAITEHVEDAGVHSGDATLMLPTQTISQGALEKVKTATRKIAKAFEISGPFNTQFLVKGNDVMVIECNLRASRSFPFVSKTIGVDFINVATRVMVGEPVNESQLPTLENPIIPVDYVGIKAPMFSWPRLRDADPVLRCEMASTGEVACFGPNIYSAFLKAMLSTGFKLPQK--GILIGIQ-------------VRNEGFPLDLLEQATSAWLNANDVSTTPVAWP--RHEGKETTLPSISRLLSDGHIDLVVNLPNNNTKFLKDNFLIRRMAVDYGVPLITNFQVVKLFVEAIKYSSELDTTSLFHYR 1466          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Cavefish
Match: cad (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:ZFIN;Acc:ZDB-GENE-021030-4])

HSP 1 Score: 1479.54 bits (3829), Expect = 0.000e+0
Identity = 762/1489 (51.18%), Postives = 1026/1489 (68.91%), Query Frame = 1
Query:  175 ARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAKIEFDTDPIE---FKDPNKSNLTADVSTNYIQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIETRN-EPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKS----------KSKTT----IIPSPKTIDFEPPXXXXXXXXXXXXXXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTSTEDFQNLDIPAATK------LISDKFFDLVINLP------NYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVESL----------DHVDLVTTDSLFN 4521
            A L L +G  F G  FG   S +GE+VF TG+ GYPE+LTDPSY+ QILTLTYP++GNYGVP ++     G+    ES RIH + LIV + S+  SHW+SVKSL QWL ++ +P L G+DTR LTK +R+ G +L K+  +  P E   F +P+  NL  +VS    +V+      +I+ VDCGIK+N I+ L  RGA+VTLVPWDY      +DGLFISNGPGDP    +T++N++ ++   N +P+FGIC G+QL+ L  GA TYK+  GNRGHNQP ++  T + FITSQNHG+ ++ ++L  DW VLF N+ND T+EGI++  KP+F+ QFHPE   GP D   LFD +++ V+           K + T       SPK+ +F  P+   +L  G     IGQAGEFDYSGSQAIKALKEE I+TIL+NPNIA+VQT+      AD VYFLP+T E+V +V++ ERPDG+LL+ GGQTALN G+EL ++G+L KY+V+VLGT + SI  TEDR+ F + ++EI   +APS A +S+E A+ AA ++GYPV++R+AFALGGLGSG A++KE+L+ +  ++FA T+QVL+++SL GWKE+EYEVVRDA DNCITVCNMEN DPLG+HTG+SIVVAPSQTL++YEY+MLR TA+KVIRH GIVGECNIQYAL+PES +Y IIE+NARLSRSSALASKATGYPLA++AAKL LGI L D+KN+ T  T+A FEPSLDY   K+PRWDL +F     +IGSSMKSVGEVMAIGR+FEE+ QKALRM   +  G    +   K  SE     + L  P++ RI  +  A   GYSV+ ++ LTKID WFLHK++ IV+    +   N +   +  E +  AKQ GFSDKQI L +  +E+ VR++R++  I P VK IDT+AAE+P  TNYLY +Y+G E D++F++  VMV+G G Y IGSSVEFDWCAV  I  LRK G +T+++N+NPETVSTD+D  +RLYF+E+S E V+DIY+ ENP+G I+S+GGQ+PNN+A+ L +    ILGT P  ID AE+R KFS +LD I + Q  W+ LS  + A+ F   VGYPCLVRPSY+LSG+AMNVAYT ++L  +L SA  +S+++PVVI+KF++ AKEI+ DA+A DGV++  A+SEH+ENAGVHSGDATLV P   I+     +I+ I   I ++ +++GPFN+Q + K+ ++ VIECN+R SRS PFVSKT+G D++A AT+V+M   ++             K  +G+K P FS+ RL  AD VL  EM+STGEVACFGEN Y A+LKA+ S+ F++P+KN  + IG  ++ +   LPT ++L   GYN+YA+  TA++   H +    V WP   E     D P   K       + +  FD+VINL          + +VT+ Y  RR A+D + PL+I+ +  K+ V++L           HVD +T+  L  
Sbjct:    6 ASLVLEDGTTFKGRLFGASASVSGEVVFQTGMVGYPEALTDPSYKSQILTLTYPLIGNYGVP-SDEDGEFGISKWFESSRIHATALIVGELSQNPSHWSSVKSLDQWLKEQGIPGLEGVDTRCLTKKIREKGTMLGKLVVEGTPAENILFDNPDSRNLVKEVSVKKPRVYNPDGNLRILAVDCGIKYNQIRCLCQRGAQVTLVPWDYPLDVCDFDGLFISNGPGDPQHCKKTIENLRKIVCVENPKPVFGICLGHQLLSLVIGAETYKMKYGNRGHNQPCVHKGTGRCFITSQNHGFAVDPKTLPKDWDVLFTNSNDHTSEGIIHHHKPLFSVQFHPEHMAGPADLVSLFDVFLDAVRDFKMGTANKSVKERLTRHLAFHKSPKSEEFVRPRKVLILGSGGLS--IGQAGEFDYSGSQAIKALKEENIQTILINPNIATVQTS---KGLADKVYFLPITPEYVTQVIKNERPDGVLLTFGGQTALNCGVELTKQGVLEKYNVRVLGTQVSSIEMTEDRKIFVEKMEEINEHVAPSEAAMSVEQAVAAAERLGYPVLIRSAFALGGLGSGFANSKEELITLVTQSFAHTSQVLVDKSLKGWKEIEYEVVRDAFDNCITVCNMENIDPLGIHTGESIVVAPSQTLNDYEYNMLRNTAIKVIRHLGIVGECNIQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLGLGIPLPDLKNSVTNSTTANFEPSLDYCVVKVPRWDLSKFLRVSTKIGSSMKSVGEVMAIGRSFEEAFQKALRMVDENCVGFDHTI---KPVSE-----QELQIPTDKRIFVLAAALHAGYSVDHLYELTKIDRWFLHKMQNIVNHEKLLQTYNQDESLMPPEVMRKAKQLGFSDKQIALAVQSTELAVRKLRRNWNILPVVKQIDTVAAEWPAHTNYLYLTYHGTEWDLSFEESHVMVIGSGVYRIGSSVEFDWCAVGCIMELRKMGYKTIMVNYNPETVSTDYDMCNRLYFDEISFEVVMDIYEMENPEGIILSMGGQLPNNIAMSLHRQQCRILGTSPEFIDSAENRFKFSRMLDTIGISQPRWKELSDTESAMHFCETVGYPCLVRPSYVLSGAAMNVAYTDSDLEKYLSSAVAVSKEHPVVISKFIQEAKEIDVDAVACDGVVIAIAISEHVENAGVHSGDATLVTPAQDINHKTMERIKSIVHAIGQELQVTGPFNLQLIAKDDQLKVIECNVRVSRSFPFVSKTLGVDLVALATQVIMGEEVEPVGLMKG------KGVVGVKVPQFSFSRLAGADVVLGVEMTSTGEVACFGENRYEAYLKAMLSTGFKIPKKNVLLSIG-SYKNKTELLPTVQALESLGYNLYASLGTADFYTEHGVKVMAVDWPFEEES----DSPNKDKQRNIMDYLEENHFDMVINLSMRNSGGRRLSSFVTKGYRTRRMAVDYSVPLIIDIKCTKLFVQALRQIGQAPPLKTHVDSMTSQKLIR 1469          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Yeast
Match: URA2 (Bifunctional carbamoylphosphate synthetase/aspartate transcarbamylase; catalyzes the first two enzymatic steps in the de novo biosynthesis of pyrimidines; both activities are subject to feedback inhibition by UTP [Source:SGD;Acc:S000003666])

HSP 1 Score: 1500.72 bits (3884), Expect = 0.000e+0
Identity = 763/1485 (51.38%), Postives = 1038/1485 (69.90%), Query Frame = 1
Query:  181 LHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDS--NGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAKIEFDT-----------------DPIEFKDPNKSNLTADVSTNY--------------IQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIETRNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSKSKTTIIPSPKTIDF-----------EPPXXXXXXXXX-XXXXXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAF-EKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTSTEDFQNLDIPAATKLISDKFFDLVINLPNYK-----TKYVTENYLIRRAAIDSATPLMINFELVKMLVESL 4482
            L L +G V  GYSFG +KS AGELVF TG+ GYPES+TDPSY GQIL +TYP+VGNYGVPD + RD     L    ES RIH++GL++  Y++  SH+ +  SL +WL +E +PA++G+DTR LTK +RD+G++L ++  +                  D  E+ DPN  NL + VS N               +Q    G   +I+ +D G+K+N I+  I RG E+ +VPW+YDFTK+ YDGLFISNGPGDP+++ +  + +  V+E +  P+FGIC G+QL+  AAGA+T KL  GNRGHN P  + I+ + +ITSQNHG+ ++ ++L+  WK LF+NAND +NEGI +++ P F+ QFHPE+  GP DTEFLFD +++ VK    T ++   K I F            P    K +++  SGGLSIGQAGEFDYSGSQAIKALKEEGI TIL+NPNIA++QT+      AD VYF+PVTAEFV KV+  ERPD I ++ GGQTAL+VGI + ++       VKVLGTPI +II TEDR+ F++ + EI  K A S+A  S+++A+ A  +IG+PV+VRAA+ALGGLGSG A+N+++L+D+C  AF+ + QVL+E+S+ GWKEVEYEVVRDA DNCITVCNMENFDPLG+HTGDSIVVAPSQTLS+ +Y+MLR TA+ VIRH G+VGECNIQYAL+P S +YCIIE+NARLSRSSALASKATGYPLA+ AAKL L I L ++KN+ T+ T ACFEPSLDY   K+PRWDL +F     E+ SSMKSVGEVM+IGRTFEE++QKA+R T  +  G         +   + D+D  L  P++ R+  I NAF +KGYSV+K+  +T+ID WFL+K+  +V  A  IS   G  + L    L  AKQ GF D+QI   +  +E+ +R +R+   ITP+VK IDT+AAE+P  TNYLY +YN   HD++FD  GVMVLG G Y IGSSVEFDWCAV+A+R LR    +T+++N+NPETVSTD+DE+DRLYFE ++LERVLDIY+ EN  G ++S+GGQ  NN+A+ L + +V ILGT P+ ID AE+R KFS +LD+I V Q +W+ L+S+D+A  FA +VGYP LVRPSY+LSG+AMN  Y+ N+L  +L  A ++S+DYPVVITK++E AKEIE DA+A++G +V H +SEH+ENAGVHSGDATL++PP  ++ +   +I   ++KI K  +I+GP+N+QF+ K+ EI VIECN+RASRS PF+SK +G ++I  ATK +M +PL     + ++  + P +Y+ +K P FS+PRL  ADPVL  EM+STGEVA FG + Y A+LK+L ++ F+LP+KN  + IG   E Q   L + + L++ GY ++AT  TA++L  H I    +      +D Q  +  + T+ +++   DL INLP+         YV++ Y  RR A+D + PL+ N +  K+L+E++
Sbjct:   24 LELKDGTVLQGYSFGAEKSVAGELVFQTGMVGYPESVTDPSYEGQILVITYPLVGNYGVPDMHLRDELVEELPRYFESNRIHIAGLVISHYTDEYSHYLAKSSLGKWLQNEGIPAVYGVDTRSLTKHLRDAGSMLGRLSLEKSGSDRTISRSSSWRSAFDVPEWVDPNVQNLVSKVSINEPKLYVPPADNKHIELQTGPDGKVLRILAIDVGMKYNQIRCFIKRGVELKVVPWNYDFTKEDYDGLFISNGPGDPSVLDDLSQRLSNVLEAKKTPVFGICLGHQLIARAAGASTLKLKFGNRGHNIPCTSTISGRCYITSQNHGFAVDVDTLTSGWKPLFVNANDDSNEGIYHSELPYFSVQFHPESTPGPRDTEFLFDVFIQAVKEFKYTQVL---KPIAFPGGLLEDNVKAHPRIEAKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTILINPNIATIQTS---KGLADKVYFVPVTAEFVRKVILHERPDAIYVTFGGQTALSVGIAMKDE--FEALGVKVLGTPIDTIITTEDRELFSNAIDEINEKCAKSQAANSVDEALAAVKEIGFPVIVRAAYALGGLGSGFANNEKELVDLCNVAFSSSPQVLVEKSMKGWKEVEYEVVRDAFDNCITVCNMENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYALNPVSKDYCIIEVNARLSRSSALASKATGYPLAYTAAKLGLNIPLNEVKNSVTKSTCACFEPSLDYCVVKMPRWDLKKFTRVSTELSSSMKSVGEVMSIGRTFEEAIQKAIRSTEYANLGFN-------ETDLDIDIDYELNNPTDMRVFAIANAFAKKGYSVDKVWEMTRIDKWFLNKLHDLVQFAEKISSF-GTKEELPSLVLRQAKQLGFDDRQIARFLDSNEVAIRRLRKEYGITPFVKQIDTVAAEFPAYTNYLYMTYNADSHDLSFDDHGVMVLGSGVYRIGSSVEFDWCAVTAVRTLRANNIKTIMVNYNPETVSTDYDEADRLYFETINLERVLDIYEIENSSGVVVSMGGQTSNNIAMTLHRENVKILGTSPDMIDSAENRYKFSRMLDQIGVDQPAWKELTSMDEAESFAEKVGYPVLVRPSYVLSGAAMNTVYSKNDLESYLNQAVEVSRDYPVVITKYIENAKEIEMDAVARNGELVMHVVSEHVENAGVHSGDATLIVPPQDLAPETVDRIVVATAKIGKALKITGPYNIQFIAKDNEIKVIECNVRASRSFPFISKVVGVNLIELATKAIMGLPLTP---YPVE--KLPDDYVAVKVPQFSFPRLAGADPVLGVEMASTGEVATFGHSKYEAYLKSLLATGFKLPKKNILLSIGSYKEKQ-ELLSSVQKLYNMGYKLFATSGTADFLSEHGIAVQYLEVLNKDDDDQKSEY-SLTQHLANNEIDLYINLPSANRFRRPASYVSKGYKTRRLAVDYSVPLVTNVKCAKLLIEAI 1485          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Yeast
Match: CPA2 (Large subunit of carbamoyl phosphate synthetase; carbamoyl phosphate synthetase catalyzes a step in the synthesis of citrulline, an arginine precursor [Source:SGD;Acc:S000003870])

HSP 1 Score: 1050.43 bits (2715), Expect = 0.000e+0
Identity = 552/1059 (52.12%), Postives = 743/1059 (70.16%), Query Frame = 1
Query: 1336 IGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAF-EKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGK------SEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGE--ILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSS-NFRLPRKNSNILIG--LQHEFQPRFLPTAKSLHDHGYNIYAT-EATAEYLKMHKIPAN----LVSWPTS-----TEDFQNLDIPAATKLISDKFFDLVINLPNYKTKYVTE-NYLIRRAAIDSATPLM 4443
            IGQAGEFDYSGSQAIKALKE+   TIL+NPNIA+ QT+      AD +Y+LPVT E++  ++E ERPD ILL+ GGQT LN G+ L E G+L+KY+VKVLGTPIK++I +EDR  FA  LK+I   +A S A  ++++A+EAA ++ YPV+VR+A+ALGGLGSG A+N  ++ ++  ++ ++  Q+L+E+SL GWKEVEYEVVRD   NCITVCNMENFDPLGVHTGDS+V APSQTLS+ E+HMLR  A+K+IRH G++GECN+QYAL P+ L+Y +IE+NARLSRSSALASKATGYPLA+ AAK+ LG  L ++ N  T+ T A FEPSLDYI  KIP+WDL +F +  + IGSSMKSVGEVMAIGR +EE+ QKALR   PSL G      G  ++ +   LD+ L TP++ R+  I  A   + Y+VE+++ L+KID WFL+K   IV++  ++  V  +L  LS + L  AK+ GFSDKQI + I K      +E+E+R +R+++ I P+VK IDT+AAE+P  TNYLY +YN  ++DV F++ G++VLG G Y IGSSVEFDWCAV+  + LR  G++T++IN+NPETVSTDFDE DRLYFEELS ERV+DIY+ E  +G IISVGGQ+P N+AL L+ N  NI+GT+PN ID AE+R KFS+ILD IDV Q  W  L+SV++A  FAS+V YP L+RPSY+LSG+AM+V     EL   L  A  +S D+PVV++KF+EGA+EI+ DA+A +G ++ HA+SEH+ENAGVHSGDA+LVLPP  +S D+   +++I+ K+AK ++I+GPFN+Q ++K+GE  + VIECN+RASRS PFVSK +G + I  A K  +   +  K    + N +   +Y+  K P FS+ RL  ADP L  EM+STGEVA FG ++  ++  A+QS+ NF +P   S IL G     E+  +      ++   GY IY T E T  YL+ H    N    L+ +P +      E FQ  DI A            V NL + + +   + +Y++RR AID A PL 
Sbjct:   41 IGQAGEFDYSGSQAIKALKEDNKFTILVNPNIATNQTS---HSLADKIYYLPVTPEYITYIIELERPDAILLTFGGQTGLNCGVALDESGVLAKYNVKVLGTPIKTLITSEDRDLFASALKDINIPIAESFACETVDEALEAAERVKYPVIVRSAYALGGLGSGFANNASEMKELAAQSLSLAPQILVEKSLKGWKEVEYEVVRDRVGNCITVCNMENFDPLGVHTGDSMVFAPSQTLSDEEFHMLRSAAIKIIRHLGVIGECNVQYALQPDGLDYRVIEVNARLSRSSALASKATGYPLAYTAAKIGLGYTLPELPNPITKTTVANFEPSLDYIVAKIPKWDLSKFQYVDRSIGSSMKSVGEVMAIGRNYEEAFQKALRQVDPSLLG----FQGSTEFGDQ--LDEALRTPTDRRVLAIGQALIHENYTVERVNELSKIDKWFLYKCMNIVNIYKELESVK-SLSDLSKDLLQRAKKLGFSDKQIAVTINKHASTNINELEIRSLRKTLGIIPFVKRIDTLAAEFPAQTNYLYTTYNATKNDVEFNENGMLVLGSGVYRIGSSVEFDWCAVNTAKTLRDQGKKTIMINYNPETVSTDFDEVDRLYFEELSYERVMDIYELEQSEGCIISVGGQLPQNIALKLYDNGCNIMGTNPNDIDRAENRHKFSSILDSIDVDQPEWSELTSVEEAKLFASKVNYPVLIRPSYVLSGAAMSVVNNEEELKAKLTLASDVSPDHPVVMSKFIEGAQEIDVDAVAYNGNVLVHAISEHVENAGVHSGDASLVLPPQHLSDDVKIALKDIADKVAKAWKITGPFNMQ-IIKDGEHTLKVIECNIRASRSFPFVSKVLGVNFIEIAVKAFLGGDIVPKPVDLMLNKK--YDYVATKVPQFSFTRLAGADPFLGVEMASTGEVASFGRDLIESYWTAIQSTMNFHVPLPPSGILFGGDTSREYLGQVASIVATI---GYRIYTTNETTKTYLQEHIKEKNAKVSLIKFPKNDKRKLRELFQEYDIKA------------VFNLASKRAESTDDVDYIMRRNAIDFAIPLF 1071          

HSP 2 Score: 167.548 bits (423), Expect = 2.944e-42
Identity = 118/391 (30.18%), Postives = 195/391 (49.87%), Query Frame = 1
Query: 2965 VMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALP------LFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAI---AKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEG--EILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEK----DYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQ 4092
            V+V+G G   IG + EFD+    AI+AL++  + T+++N N  T  T    +D++Y+  ++ E +  I + E P   +++ GGQ   N  +       L K +V +LGT    +  +EDR  F++ L +I++  A   +  +VD+ALE A RV YP +VR +Y L G     A   +E+     +A+ +S    +++ K L+G KE+E + +     + + VC+   E+ +  GVH+GD+ +  P  T+S +    +R  + KI +   + G  NVQ+ ++    +  VIE N R SRS    SK  G  +  TA K+ +   L E        T+ N     +Y+  K P +   +    D  +   M S GEV   G N   AF KAL+
Sbjct:   31 VLVIGSGGLSIGQAGEFDYSGSQAIKALKEDNKFTILVNPNIATNQTSHSLADKIYYLPVTPEYITYIIELERPDAILLTFGGQTGLNCGVALDESGVLAKYNVKVLGTPIKTLITSEDRDLFASALKDINIPIAESFACETVDEALEAAERVKYPVIVRSAYALGGLGSGFANNASEMKEL--AAQSLSLAPQILVEKSLKGWKEVEYEVVRDRVGNCITVCNM--ENFDPLGVHTGDSMVFAPSQTLSDEEFHMLRSAAIKIIRHLGVIGECNVQYALQPDGLDYRVIEVNARLSRSSALASKATGYPLAYTAAKIGLGYTLPELPNPITKTTVANFEPSLDYIVAKIPKWDLSKFQYVDRSIGSSMKSVGEVMAIGRNYEEAFQKALR 417          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Yeast
Match: CPA1 (Small subunit of carbamoyl phosphate synthetase; carbamoyl phosphate synthetase catalyzes a step in the synthesis of citrulline, an arginine precursor; translationally regulated by an attenuator peptide encoded by YOR302W within the CPA1 mRNA 5'-leader [Source:SGD;Acc:S000005829])

HSP 1 Score: 367.851 bits (943), Expect = 3.349e-115
Identity = 175/378 (46.30%), Postives = 249/378 (65.87%), Query Frame = 1
Query:  169 TKARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAKIEF-DTDPIEFKDPNKSNLTADVSTN---YIQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDF--TKDKYDGLFISNGPGDPALVSETVKNIKTVIET---RNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESL-SDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYME-----MVKSKSKTTI 1257
            TKA   + NG  F G SFG +KS AGE VF T L GYPES+TDPSYRGQIL  T P++GNYGVP   ARD   L+   ES  IHV G++V +Y+ + SHW +V+SL+QW   E V A+ G+DTR L + +R+ G+ L +I   D DP+ + +P K+NL A V+T    ++          +  +DCG+K N+I+ L+ RGA VT+ P+DY       ++DG+F+SNGPG+P L   T+ N++ ++        P+FGIC G+QL+ LA+GA+T+KL  GNR HN P +++ T Q  ITSQNHGY ++ E+L  D WK  F+N NDK+NEG+++ ++PIF+ QFHPEA GGP DT  LFD + +      ++S++K++I
Sbjct:    6 TKATFCIQNGPSFEGISFGANKSVAGETVFTTSLVGYPESMTDPSYRGQILVFTQPLIGNYGVPSGEARDEYNLLKYFESPHIHVVGIVVAEYAYQYSHWTAVESLAQWCQREGVAAITGVDTRELVQYLREQGSSLGRITLADHDPVPYVNPMKTNLVAQVTTKKPFHVSALPGKAKANVALIDCGVKENIIRCLVKRGANVTVFPYDYRIQDVASEFDGIFLSNGPGNPELCQATISNVRELLNNPVYDCIPIFGICLGHQLLALASGASTHKLKYGNRAHNIPAMDLTTGQCHITSQNHGYAVDPETLPKDQWKPYFVNLNDKSNEGMIHLQRPIFSTQFHPEAKGGPLDTAILFDKFFDNIEKYQLQSQAKSSI 383          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Yeast
Match: HFA1 (Mitochondrial acetyl-coenzyme A carboxylase; catalyzes production of malonyl-CoA in mitochondrial fatty acid biosynthesis; relocalizes from mitochondrion to cytoplasm upon DNA replication stress; genetic and comparative analysis suggests that translation begins at a non-canonical (Ile) start codon at -372 relative to the annotated start codon [Source:SGD;Acc:S000004820])

HSP 1 Score: 48.521 bits (114), Expect = 9.960e-6
Identity = 41/192 (21.35%), Postives = 87/192 (45.31%), Query Frame = 1
Query: 1738 SIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMT--NQVLIEQSLLGWKEVEYEVVRDAADNCITV----CNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKL---TDIK 2286
            S EDA+E A  IG+PVM++A+   GG G    DN++  + + ++A   T  + + + + +   + +E +++ D     IT+    C+++      +      +  P        +  +   A+++    G V    ++Y   P+  ++  +E+N RL          +G  L     ++A+GI +   +DI+
Sbjct:  160 SPEDALEKAKLIGFPVMIKASEGGGGKGIRRVDNEDDFIALYRQAVNETPGSPMFVMKVVTDARHLEVQLLADQYGTNITLFGRDCSIQRRHQKIIEEAPVTITKPET------FQRMERAAIRLGELVGYVSAGTVEYLYSPKDDKFYFLELNPRLQVEHPTTEMISGVNLPATQLQIAMGIPMHMISDIR 345          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Nematostella
Match: EDO37703 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF31])

HSP 1 Score: 1496.1 bits (3872), Expect = 0.000e+0
Identity = 773/1473 (52.48%), Postives = 1030/1473 (69.93%), Query Frame = 1
Query:  175 ARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAKIEFD-TDP--IEFKDPNKSNLTADVSTNYIQVFG-RGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKD----KYDGLFISNGPGDPALVSETVKNIKTVIETRNE-PLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSK--SKTTIIPSPKTID----FEP-----PXXXXXXXXXXXXXXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTSTEDFQNLDIPAATK--------LISDKFFDLVINLP------NYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVESLDHV 4491
            A L L++G V+ G  FG  K+  GE+VF TG+ GYPESLTDPSY+ Q+L LTYP++GNYG P+   +D +GL LN ES +I  + LIV DY E  SHWN+ +SLS WLT++ +P + GIDTR LTK +R+ G +L KI  D TDP  + F DPN  NL   VS     V+  +G P+ I+ +DCGIK+N I+ L++RGA V +VPW +DF  +     +DG+F+SNGPGDP+     + NI+  I  +N  PLFGIC G+QL+ LA G  ++K+  GNRGHN P  +  TN+ FIT+QNHG+ ++T S+  DW  LF NAND+TNEGI++   P F+ QFHPE  GGP D E LFD ++E VK     K + +   + I     F+P      K KKVL+LGSGGLSIGQAGEFDYSGSQAIKALKEE I+T+++NPNIA+VQT       +D VYFLP+TA++V +V+  ERPDGILL+ GGQTALN GIEL ++G+L +Y+VKVLGTP+ +I+ TEDR+ FA+ L EI   +APS AV S+++A+ AA ++GYPVMVRAAFALGG+GSG AD+KE+L  +   A A + Q++I++SL GWKE+EYEVVRDA DNCITVCNMEN DPLG+HTG+SIVVAPSQTL+N EY+MLR TA+KVI+H G+VGECNIQYAL+P+S EY IIE+NARLSRSSALASKATGYPLA++AAKLALG  L  ++N+ T  T+ACFEPSLDY+  KIPRWDL +F     +IGS MKSVGEVMAIGR FEE+LQKALRM   S  G         D   N   D+ L  PS+ RIH +  + ++GY++++++ LTKID WFLH++K I+D    +         +++  L  AK+ GFSDKQI   +  +E+ VR++R+ MK+TP++K IDT+AAEYP  TNYLY +YN  E D+ F    +MVLG G Y IGSSVEFD CAV  IR L+K G+QT+++N+NPETVSTD+DE DRLYF+E+S E V+DIYQ E P+G I+S+GGQ+PNN+A+PL +    I GT P  ID+AE+R KFS +LD I + Q  W+ L++V+ A EF  +V YPCLVRPSY+LSG+AM VAY+  +L  +L S   +S+D+PVVI+KF++ AKEI+ DA+A+DG +V  A+SEH+ENAGVHSGDAT+VLPP  I++    +IR I  +I     ++GPFN+Q + K+ ++ VIECNLR SRS PFVSKT+ TD +A AT+V+  + ++      +D     +  +G+K P FS+ RL  AD  L  EM+STGEVACFGEN Y AFLK L S+ FR+P+++  + IG  ++F+   LP+  +L + GY++YA+  TA++   H I  + V WP +  D  N +   AT          +S    DL INLP         + ++T  Y  RR AID + PL+ + +  K+ VE+L  V
Sbjct:    2 ASLFLDDGSVYRGKLFGAAKNVPGEVVFQTGMVGYPESLTDPSYQAQLLILTYPLIGNYGAPEAK-QDKHGLDLNFESHKIWAAALIVGDYIEEYSHWNAKRSLSTWLTEQGIPGISGIDTRALTKKIREKGTMLGKIVIDGTDPETVPFHDPNLENLVDIVSCKIPTVYNPQGTPH-IIALDCGIKYNQIRCLVSRGACVKVVPWSHDFNPEVKNGDFDGVFLSNGPGDPSYCMAAIDNIRQHIHDKNPIPLFGICLGHQLLSLAVGCKSFKMKYGNRGHNIPCTHHGTNRCFITTQNHGFAIDTTSIPKDWSTLFTNANDQTNEGIIHNTLPFFSVQFHPEHMGGPRDLECLFDIFLETVKQYKLGKVSDMSVKERIQQQFMFKPVNPVETKPKKVLILGSGGLSIGQAGEFDYSGSQAIKALKEECIQTVVVNPNIATVQTT---KGLSDKVYFLPITADYVTQVIHSERPDGILLAFGGQTALNCGIELRDRGVLDEYNVKVLGTPVDAIVCTEDRKMFAEKLLEIDEHVAPSEAVFSVDEALAAAGRLGYPVMVRAAFALGGMGSGFADDKEELTQLASMALANSKQLIIDKSLKGWKEIEYEVVRDAYDNCITVCNMENVDPLGIHTGESIVVAPSQTLTNSEYNMLRSTAIKVIKHLGVVGECNIQYALNPDSQEYFIIEVNARLSRSSALASKATGYPLAYVAAKLALGRPLPVLRNSVTNSTTACFEPSLDYVVVKIPRWDLSKFSRVSTKIGSCMKSVGEVMAIGRRFEEALQKALRMVDESNLGF--------DSHRNAASDEELREPSDKRIHVVAASLKEGYTIDRLYELTKIDRWFLHRMKAIIDYGTMLKSYRAGSDPVTYNHLLEAKRLGFSDKQIAKCVHSTELAVRKLREEMKLTPFIKQIDTVAAEYPACTNYLYLTYNAQEDDLGFPGNAMMVLGSGVYRIGSSVEFDCCAVGCIRELKKLGKQTIMVNYNPETVSTDYDECDRLYFDEISFESVMDIYQREKPEGIILSMGGQLPNNIAMPLHRQEARIFGTSPEYIDNAENRFKFSRLLDNIGILQPQWKELTTVESAKEFCHKVSYPCLVRPSYVLSGAAMIVAYSDTDLENYLGSEVFLSRDHPVVISKFIQEAKEIDVDAVAQDGKVVAIAVSEHVENAGVHSGDATMVLPPQDINQVTMEKIRSICYRIGAALSVTGPFNMQLIAKDDQLKVIECNLRVSRSFPFVSKTLDTDFVAMATRVICGLTVEPA--LDMDG----RGRVGVKVPQFSFSRLAGADARLGVEMASTGEVACFGENRYEAFLKGLLSTGFRIPKRSILLSIG-SYKFKNELLPSVHTLRNLGYSLYASVGTADFYTEHGITVHAVDWPFA--DANNGNGNGATTEGEQSIADYLSQNMIDLFINLPLRSNPGKKVSSFMTRGYQTRRMAIDYSVPLITDVKCAKLFVEALKRV 1452          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Nematostella
Match: EDO33367 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSG4])

HSP 1 Score: 1310.43 bits (3390), Expect = 0.000e+0
Identity = 661/953 (69.36%), Postives = 787/953 (82.58%), Query Frame = 1
Query:  175 ARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAKIEFDTDPIEFKDPNKSNLTADVSTNYIQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIE-TRNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMV---KSKSKTTIIPSPKTIDFEPPXXXXXXXXXXXXXXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENF--DLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEF 3015
            A L L +G    G+SFG   ST+GE+VFNTGL GYPE+LTDPSY GQILTLTYPI+GNYGVPDT A D  GL+  VES ++ VSGL+VQDYS   SHWN+VKSLS+WLT+E VPAL+GIDTRMLTK VR+ G VL KI+F+  PI+F +PN  NLTA+VST Y +V+G+GN  KI+ VDCGIK N+I+ L+ RGAEV +VPW+YD+++++YDGLF+SNGPGDPA  ++ + N++ VI   RNEP+FGIC GNQLV LAAGA T+KLPLGNRGHNQPVIN +T QAFITSQNHGY ++  +L  DWK +F+NAND +NEGIM+T KPI TAQFHPE  GGPTDTEFLFDA++ MV   KS  +   +PS  T   E  ++KKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEE IET+LMNPNIASVQTN  G+KQAD VYF+PVT+EF+E V+++ERPDG+LLSMGGQTALN G++L++KGI  KY+V+VLGTPI+SI ATEDRQ FA+ LKEI  KLAPS AV S+E+A++AA +I YPVMVRAA+ALGGLGSG+ +N+ +L  + K+A A+  Q+LIEQSLLGWKEVEYEVVRDAA+NCITVCNMENFDPLGVHTGDS+VVAPSQTLSN EYHMLRETA+KV+RHFGIVGECNIQYALHP SLEYCIIEINARLSRSSALASKATGYPLAFIAAKLALGI+L DIKNATTQ+T+ACFEPSLDYI TKIPRWDLDRF  TPKEIGSSMKSVGEVMAIGRTFEESLQKALRM HPS++G  SK+    D S  +  +LD+ L  PSN+R++ I  A E+GYSVE+I+ LT IDPWFL K++RI+ L  DI   N + ++L  + L  AK+ GFSD+Q+  L+   E+ +R+ R +  +TPWVK IDTMAAEYP  TNYLY +YNG EHD+ FD+ G+MVLGCGPYHIGSSVEF
Sbjct:    1 ASLILEDGTRLEGFSFGKPVSTSGEVVFNTGLVGYPEALTDPSYYGQILTLTYPILGNYGVPDTKAVDQYGLLKYVESSKVQVSGLLVQDYSHEYSHWNAVKSLSEWLTEENVPALYGIDTRMLTKFVREKGTVLGKIQFENQPIDFINPNLRNLTAEVSTRYFKVYGKGNALKIIAVDCGIKENIIRNLVQRGAEVHVVPWNYDYSQEEYDGLFLSNGPGDPATTTDAINNLRKVINGDRNEPIFGICMGNQLVSLAAGAKTFKLPLGNRGHNQPVINRLTGQAFITSQNHGYAVDEATLPRDWKPIFVNANDGSNEGIMHTSKPIVTAQFHPEHFGGPTDTEFLFDAFISMVRDGKSPVEAMRLPSKPT---ERKQLKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEENIETVLMNPNIASVQTNEVGEKQADTVYFVPVTSEFIEDVIKRERPDGVLLSMGGQTALNCGVDLYDKGIFQKYNVQVLGTPIESIKATEDRQIFANRLKEINEKLAPSVAVYSVEEAVKAAKKIKYPVMVRAAYALGGLGSGLCENEAKLRALAKKALAIAPQILIEQSLLGWKEVEYEVVRDAANNCITVCNMENFDPLGVHTGDSVVVAPSQTLSNQEYHMLRETAIKVVRHFGIVGECNIQYALHPTSLEYCIIEINARLSRSSALASKATGYPLAFIAAKLALGIELPDIKNATTQVTTACFEPSLDYIVTKIPRWDLDRFQMTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMVHPSVDGFISKVP---DLSVKWASNLDEALRVPSNTRMYSIARALEEGYSVERINELTAIDPWFLCKLERIIKLEKDIK--NTSPETLPLDTLVYAKKMGFSDRQMARLMATDELSMRKNRIAKGVTPWVKQIDTMAAEYPASTNYLYMTYNGQEHDLVFDEHGIMVLGCGPYHIGSSVEF 945          

HSP 2 Score: 161.77 bits (408), Expect = 3.181e-40
Identity = 121/394 (30.71%), Postives = 196/394 (49.75%), Query Frame = 1
Query: 2965 VMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDF---DESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLF------KNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAI---AKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEG--EILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPR---EPK-NYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQ 4092
            V+VLG G   IG + EFD+    AI+AL++   +TV++N N  +V T+     ++D +YF  ++ E + D+ + E P G ++S+GGQ   N  + L+      K +V +LGT    I   EDR  F+  L EI+ K A   ++ SV++A++ A ++ YP +VR +Y L G  +      NE      + K ++    ++I + L G KE+E + +   A + + VC+   E+ +  GVH+GD+ +V P  T+S      +RE + K+ + F I G  N+Q+ +     E  +IE N R SRS    SK  G  +   A K+ + I L +    T        EP  +Y+  K P +   R       +   M S GEV   G     +  KAL+
Sbjct:  379 VLVLGSGGLSIGQAGEFDYSGSQAIKALKEENIETVLMNPNIASVQTNEVGEKQADTVYFVPVTSEFIEDVIKRERPDGVLLSMGGQTALNCGVDLYDKGIFQKYNVQVLGTPIESIKATEDRQIFANRLKEINEKLAPSVAVYSVEEAVKAAKKIKYPVMVRAAYALGG--LGSGLCENEAKLRALAKKALAIAPQILIEQSLLGWKEVEYEVVRDAANNCITVCNM--ENFDPLGVHTGDSVVVAPSQTLSNQEYHMLRETAIKVVRHFGIVGECNIQYALHPTSLEYCIIEINARLSRSSALASKATGYPLAFIAAKLALGIELPDIKNATTQVTTACFEPSLDYIVTKIPRWDLDRFQMTPKEIGSSMKSVGEVMAIGRTFEESLQKALR 768          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Nematostella
Match: EDO43751 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXC8])

HSP 1 Score: 643.269 bits (1658), Expect = 0.000e+0
Identity = 305/486 (62.76%), Postives = 382/486 (78.60%), Query Frame = 1
Query: 3070 VVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTSTEDFQNLDIPAATKLISDKFFDLVINLPNYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVESLDHVDLVTTDSLFNYQ 4527
            VV+N+NPETVSTD+DE DRLYFEELSLERVLDIYQ E  +GAIISVGGQIPNNLALPL  N V ILGT P  ID AE+RS+FS I+DEI+V QA WR+L +VDDAL+FA+ VGYPCL+RPS++LSGSAMNVAY P +L  FL  A ++SQD+PVVITKF+ GA+E+E DA+AK G +VCHA+SEH+ENAGVHSGDATL+LPP  I  D   +I+E++SKIAK+F ISGPFN+QFLVK+  ++VIECNLRASRS PFVSKTIG D I  ATK+M+N P D K +  ++ P +P+ ++GIK+PMFSWPRL  ADP+LRCEM+STGEVACFG  V +AFL AL S+ F++P K  N++IG+Q +FQ  FLPTA  LH  GY ++AT+AT++YLK H IPA  VSWP   E     + P A +LIS+K  D+VINLPN  TKYV +NY+IRRAAID+  PL+ NFE+ K+L ++L     +   +LF++Q
Sbjct:   12 VVVNNNPETVSTDYDECDRLYFEELSLERVLDIYQTEGCEGAIISVGGQIPNNLALPLHNNGVKILGTSPLSIDAAEERSRFSEIMDEIEVNQAPWRALYAVDDALDFAAHVGYPCLLRPSFVLSGSAMNVAYGPEDLKRFLSEAARVSQDHPVVITKFVTGAREVEMDAVAKRGHVVCHAISEHVENAGVHSGDATLILPPQNIRSDDIAKIKEVTSKIAKRFNISGPFNMQFLVKDNRVMVIECNLRASRSFPFVSKTIGKDFIECATKIMVNHPQDLKAFPDLNTPLQPQGFVGIKAPMFSWPRLRDADPLLRCEMASTGEVACFGRTVNSAFLMALLSTGFKIPEK--NVMIGIQQDFQHEFLPTANKLHRMGYKLFATDATSKYLKDHNIPAQTVSWPLHPEG----EYPNAGRLISEKKIDMVINLPNQNTKYVKDNYIIRRAAIDNGIPLITNFEVTKLLAQALSERSTLEASTLFHFQ 491          

HSP 2 Score: 126.716 bits (317), Expect = 2.362e-30
Identity = 105/361 (29.09%), Postives = 174/361 (48.20%), Query Frame = 1
Query: 1411 ILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQ--VLIEQSLLGWKEVEYEVVRDAADNCITVCNM--ENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMT 2481
            +++N N  +V T+ +   + D +YF  ++ E V  + + E  +G ++S+GGQ   N+ + LH  G      VK+LGT   SI A E+R  F++ + EI    AP RA+ +++DA++ A  +GYP ++R +F L G    +A   E L      A  ++    V+I + + G +EVE + V   A     VC+   E+ +  GVH+GD+ ++ P Q + + +   ++E   K+ + F I G  N+Q+ +    +   +IE N R SRS    SK  G      A K+ +     D+K      T    +P   ++  K P +   R       +   M S GEV   GRT   +   AL  T
Sbjct:   12 VVVNNNPETVSTDYD---ECDRLYFEELSLERVLDIYQTEGCEGAIISVGGQIPNNLALPLHNNG------VKILGTSPLSIDAAEERSRFSEIMDEIEVNQAPWRALYAVDDALDFAAHVGYPCLLRPSFVLSGSAMNVAYGPEDLKRFLSEAARVSQDHPVVITKFVTGAREVEMDAV---AKRGHVVCHAISEHVENAGVHSGDATLILPPQNIRSDDIAKIKEVTSKIAKRFNISGPFNMQFLVKDNRV--MVIECNLRASRSFPFVSKTIGKDFIECATKIMVN-HPQDLKAFPDLNTP--LQPQ-GFVGIKAPMFSWPRLRDADPLLRCEMASTGEVACFGRTVNSAFLMALLST 354          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Nematostella
Match: EDO29083 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4N0])

HSP 1 Score: 395.201 bits (1014), Expect = 7.309e-115
Identity = 210/337 (62.31%), Postives = 265/337 (78.64%), Query Frame = 1
Query: 1183 GGPTDTEFLFDAYMEMVKSK--SKTTIIPSPKTID----FEP-----PXXXXXXXXXXXXXXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLE 2160
            GGP D E LFD ++E VK     K + +   + I     F+P      K KKVL+LGSGGLSIGQAGEFDYSGSQAIKALKEE I+T+++NPNIA+VQT       +D VYFLP+TA++V +V+  ERPDGILL+ GGQTALN GIEL ++G+L +Y+VKVLGTP+ +I+ TEDR+ FA+ L EI   +APS AV S+++A+ AA ++GYPVMVRAAFALGG+GSG AD+KE+L  +   A A + Q++I++SL GWKE+EYEVVRDA DNCITVCNMEN DPLG+HTG+SIVVAPSQTL+N EY+MLR TA+KVI+H G+VGECNIQYAL+P+S E
Sbjct:    2 GGPRDLECLFDIFLETVKQYKLGKVSDMSVKERIQQQFMFKPVNPVETKPKKVLILGSGGLSIGQAGEFDYSGSQAIKALKEECIQTVVVNPNIATVQTTK---GLSDKVYFLPITADYVTQVIHSERPDGILLAFGGQTALNCGIELRDRGVLDEYNVKVLGTPVDAIVCTEDRKMFAEKLLEIDEHVAPSEAVFSVDEALAAAGRLGYPVMVRAAFALGGMGSGFADDKEELTQLASMALANSKQLIIDKSLKGWKEIEYEVVRDAYDNCITVCNMENVDPLGIHTGESIVVAPSQTLTNSEYNMLRSTAIKVIKHLGVVGECNIQYALNPDSQE 335          

HSP 2 Score: 204.142 bits (518), Expect = 6.199e-53
Identity = 100/216 (46.30%), Postives = 134/216 (62.04%), Query Frame = 1
Query: 2734 LSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDD 3381
            +++  L  AK+ GFSDKQI   +  +E+ VR++R+ MK+TP++K IDT+AAEYP  TNYLY +YN  E D+ F    +MVLG G Y IGSSVEFD CAV  IR L+K G+QT+++N+NPETVSTD+DE DRLYF+E+S E                                    I GT P  ID+AE+R KFS +LD I + Q  W+ L++V+D
Sbjct:  407 VTYNHLLEAKRLGFSDKQIAKCVHSTELAVRKLREEMKLTPFIKQIDTVAAEYPACTNYLYLTYNAQEDDLGFPGNAMMVLGSGVYRIGSSVEFDCCAVGCIRELKKLGKQTIMVNYNPETVSTDYDECDRLYFDEISFE----------------------------------ARIFGTSPEYIDNAENRFKFSRLLDNIGILQPQWKELTTVED 588          

HSP 3 Score: 139.813 bits (351), Expect = 3.489e-33
Identity = 93/278 (33.45%), Postives = 146/278 (52.52%), Query Frame = 1
Query: 2965 VMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKN------SVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAI--AKDGVI-VCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQF 3771
            V++LG G   IG + EFD+    AI+AL++   QTVV+N N  TV T    SD++YF  ++ + V  +   E P G +++ GGQ   N  + L         +V +LGT  + I   EDR  F+  L EID   A   ++ SVD+AL  A R+GYP +VR ++ L G     A    EL      A  ++    ++I K L+G KEIE + +  A D  I VC+   E+++  G+H+G++ +V P  T++      +R  + K+ K   + G  N+Q+
Sbjct:   54 VLILGSGGLSIGQAGEFDYSGSQAIKALKEECIQTVVVNPNIATVQTTKGLSDKVYFLPITADYVTQVIHSERPDGILLAFGGQTALNCGIELRDRGVLDEYNVKVLGTPVDAIVCTEDRKMFAEKLLEIDEHVAPSEAVFSVDEALAAAGRLGYPVMVRAAFALGGMGSGFADDKEELTQLASMA--LANSKQLIIDKSLKGWKEIEYEVVRDAYDNCITVCNM--ENVDPLGIHTGESIVVAPSQTLTNSEYNMLRSTAIKVIKHLGVVGECNIQY 327          

HSP 4 Score: 52.7582 bits (125), Expect = 1.423e-6
Identity = 32/85 (37.65%), Postives = 51/85 (60.00%), Query Frame = 1
Query: 3775 VKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIK-SPMFSWPRLTKADPVLRCEM 4026
            V++ ++ VIECNLR SRS PFVSKT+ TD +A AT+V+  + ++      +D     +  +G+K +   S P  T+   V +CE+
Sbjct:  586 VEDDQLKVIECNLRVSRSFPFVSKTLDTDFVAMATRVICGLTVEPA--LDMDG----RGRVGVKEAEKRSRPDTTRPVTVPKCEV 664          

HSP 5 Score: 50.8322 bits (120), Expect = 5.218e-6
Identity = 34/120 (28.33%), Postives = 54/120 (45.00%), Query Frame = 1
Query: 4150 EFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTSTEDFQNLDIPAATKLISDKFFDLVINLP------NYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVESLDHV 4491
            EF+   LP+  +L + GY++YA+  TA++   H I  N++                          DL INLP         + ++T  Y  RR AID + PL+ + +  K+ VE+L  V
Sbjct:  787 EFKNELLPSVHTLRNLGYSLYASVGTADFYTEHGI-TNMI--------------------------DLFINLPLRSNPGKKVSSFMTRGYQTRRMAIDYSVPLITDVKCAKLFVEALKRV 879          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Nematostella
Match: EDO25883 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TDG2])

HSP 1 Score: 240.736 bits (613), Expect = 1.945e-71
Identity = 125/299 (41.81%), Postives = 181/299 (60.54%), Query Frame = 1
Query: 2347 KIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPL 3243
            KIPR+  ++F      + + MKSVGEVMAIGRT +ESLQKALR       G    +   K      D+ + +  P   RI ++ +AF  G SV++++ ++ IDPWFL +++ ++     ++E+   L  L  + +   K+ GFSD ++  L+G SE + R+ RQ+M I P  K +DT AAE+ T T Y+Y +Y      V  D+Q +MV+G GP  IG  +EFD+C V A  A R+ G +T+++N NPETVSTD+D SDRLYFE ++LE VL+I   E P G I+  GGQ P  LA+ L
Sbjct:    1 KIPRFTFEKFPQANDRLTTQMKSVGEVMAIGRTQQESLQKALRGLEVGATGF-DPIVDLKSEDARSDIVREMKQPGAERIWYLGDAFRLGMSVDELYEISGIDPWFLVQVEDLIKEEQRVAEMA--LSDLDADAIFRLKRKGFSDARLATLLGVSEKQFRKHRQAMNIRPVFKRVDTCAAEFATDTAYMYSTYEEECEAVPTDRQKIMVIGGGPNRIGQGIEFDYCCVHAALAAREAGFETIMVNCNPETVSTDYDTSDRLYFEPITLEDVLEIVNVEKPAGVIVQFGGQTPLKLAVAL 296          

HSP 2 Score: 63.929 bits (154), Expect = 1.097e-10
Identity = 34/86 (39.53%), Postives = 52/86 (60.47%), Query Frame = 1
Query: 1336 IGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIEL 1593
            IGQ  EFDY    A  A +E G ETI++N N  +V T+ +    +D +YF P+T E V +++  E+P G+++  GGQT L + + L
Sbjct:  214 IGQGIEFDYCCVHAALAAREAGFETIMVNCNPETVSTDYD---TSDRLYFEPITLEDVLEIVNVEKPAGVIVQFGGQTPLKLAVAL 296          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Medaka
Match: cps1 (carbamoyl-phosphate synthase 1 [Source:NCBI gene;Acc:101164854])

HSP 1 Score: 1949.87 bits (5050), Expect = 0.000e+0
Identity = 941/1464 (64.28%), Postives = 1156/1464 (78.96%), Query Frame = 1
Query:  148 SKRINMPTK-ARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAKIEFDTDPIEFKDPNKSNLTADVSTNYIQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIET-RNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSKSKTTIIPSPKTIDFEPPXXXXXXXXXXXX--XXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTSTEDFQNLDIPAATKLISDKFFDLVINLPNYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVESLDHVDLVTTDSLFNYQ 4527
            +KR ++  + ARL L +G    G+SFG+  S AGELVFNTGL GYPE+LTDPSYRGQILTLTYPIVGNYGVP+T   D  GL  +VESERI VSGL+VQDYS   SHWNSVKSL QWL +EKVPALFGIDTRMLTKI+RD G VL KIEFD  P++  DPN+ NL A+VST   +VFG+GNP K+V VDCG+KHN+I++L+ RGAEV LVPW+ D    KYDGLFISNGPGDP+L    + N++ V+++ R EP+FGIC GNQ+  LAAGA +YKLP+GNRG NQPV+NV+T QAFIT+QNHGYG++++SL   W  LFINAND TNEGIM+  KP+FTAQFHPEA GGPTDTEFLFDA++ M+K      I+         PP+ +   VL  G   LSIGQAGEFDYSGSQAIKA+KEE ++T+LMNPNIASVQTN  G KQAD VYFLPVT EFV +V++ ERPDGILLSMGGQTALN G+EL + GIL KY VKVLGTP++SIIATEDRQ FAD L +I  K+APS AV S+ DA++AA QIGYPVM+R+A+ALGGLGSG+  NKE+L +   +A AM++Q+L+E+SLLGWKEVEYEVVRD ADNC+TVCNMENFDPLG+HTGDSIVVAPSQTLSN EYHMLRETA+KV+RH GIVGECNIQYALHP SLEYCIIE+NARLSRSSALASKATGYPLAF+AAKLALGI L +I+NA ++ T+ACFEPSLDYI TKIPRWDLDRF    +EIGS+MKSVGEVMA+GRTFEES+QKALRM HPS++G   +L   K +++  DL + L  PS++RI  +  A  +G SV +IH LT ID WFLHK++RI  L   +     N  ++  E L  AKQ GFSDKQIG ++G +E   RE+R +  I PWVK IDT+AAEYP +TNYLYC+YNG EHD+ F  +G+MVLGCGPYHIGSSVEFDWCAVSAIRALR+ G++TVV+NHNPETVSTDFDE DRLYFEEL+LER+LDI Q E+  G+I+SVGGQIPNNLA+PL  + V ILGT P +ID AE+RS FS ILDE++V QA WR+LSS++DA  FA++VGYPCL+RPSY+LSGSAMNVAY   E+  FL+ A Q+SQ++PVVITKF+ GA+E+E DA+AKDG ++ HA++EH+E+AGVHSGDATL+LP  TIS+    +++  + KIA+ FEISGPFN QFLVK+ +++VIECNLRASRS PFVSKTIG D I  ATKVM+  PLDE    ++D P  P +Y+GIK+PMFSWPRL  ADPVLRCEM+STGEVACFG N+Y+AFLKA+ S+ F+LP+K   ILIG+Q  F+P FL TA  L + G+ +YATEAT+ +L  + +PA  V+WPT        ++P    LI++   DLV+NLPN  T+++ +N+LIRR AID   PL+ N+++VK+  E++ +   +   SLF+Y+
Sbjct:   36 TKRFSLKAQTARLVLEDGTSMKGFSFGHTASVAGELVFNTGLVGYPEALTDPSYRGQILTLTYPIVGNYGVPNTEELDELGLRKHVESERIQVSGLLVQDYSHEYSHWNSVKSLGQWLQEEKVPALFGIDTRMLTKIIRDKGTVLGKIEFDGQPVDITDPNQKNLVAEVSTKETKVFGKGNPVKVVAVDCGVKHNIIRLLVKRGAEVHLVPWNQDLLSLKYDGLFISNGPGDPSLAETLINNVRKVLDSDRPEPVFGICMGNQITALAAGAKSYKLPMGNRGQNQPVLNVMTGQAFITAQNHGYGIDSKSLPPGWSSLFINANDGTNEGIMHNSKPVFTAQFHPEAKGGPTDTEFLFDAFISMIKKGKDANIVSVMPKKPCLPPRAQVSKVLVLGSGGLSIGQAGEFDYSGSQAIKAMKEENLKTVLMNPNIASVQTNEVGSKQADSVYFLPVTPEFVTEVIKAERPDGILLSMGGQTALNCGVELFQSGILEKYEVKVLGTPVESIIATEDRQLFADKLMQINEKIAPSFAVESVSDALKAAEQIGYPVMLRSAYALGGLGSGLCANKEKLEETAHKALAMSSQILVERSLLGWKEVEYEVVRDVADNCVTVCNMENFDPLGIHTGDSIVVAPSQTLSNEEYHMLRETAIKVVRHLGIVGECNIQYALHPSSLEYCIIEVNARLSRSSALASKATGYPLAFVAAKLALGIPLPEIQNAVSEKTTACFEPSLDYIVTKIPRWDLDRFQGMSREIGSAMKSVGEVMAVGRTFEESIQKALRMCHPSVDGFVPQLPLKKAWADTHDLQQELAVPSSTRIFSLAKALHQGMSVGEIHQLTAIDKWFLHKLQRITHLEHHLKTYKSN--TIPRELLLKAKQDGFSDKQIGRILGGNETGTRELRLARGIRPWVKQIDTLAAEYPAMTNYLYCTYNGQEHDLDFQDKGIMVLGCGPYHIGSSVEFDWCAVSAIRALRQLGKKTVVVNHNPETVSTDFDECDRLYFEELTLERILDITQQEDCSGSIVSVGGQIPNNLAIPLHMSGVKILGTSPLQIDRAEERSVFSRILDELEVSQAPWRALSSLEDAFAFANQVGYPCLLRPSYVLSGSAMNVAYGEEEMKRFLEEATQVSQEHPVVITKFVRGAREVEVDAVAKDGKVLVHAITEHVEDAGVHSGDATLMLPTQTISQGALEKVKIATRKIAQAFEISGPFNTQFLVKDNDVMVIECNLRASRSFPFVSKTIGVDFINVATKVMVGEPLDESILPSLDKPFIPVDYVGIKAPMFSWPRLRDADPVLRCEMASTGEVACFGPNIYSAFLKAMLSTGFKLPQK--GILIGIQQSFRPNFLATAHQLKEEGFKLYATEATSAWLCANDVPAIPVAWPTEK---GVTELPTIKGLINEGQIDLVVNLPNNNTRHLKDNFLIRRMAIDHGVPLITNYQVVKLFAEAIRYAGELDATSLFHYR 1492          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Medaka
Match: cps1 (carbamoyl-phosphate synthase 1 [Source:NCBI gene;Acc:101164854])

HSP 1 Score: 1949.87 bits (5050), Expect = 0.000e+0
Identity = 941/1464 (64.28%), Postives = 1156/1464 (78.96%), Query Frame = 1
Query:  148 SKRINMPTK-ARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAKIEFDTDPIEFKDPNKSNLTADVSTNYIQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIET-RNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSKSKTTIIPSPKTIDFEPPXXXXXXXXXXXX--XXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTSTEDFQNLDIPAATKLISDKFFDLVINLPNYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVESLDHVDLVTTDSLFNYQ 4527
            +KR ++  + ARL L +G    G+SFG+  S AGELVFNTGL GYPE+LTDPSYRGQILTLTYPIVGNYGVP+T   D  GL  +VESERI VSGL+VQDYS   SHWNSVKSL QWL +EKVPALFGIDTRMLTKI+RD G VL KIEFD  P++  DPN+ NL A+VST   +VFG+GNP K+V VDCG+KHN+I++L+ RGAEV LVPW+ D    KYDGLFISNGPGDP+L    + N++ V+++ R EP+FGIC GNQ+  LAAGA +YKLP+GNRG NQPV+NV+T QAFIT+QNHGYG++++SL   W  LFINAND TNEGIM+  KP+FTAQFHPEA GGPTDTEFLFDA++ M+K      I+         PP+ +   VL  G   LSIGQAGEFDYSGSQAIKA+KEE ++T+LMNPNIASVQTN  G KQAD VYFLPVT EFV +V++ ERPDGILLSMGGQTALN G+EL + GIL KY VKVLGTP++SIIATEDRQ FAD L +I  K+APS AV S+ DA++AA QIGYPVM+R+A+ALGGLGSG+  NKE+L +   +A AM++Q+L+E+SLLGWKEVEYEVVRD ADNC+TVCNMENFDPLG+HTGDSIVVAPSQTLSN EYHMLRETA+KV+RH GIVGECNIQYALHP SLEYCIIE+NARLSRSSALASKATGYPLAF+AAKLALGI L +I+NA ++ T+ACFEPSLDYI TKIPRWDLDRF    +EIGS+MKSVGEVMA+GRTFEES+QKALRM HPS++G   +L   K +++  DL + L  PS++RI  +  A  +G SV +IH LT ID WFLHK++RI  L   +     N  ++  E L  AKQ GFSDKQIG ++G +E   RE+R +  I PWVK IDT+AAEYP +TNYLYC+YNG EHD+ F  +G+MVLGCGPYHIGSSVEFDWCAVSAIRALR+ G++TVV+NHNPETVSTDFDE DRLYFEEL+LER+LDI Q E+  G+I+SVGGQIPNNLA+PL  + V ILGT P +ID AE+RS FS ILDE++V QA WR+LSS++DA  FA++VGYPCL+RPSY+LSGSAMNVAY   E+  FL+ A Q+SQ++PVVITKF+ GA+E+E DA+AKDG ++ HA++EH+E+AGVHSGDATL+LP  TIS+    +++  + KIA+ FEISGPFN QFLVK+ +++VIECNLRASRS PFVSKTIG D I  ATKVM+  PLDE    ++D P  P +Y+GIK+PMFSWPRL  ADPVLRCEM+STGEVACFG N+Y+AFLKA+ S+ F+LP+K   ILIG+Q  F+P FL TA  L + G+ +YATEAT+ +L  + +PA  V+WPT        ++P    LI++   DLV+NLPN  T+++ +N+LIRR AID   PL+ N+++VK+  E++ +   +   SLF+Y+
Sbjct:   36 TKRFSLKAQTARLVLEDGTSMKGFSFGHTASVAGELVFNTGLVGYPEALTDPSYRGQILTLTYPIVGNYGVPNTEELDELGLRKHVESERIQVSGLLVQDYSHEYSHWNSVKSLGQWLQEEKVPALFGIDTRMLTKIIRDKGTVLGKIEFDGQPVDITDPNQKNLVAEVSTKETKVFGKGNPVKVVAVDCGVKHNIIRLLVKRGAEVHLVPWNQDLLSLKYDGLFISNGPGDPSLAETLINNVRKVLDSDRPEPVFGICMGNQITALAAGAKSYKLPMGNRGQNQPVLNVMTGQAFITAQNHGYGIDSKSLPPGWSSLFINANDGTNEGIMHNSKPVFTAQFHPEAKGGPTDTEFLFDAFISMIKKGKDANIVSVMPKKPCLPPRAQVSKVLVLGSGGLSIGQAGEFDYSGSQAIKAMKEENLKTVLMNPNIASVQTNEVGSKQADSVYFLPVTPEFVTEVIKAERPDGILLSMGGQTALNCGVELFQSGILEKYEVKVLGTPVESIIATEDRQLFADKLMQINEKIAPSFAVESVSDALKAAEQIGYPVMLRSAYALGGLGSGLCANKEKLEETAHKALAMSSQILVERSLLGWKEVEYEVVRDVADNCVTVCNMENFDPLGIHTGDSIVVAPSQTLSNEEYHMLRETAIKVVRHLGIVGECNIQYALHPSSLEYCIIEVNARLSRSSALASKATGYPLAFVAAKLALGIPLPEIQNAVSEKTTACFEPSLDYIVTKIPRWDLDRFQGMSREIGSAMKSVGEVMAVGRTFEESIQKALRMCHPSVDGFVPQLPLKKAWADTHDLQQELAVPSSTRIFSLAKALHQGMSVGEIHQLTAIDKWFLHKLQRITHLEHHLKTYKSN--TIPRELLLKAKQDGFSDKQIGRILGGNETGTRELRLARGIRPWVKQIDTLAAEYPAMTNYLYCTYNGQEHDLDFQDKGIMVLGCGPYHIGSSVEFDWCAVSAIRALRQLGKKTVVVNHNPETVSTDFDECDRLYFEELTLERILDITQQEDCSGSIVSVGGQIPNNLAIPLHMSGVKILGTSPLQIDRAEERSVFSRILDELEVSQAPWRALSSLEDAFAFANQVGYPCLLRPSYVLSGSAMNVAYGEEEMKRFLEEATQVSQEHPVVITKFVRGAREVEVDAVAKDGKVLVHAITEHVEDAGVHSGDATLMLPTQTISQGALEKVKIATRKIAQAFEISGPFNTQFLVKDNDVMVIECNLRASRSFPFVSKTIGVDFINVATKVMVGEPLDESILPSLDKPFIPVDYVGIKAPMFSWPRLRDADPVLRCEMASTGEVACFGPNIYSAFLKAMLSTGFKLPQK--GILIGIQQSFRPNFLATAHQLKEEGFKLYATEATSAWLCANDVPAIPVAWPTEK---GVTELPTIKGLINEGQIDLVVNLPNNNTRHLKDNFLIRRMAIDHGVPLITNYQVVKLFAEAIRYAGELDATSLFHYR 1492          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Medaka
Match: cps1 (carbamoyl-phosphate synthase 1 [Source:NCBI gene;Acc:101164854])

HSP 1 Score: 1948.71 bits (5047), Expect = 0.000e+0
Identity = 941/1464 (64.28%), Postives = 1156/1464 (78.96%), Query Frame = 1
Query:  148 SKRINMPTK-ARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAKIEFDTDPIEFKDPNKSNLTADVSTNYIQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIET-RNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSKSKTTIIPSPKTIDFEPPXXXXXXXXXXXX--XXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTSTEDFQNLDIPAATKLISDKFFDLVINLPNYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVESLDHVDLVTTDSLFNYQ 4527
            +KR ++  + ARL L +G    G+SFG+  S AGELVFNTGL GYPE+LTDPSYRGQILTLTYPIVGNYGVP+T   D  GL  +VESERI VSGL+VQDYS   SHWNSVKSL QWL +EKVPALFGIDTRMLTKI+RD G VL KIEFD  P++  DPN+ NL A+VST   +VFG+GNP K+V VDCG+KHN+I++L+ RGAEV LVPW+ D    KYDGLFISNGPGDP+L    + N++ V+++ R EP+FGIC GNQ+  LAAGA +YKLP+GNRG NQPV+NV+T QAFIT+QNHGYG++++SL   W  LFINAND TNEGIM+  KP+FTAQFHPEA GGPTDTEFLFDA++ M+K      I+         PP+ +   VL  G   LSIGQAGEFDYSGSQAIKA+KEE ++T+LMNPNIASVQTN  G KQAD VYFLPVT EFV +V++ ERPDGILLSMGGQTALN G+EL + GIL KY VKVLGTP++SIIATEDRQ FAD L +I  K+APS AV S+ DA++AA QIGYPVM+R+A+ALGGLGSG+  NKE+L +   +A AM++Q+L+E+SLLGWKEVEYEVVRD ADNC+TVCNMENFDPLG+HTGDSIVVAPSQTLSN EYHMLRETA+KV+RH GIVGECNIQYALHP SLEYCIIE+NARLSRSSALASKATGYPLAF+AAKLALGI L +I+NA ++ T+ACFEPSLDYI TKIPRWDLDRF    +EIGS+MKSVGEVMA+GRTFEES+QKALRM HPS++G   +L   K +++  DL + L  PS++RI  +  A  +G SV +IH LT ID WFLHK++RI  L   +     N  ++  E L  AKQ GFSDKQIG ++G +E   RE+R +  I PWVK IDT+AAEYP +TNYLYC+YNG EHD+ F  +G+MVLGCGPYHIGSSVEFDWCAVSAIRALR+ G++TVV+NHNPETVSTDFDE DRLYFEEL+LER+LDI Q E+  G+I+SVGGQIPNNLA+PL  + V ILGT P +ID AE+RS FS ILDE++V QA WR+LSS++DA  FA++VGYPCL+RPSY+LSGSAMNVAY   E+  FL+ A Q+SQ++PVVITKF+ GA+E+E DA+AKDG ++ HA++EH+E+AGVHSGDATL+LP  TIS+    +++  + KIA+ FEISGPFN QFLVK+ +++VIECNLRASRS PFVSKTIG D I  ATKVM+  PLDE    ++D P  P +Y+GIK+PMFSWPRL  ADPVLRCEM+STGEVACFG N+Y+AFLKA+ S+ F+LP+K   ILIG+Q  F+P FL TA  L + G+ +YATEAT+ +L  + +PA  V+WPT        ++P    LI++   DLV+NLPN  T+++ +N+LIRR AID   PL+ N+++VK+  E++ +   +   SLF+Y+
Sbjct:   36 TKRFSLKAQTARLVLEDGTSMKGFSFGHTASVAGELVFNTGLVGYPEALTDPSYRGQILTLTYPIVGNYGVPNTEELDELGLRKHVESERIQVSGLLVQDYSHEYSHWNSVKSLGQWLQEEKVPALFGIDTRMLTKIIRDKGTVLGKIEFDGQPVDITDPNQKNLVAEVSTKETKVFGKGNPVKVVAVDCGVKHNIIRLLVKRGAEVHLVPWNQDLLSLKYDGLFISNGPGDPSLAETLINNVRKVLDSDRPEPVFGICMGNQITALAAGAKSYKLPMGNRGQNQPVLNVMTGQAFITAQNHGYGIDSKSLPPGWSSLFINANDGTNEGIMHNSKPVFTAQFHPEAKGGPTDTEFLFDAFISMIKKGKDANIVSVMPKKPCLPPRAQVSKVLVLGSGGLSIGQAGEFDYSGSQAIKAMKEENLKTVLMNPNIASVQTNEVGSKQADSVYFLPVTPEFVTEVIKAERPDGILLSMGGQTALNCGVELFQSGILEKYEVKVLGTPVESIIATEDRQLFADKLMQINEKIAPSFAVESVSDALKAAEQIGYPVMLRSAYALGGLGSGLCANKEKLEETAHKALAMSSQILVERSLLGWKEVEYEVVRDVADNCVTVCNMENFDPLGIHTGDSIVVAPSQTLSNEEYHMLRETAIKVVRHLGIVGECNIQYALHPSSLEYCIIEVNARLSRSSALASKATGYPLAFVAAKLALGIPLPEIQNAVSEKTTACFEPSLDYIVTKIPRWDLDRFQGMSREIGSAMKSVGEVMAVGRTFEESIQKALRMCHPSVDGFVPQLPLKKAWADTHDLQQELAVPSSTRIFSLAKALHQGMSVGEIHQLTAIDKWFLHKLQRITHLEHHLKTYKSN--TIPRELLLKAKQDGFSDKQIGRILGGNETGTRELRLARGIRPWVKQIDTLAAEYPAMTNYLYCTYNGQEHDLDFQDKGIMVLGCGPYHIGSSVEFDWCAVSAIRALRQLGKKTVVVNHNPETVSTDFDECDRLYFEELTLERILDITQQEDCSGSIVSVGGQIPNNLAIPLHMSGVKILGTSPLQIDRAEERSVFSRILDELEVSQAPWRALSSLEDAFAFANQVGYPCLLRPSYVLSGSAMNVAYGEEEMKRFLEEATQVSQEHPVVITKFVRGAREVEVDAVAKDGKVLVHAITEHVEDAGVHSGDATLMLPTQTISQGALEKVKIATRKIAQAFEISGPFNTQFLVKDNDVMVIECNLRASRSFPFVSKTIGVDFINVATKVMVGEPLDESILPSLDKPFIPVDYVGIKAPMFSWPRLRDADPVLRCEMASTGEVACFGPNIYSAFLKAMLSTGFKLPQK--GILIGIQQSFRPNFLATAHQLKEEGFKLYATEATSAWLCANDVPAIPVAWPTEK---GVTELPTIKGLINEGQIDLVVNLPNNNTRHLKDNFLIRRMAIDHGVPLITNYQVVKLFAEAIRYAGELDATSLFHYR 1492          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Medaka
Match: cad (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [Source:ZFIN;Acc:ZDB-GENE-021030-4])

HSP 1 Score: 1026.93 bits (2654), Expect = 0.000e+0
Identity = 544/986 (55.17%), Postives = 689/986 (69.88%), Query Frame = 1
Query:  163 MPTKARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAKIEFDTDP---IEFKDPNKSNLTADVSTNYIQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIET-RNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSKS--------------KTTIIPSPKTIDFEPPXXXXXXXXXXXXXXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEEL----TLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRK 3054
            M   A L L +G  FSG  FG + S +GE+VF TG+ GYPE+LTDPSYR Q+LTLTYP+VGNYGVP   A +  GL    ES +I  + L++ + SE  SHW+SVKSL +WL +  VP L G+DTR LTK +R+ G +L K+  D  P   +   +P++ NL  +VS    +VF      +I  VDCGIK+N I+ L  RGA VT+VPWD+    D +DGLFISNGPGDP     T+ NI+ V+   R +P+FGIC G+QL+ L  GA TYK+  GNRGHNQP ++  T + FITSQNHG+ ++ ++L  DW VLF NAND TNEGI++  KPIF+ QFHPE   GPTD   LFD +++ VK                   T   S K  D   P  KKVL+LGSGGLSIGQAGEFDYSGSQAIKALKEE I+T+L+NPNIA+VQT+      AD VYFLP+TAE+V +V++ ERPDG+LL+ GGQTALN G++L + G+L KY+V+VLGTP+ SI  TEDR+ F + ++EI   +APS A +S+E A+ AA ++GYPV+VR+AFALGGLGSG A+ +E+L  +   AFA T+QVL+++SL GWKE+EYEVVRDA DNC+TVCNMEN DPLG+HTG+SIVVAPSQTL+++EY+MLR TA+KVIRH GIVGECNIQYAL+PES +Y IIE+NARLSRSSALASKATGYPLA++AAKL LGI L  +KN+ T  T+A FEPSLDY   K+PRWDL +F     +IGSSMKSVGEVMAIGR FEE+ QKALRM   +  G         D++     D  L TP++ RI  +  A + GY+V++++ LTKID WFLHK+K I D                HE L      AKQ GFSDKQI   +  +E+ VR++R+   I P VK IDT+AAE+P  TNYLY +Y+G E+D++F +  VMV+G G Y IGSSVEFDWCAV  I  LRK
Sbjct:    1 MAKTATLILEDGTAFSGRLFGANVSVSGEVVFQTGMVGYPEALTDPSYRCQLLTLTYPLVGNYGVPKDEAGEF-GLSRWFESRKIQAAALVIGELSENPSHWSSVKSLDEWLKEHGVPGLQGVDTRRLTKKIREKGTMLGKLVVDGTPEDGVPLDNPDQRNLVQEVSMKEPKVFNPDGSLRITAVDCGIKYNQIRCLARRGARVTVVPWDHPLDVDDFDGLFISNGPGDPRFCQATISNIRKVVCVDRPKPVFGICLGHQLLSLVIGARTYKMKYGNRGHNQPCVHTGTGRCFITSQNHGFAVDPDTLPKDWDVLFTNANDHTNEGIVHRTKPIFSVQFHPEHSAGPTDLVSLFDVFLQTVKDHKDGNTQKSVKQRLMDHLTYPGSLKPEDVIRP--KKVLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTVLINPNIATVQTS---KGLADKVYFLPITAEYVTQVIKNERPDGVLLTFGGQTALNCGVDLTKLGVLEKYNVRVLGTPVASIEMTEDRKVFVEKMEEINEHVAPSEAALSVEQAVAAAERLGYPVLVRSAFALGGLGSGFANTREELTSLVTSAFAHTSQVLVDKSLKGWKEIEYEVVRDAYDNCVTVCNMENIDPLGIHTGESIVVAPSQTLNDHEYNMLRNTAIKVIRHLGIVGECNIQYALNPESDQYYIIEVNARLSRSSALASKATGYPLAYVAAKLGLGIPLPQLKNSVTNSTTANFEPSLDYCVVKVPRWDLSKFLRVSTKIGSSMKSVGEVMAIGRCFEEAFQKALRMVDENCVGF--------DHTIKPVSDNELQTPTDKRIFVLAAALKAGYTVDQLYQLTKIDRWFLHKMKNISD----------------HERLLETYNQAKQLGFSDKQIAQAVQSTELAVRKMRRDWSILPVVKQIDTVAAEWPAYTNYLYLTYHGTENDLSFQEPHVMVIGSGVYRIGSSVEFDWCAVGCITKLRK 956          

HSP 2 Score: 176.792 bits (447), Expect = 2.068e-44
Identity = 130/414 (31.40%), Postives = 204/414 (49.28%), Query Frame = 1
Query: 2965 VMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLF------KNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIA---KDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLV--KEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDE-KDYFTIDNPR--EPK-NYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQP 4161
            V++LG G   IG + EFD+    AI+AL++   QTV+IN N  TV T    +D++YF  ++ E V  + + E P G +++ GGQ   N  + L       K +V +LGT    I+  EDR  F   ++EI+   A   +  SV+ A+  A R+GYP LVR ++ L G     A T  EL   + SA   +    V++ K L+G KEIE + +     + V VC+   E+I+  G+H+G++ +V P  T++      +R  + K+ +   I G  N+Q+ +  +  +  +IE N R SRS    SK  G  +   A K+ + IPL + K+  T       EP  +Y  +K P +   +  +    +   M S GEV   G     AF KAL     R+  +N    +G  H  +P
Sbjct:  397 VLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTVLINPNIATVQTSKGLADKVYFLPITAEYVTQVIKNERPDGVLLTFGGQTALNCGVDLTKLGVLEKYNVRVLGTPVASIEMTEDRKVFVEKMEEINEHVAPSEAALSVEQAVAAAERLGYPVLVRSAFALGGLGSGFANTREELTSLVTSA--FAHTSQVLVDKSLKGWKEIEYEVVRDAYDNCVTVCNM--ENIDPLGIHTGESIVVAPSQTLNDHEYNMLRNTAIKVIRHLGIVGECNIQYALNPESDQYYIIEVNARLSRSSALASKATGYPLAYVAAKLGLGIPLPQLKNSVTNSTTANFEPSLDYCVVKVPRWDLSKFLRVSTKIGSSMKSVGEVMAIGRCFEEAFQKAL-----RMVDENC---VGFDHTIKP 798          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Planmine SMEST
Match: SMESG000066808.1 (SMESG000066808.1)

HSP 1 Score: 3024.96 bits (7841), Expect = 0.000e+0
Identity = 1487/1492 (99.66%), Postives = 1490/1492 (99.87%), Query Frame = 1
Query:   70 MSLFRIARDVSLFKMHKNSLSISAFLSKRINMPTKARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAKIEFDTDPIEFKDPNKSNLTADVSTNYIQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIETRNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSKSKTTIIPSPKTIDFEPPXXXXXXXXXXXXXXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTSTEDFQNLDIPAATKLISDKFFDLVINLPNYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVESLDHVDLVTTDSLFNYQAVKTVN 4545
            MSLFRIARDVSLFK+HKNSLSISAFLSKRINMPTKARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWL DEKVPALFGIDTRMLTKIVRDSGNVLAKIEFDTDPIEFKDPNKSNLTADVSTN+IQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIETRNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSKSKTTIIPSPKTIDFEPPKVKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQAD+VYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINARLSRSSALASKATGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTS EDFQNLDIPAATKLISDKFFDLVINLPNYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVESLDHVDLVTTDSLFNYQAVKTVN
Sbjct:    1 MSLFRIARDVSLFKIHKNSLSISAFLSKRINMPTKARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLIDEKVPALFGIDTRMLTKIVRDSGNVLAKIEFDTDPIEFKDPNKSNLTADVSTNHIQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIETRNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSKSKTTIIPSPKTIDFEPPKVKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADYVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINARLSRSSALASKATGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTSAEDFQNLDIPAATKLISDKFFDLVINLPNYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVESLDHVDLVTTDSLFNYQAVKTVN 1492          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Planmine SMEST
Match: SMESG000066808.1 (SMESG000066808.1)

HSP 1 Score: 2961.79 bits (7677), Expect = 0.000e+0
Identity = 1457/1461 (99.73%), Postives = 1459/1461 (99.86%), Query Frame = 1
Query:  163 MPTKARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAKIEFDTDPIEFKDPNKSNLTADVSTNYIQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIETRNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSKSKTTIIPSPKTIDFEPPXXXXXXXXXXXXXXIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTSTEDFQNLDIPAATKLISDKFFDLVINLPNYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVESLDHVDLVTTDSLFNYQAVKTVN 4545
            MPTKARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWL DEKVPALFGIDTRMLTKIVRDSGNVLAKIEFDTDPIEFKDPNKSNLTADVSTN+IQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIETRNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSKSKTTIIPSPKTIDFEPPKVKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQAD+VYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINARLSRSSALASKATGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTS EDFQNLDIPAATKLISDKFFDLVINLPNYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVESLDHVDLVTTDSLFNYQAVKTVN
Sbjct:    1 MPTKARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLIDEKVPALFGIDTRMLTKIVRDSGNVLAKIEFDTDPIEFKDPNKSNLTADVSTNHIQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIETRNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSKSKTTIIPSPKTIDFEPPKVKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADYVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINARLSRSSALASKATGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTSAEDFQNLDIPAATKLISDKFFDLVINLPNYKTKYVTENYLIRRAAIDSATPLMINFELVKMLVESLDHVDLVTTDSLFNYQAVKTVN 1461          
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Planmine SMEST
Match: SMESG000012911.1 (SMESG000012911.1)

HSP 1 Score: 1385.55 bits (3585), Expect = 0.000e+0
Identity = 717/1470 (48.78%), Postives = 979/1470 (66.60%), Query Frame = 1
Query:  172 KARLHLNNGKVFSGYSFGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTNARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPALFGIDTRMLTKIVRDSGNVLAKIEFDTD---------PIEFKDPNKSNLTADVSTNYIQVFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLFISNGPGDPALVSETVKNIKTVIETRNEPLFGICFGNQLVGLAAGATTYKLPLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKTNEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKS-KSKTTIIPSPKTIDFEPPXXXXXXXXXXXXX----------------XIGQAGEFDYSGSQAIKALKEEGIETILMNPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQTALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLAPSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKRAFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGDSIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCIIEINXXXXXXXXXXXXXTGYPLAFIAAKLALGIKLTDIKNATTQITSACFEPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKALRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGYSVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQAGFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYCSYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQTVVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQIPNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLSSVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQDYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVLPPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRASRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKSPMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRKNSNILIGL-QHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLVSWPTSTEDFQNLDIPAATKLISDKFFDLVINLPNYKTK------YVTENYLIRRAAIDSATPLMINFELVKMLVESL 4482
            K  L L++  V+ G  FG  K   GE+VF TG+ GY ESL+DPSY  Q+L LTYPI+G+YGV D    D  GL  + ES +IH +GLIV +YS   S+W +  +LSQWL    V  + GIDTR LTK +R+ G++   I    D         P  F DPN+ NL  +VS N I+ + +     +  +DCG+K+N I+     GA VT++P++     D+YD LFISNGPGDP   +ET++ IK  I T  +P  GIC G+QL+ LA G  T+K+  GNRGHNQP  ++ T + F+TSQNHG+ ++  S+ D+W+ LF N NDK+NEGI++ K P  + QFHPE   GPTD E LF+ ++E V + KS T  +   + +            L    L                SIGQAGEFDYSG+QA+KAL+EEGI+T+L+NPNIA+VQT       AD  Y LP+T ++V +V++ ERPDG+ L+ GGQTALN GIEL E G+   Y V VLGT I++I  TEDRQ F++ L+EI  ++APS A  ++++ I+AA Q+GYPVM+RAAFALGGLGSG A+N  +L+D+   AFA T+QVL+++SL GWKE+EYEVVRD  DNCITVCNMEN DPLG+HTG+S+VVAPSQTLSNYEY+MLR+ ALKV+R+ G+VGECNIQYAL P S +Y IIE+NARLSRSSALASKATGYPLA++AAKL LG+ L  ++N+ T +T+ACFEPS+DY   KIPRWDL++F     +I SSMKSVGE+M++GR FEE+ QKALRM       +  KL G   Y E F  +  L +P++ R+  + NA ++G SV++I+ LTKID WFL+K  +I+     ++E+      LS + L  AK  GFSD QI   +  +EM VR++R  + + P V  IDT++AE+P  TNYLY SY+G++HD+TF+   +MVLG G Y IGSSVEFDWCAV  I+ L++  ++T+++N NPETVSTD+D  D L+FEELSLE VLDI+  E P G I+S+GGQ+PNN+A+ L +  + I GT P  ID+AE+R KFS +LD I + Q  W+ L+  + A+ F + V YPCLVRPSY+LSG+AMNVA++ ++LI +L  A  +++D+PVVI+KF+E AKEI+ DA+A  G ++  A+SEH+ENAG+HSGDATLV PP  +++    +I +I ++IA++ ++SGPFN+Q + K+  +LVIECNLR SRS PFVSK +G +MIA AT+ +M+ P   +  F    P    N + +K PMFS+ RL  AD +L  EM STGEVACFGE+   AFLKA  +   ++PR   NI I +  ++ +   L + + L   GYN+YA+  TA++     I  N V W T  +   +      +  I +   DL+INLP   +        +T  Y  RR AID    L+ N +  K+ V++L
Sbjct:    2 KGALILSDETVYIGNLFGAIKQGKGEVVFQTGMVGYTESLSDPSYHSQLLVLTYPIIGSYGVSDDKMLDQWGLPKSFESAKIHATGLIVNEYSLEYSNWTAQVTLSQWLEKHGVIGISGIDTRHLTKKLRECGSITGVIVPIKDKLLINPLNNPELFIDPNERNLVEEVSINEIRHYNKNGNIHVCIIDCGVKNNQIRCFCKYGARVTVMPYNATVNVDEYDALFISNGPGDPVKCTETIETIKNWI-TSEKPFMGICLGHQLLALAIGCKTHKMKYGNRGHNQPCTHLQTKRCFMTSQNHGFAVSASSIPDEWRELFYNENDKSNEGIIHKKLPFMSVQFHPEHMSGPTDMELLFEVFIEHVTAVKSNTATVSLDQRLTNRLTYQHTQHELTLTALLENKPKKILILGSGGLSIGQAGEFDYSGAQALKALREEGIQTVLVNPNIATVQTTM---GVADKSYLLPITKDYVTEVIKMERPDGVYLTFGGQTALNCGIELEESGVFKDYKVSVLGTSIETIKMTEDRQRFSEILEEIKEEVAPSLAAYTVKECIDAAEQLGYPVMIRAAFALGGLGSGFANNPTELLDLASAAFAHTSQVLVDKSLRGWKEIEYEVVRDVYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSNYEYYMLRKCALKVVRYLGVVGECNIQYALDPNSHKYYIIEVNARLSRSSALASKATGYPLAYVAAKLGLGMSLVSLRNSVTTVTTACFEPSIDYCVVKIPRWDLNKFTKVCNKISSSMKSVGEIMSVGRGFEEAFQKALRM-------VDEKLKGFDPYVEKFT-ESGLSSPTDRRMLVLANALKQGVSVKEIYDLTKIDYWFLYKFAKIIKC---LNELEEPRTYLSKDILLNAKLLGFSDTQIAEAVKSTEMAVRQLRIELGVRPIVHQIDTVSAEWPCYTNYLYLSYSGIDHDITFEGGYIMVLGSGVYRIGSSVEFDWCAVECIKELQRMRKKTIMVNCNPETVSTDYDMCDHLFFEELSLESVLDIFHIEQPDGVIVSMGGQLPNNIAMGLHREKIPIFGTSPICIDNAENRFKFSRMLDSIGICQPKWKELTDSESAINFCNDVQYPCLVRPSYVLSGAAMNVAFSESDLIEYLTQAVAVNKDHPVVISKFIEDAKEIDVDAVAYGGKLLRWAVSEHVENAGIHSGDATLVTPPQDMNEKTLQKIGQIITEIAQELKVSGPFNMQLIAKDDNLLVIECNLRVSRSFPFVSKALGYNMIAAATRAIMSEPFSLECEFLRGEP----NKVAVKVPMFSFARLPGADVLLGVEMYSTGEVACFGEDRNEAFLKAQLAQGIKIPRPGGNIFISIGSYKHKKELLESVRQLFSLGYNLYASLGTADFYIESGISVNAVDWDTGNQASSDSKKKTFSDYIIEDKMDLLINLPKRNSGLRRASCMITNGYKNRRLAIDYGIGLLTNVKCTKLFVQAL 1452          
The following BLAST results are available for this feature:
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CPS10.000e+061.17carbamoyl-phosphate synthase 1 [Source:HGNC Symbol... [more]
CPS10.000e+061.17carbamoyl-phosphate synthase 1 [Source:HGNC Symbol... [more]
CPS10.000e+061.17carbamoyl-phosphate synthase 1 [Source:HGNC Symbol... [more]
CPS10.000e+061.17carbamoyl-phosphate synthase 1 [Source:HGNC Symbol... [more]
CPS10.000e+061.17carbamoyl-phosphate synthase 1 [Source:HGNC Symbol... [more]
back to top
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pyr-10.000e+050.98CAD protein Glutamine-dependent carbamoyl-phosphat... [more]
back to top
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
r0.000e+050.92gene:FBgn0003189 transcript:FBtr0089734[more]
r0.000e+050.92gene:FBgn0003189 transcript:FBtr0340156[more]
r0.000e+050.92gene:FBgn0003189 transcript:FBtr0340155[more]
back to top
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cps10.000e+063.51carbamoyl-phosphate synthase 1, mitochondrial [Sou... [more]
cps10.000e+063.49carbamoyl-phosphate synthase 1, mitochondrial [Sou... [more]
cps10.000e+063.09carbamoyl-phosphate synthase 1, mitochondrial [Sou... [more]
cps10.000e+063.15carbamoyl-phosphate synthase 1, mitochondrial [Sou... [more]
cad0.000e+050.84carbamoyl-phosphate synthetase 2, aspartate transc... [more]
back to top
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000045254.10.000e+059.77carbamoyl-phosphate synthase 1 [Source:NCBI gene;A... [more]
ENSXETT00000045303.10.000e+058.80carbamoyl-phosphate synthase 1 [Source:NCBI gene;A... [more]
CAD0.000e+051.74carbamoyl-phosphate synthetase 2, aspartate transc... [more]
CAD0.000e+051.82carbamoyl-phosphate synthetase 2, aspartate transc... [more]
CAD0.000e+049.42carbamoyl-phosphate synthetase 2, aspartate transc... [more]
back to top
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cps10.000e+061.10carbamoyl-phosphate synthetase 1 [Source:MGI Symbo... [more]
Cad0.000e+050.37carbamoyl-phosphate synthetase 2, aspartate transc... [more]
Cad0.000e+050.37carbamoyl-phosphate synthetase 2, aspartate transc... [more]
Cad0.000e+050.37carbamoyl-phosphate synthetase 2, aspartate transc... [more]
Cad0.000e+046.87carbamoyl-phosphate synthetase 2, aspartate transc... [more]
back to top
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P31327|CPSM_HUMAN0.000e+061.17Carbamoyl-phosphate synthase [ammonia], mitochondr... [more]
sp|Q8C196|CPSM_MOUSE0.000e+061.10Carbamoyl-phosphate synthase [ammonia], mitochondr... [more]
sp|P07756|CPSM_RAT0.000e+061.10Carbamoyl-phosphate synthase [ammonia], mitochondr... [more]
sp|Q91293|CPSM_LITCT0.000e+060.57Carbamoyl-phosphate synthase [ammonia], mitochondr... [more]
sp|Q09794|PYR1_SCHPO0.000e+052.77Protein ura1 OS=Schizosaccharomyces pombe (strain ... [more]
back to top
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267E8J70.000e+070.38Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267G4B60.000e+070.31Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8JML00.000e+069.84Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1S3JDD20.000e+067.99carbamoyl-phosphate synthase [ammonia], mitochondr... [more]
A0A1S3JJ360.000e+067.99carbamoyl-phosphate synthase [ammonia], mitochondr... [more]
back to top
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cps10.000e+064.31carbamoyl-phosphate synthase 1 [Source:NCBI gene;A... [more]
cps10.000e+064.71carbamoyl-phosphate synthase 1 [Source:NCBI gene;A... [more]
cps10.000e+064.71carbamoyl-phosphate synthase 1 [Source:NCBI gene;A... [more]
cps10.000e+063.51carbamoyl-phosphate synthase 1 [Source:NCBI gene;A... [more]
cad0.000e+051.18carbamoyl-phosphate synthetase 2, aspartate transc... [more]
back to top
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
URA20.000e+051.38Bifunctional carbamoylphosphate synthetase/asparta... [more]
CPA22.944e-4252.12Large subunit of carbamoyl phosphate synthetase; c... [more]
CPA13.349e-11546.30Small subunit of carbamoyl phosphate synthetase; c... [more]
HFA19.960e-621.35Mitochondrial acetyl-coenzyme A carboxylase; catal... [more]
back to top
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO377030.000e+052.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO333673.181e-4069.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO437512.362e-3062.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO290837.309e-11562.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO258831.945e-7141.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cps10.000e+064.28carbamoyl-phosphate synthase 1 [Source:NCBI gene;A... [more]
cps10.000e+064.28carbamoyl-phosphate synthase 1 [Source:NCBI gene;A... [more]
cps10.000e+064.28carbamoyl-phosphate synthase 1 [Source:NCBI gene;A... [more]
cad2.068e-4455.17carbamoyl-phosphate synthetase 2, aspartate transc... [more]
back to top
BLAST of carbamoyl-phosphate synthase [ammonia], mitochondrial-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000066808.10.000e+099.66SMESG000066808.1[more]
SMESG000066808.10.000e+099.73SMESG000066808.1[more]
SMESG000012911.10.000e+048.78SMESG000012911.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029235 ID=SMED30029235|Name=carbamoyl-phosphate synthase [ammonia], mitochondrial-like|organism=Schmidtea mediterranea sexual|type=transcript|length=4624bp
GCCTTATAAAGGTATTGATTTAAATAATTTTCAAGTTTTATCATTTGTTA
AGAAAATCCTTCCTGAAAAATGTCGTTATTTCGTATTGCTAGAGATGTTT
CTTTATTTAAAATGCACAAAAATAGTTTAAGCATTTCTGCCTTTCTTTCT
AAAAGAATAAATATGCCAACCAAAGCCAGACTTCACTTGAATAATGGTAA
GGTCTTTTCAGGTTATTCTTTTGGTTATGATAAATCCACTGCCGGAGAAT
TAGTTTTTAATACTGGTCTGACTGGATATCCTGAATCATTAACTGATCCA
AGTTATAGAGGTCAAATATTAACACTAACATATCCTATTGTTGGTAATTA
TGGTGTCCCTGATACGAATGCAAGGGATAGTAATGGTCTTATGTTGAATG
TTGAATCGGAAAGAATTCATGTTTCTGGTCTCATTGTTCAAGATTATTCT
GAAAGAATGAGTCATTGGAATTCAGTTAAATCTTTGTCTCAATGGCTAAC
AGATGAGAAAGTACCAGCATTGTTTGGAATAGATACGAGAATGCTAACAA
AGATTGTCAGAGATAGTGGAAACGTTCTTGCTAAAATAGAGTTTGATACA
GATCCAATTGAATTCAAAGATCCAAATAAATCCAATTTGACTGCGGATGT
TTCAACCAATTATATTCAAGTATTCGGACGAGGCAACCCTTACAAAATTG
TGACGGTTGATTGTGGAATCAAACACAACATGATTAAAATGTTGATTGCA
AGAGGAGCTGAAGTGACTTTAGTACCATGGGATTACGATTTTACGAAAGA
TAAGTATGATGGATTATTTATCAGCAATGGGCCCGGTGATCCGGCTTTAG
TGTCGGAAACTGTGAAAAATATAAAAACGGTTATTGAAACAAGAAATGAG
CCATTGTTTGGAATATGTTTTGGAAATCAGCTGGTTGGATTGGCAGCGGG
TGCAACAACGTACAAACTTCCATTGGGAAATAGGGGTCACAATCAACCGG
TCATCAATGTCATCACTAATCAAGCATTTATAACGTCACAAAATCATGGG
TATGGATTAAATACAGAGAGTTTGAGTGATGATTGGAAAGTGTTATTCAT
AAACGCCAATGACAAAACTAATGAAGGAATTATGAATACAAAAAAACCCA
TTTTTACCGCTCAATTTCACCCAGAAGCTTGTGGTGGACCCACTGATACG
GAATTTCTATTTGATGCATATATGGAAATGGTTAAAAGTAAATCAAAAAC
TACAATTATTCCAAGTCCTAAAACAATAGATTTTGAACCACCTAAAGTCA
AAAAAGTATTAGTATTAGGAAGTGGTGGTTTGTCCATTGGACAAGCTGGA
GAATTCGATTACAGCGGATCACAGGCAATAAAGGCTTTGAAGGAGGAAGG
TATTGAGACGATTCTAATGAATCCAAATATTGCATCTGTTCAAACCAACG
CTGAAGGAGATAAACAAGCGGATTTTGTTTATTTTCTTCCCGTTACAGCT
GAATTCGTAGAAAAAGTCCTCGAAAAGGAAAGACCTGATGGAATACTCTT
ATCAATGGGTGGACAGACAGCTTTAAATGTTGGAATAGAGCTTCATGAAA
AGGGAATTCTTTCAAAGTATAGCGTGAAGGTACTTGGTACACCAATTAAA
AGCATTATAGCGACGGAAGATCGACAATCATTTGCAGATGGATTAAAGGA
AATCGGCGCCAAATTAGCTCCCAGCAGAGCGGTTGTGTCAATAGAAGATG
CAATTGAAGCAGCCAATCAGATTGGTTATCCAGTAATGGTAAGAGCCGCC
TTTGCACTCGGTGGACTGGGATCGGGCATTGCTGACAATAAAGAGCAACT
CATGGACATATGTAAGCGAGCGTTTGCCATGACTAATCAAGTACTTATTG
AGCAGTCGCTATTGGGTTGGAAGGAAGTCGAATATGAAGTCGTGAGGGAT
GCAGCTGATAATTGTATTACAGTTTGTAATATGGAGAATTTTGATCCTTT
GGGTGTTCATACTGGAGACTCGATTGTAGTCGCACCCAGTCAAACTTTGT
CAAATTACGAGTACCATATGCTAAGAGAAACTGCACTGAAGGTTATCAGA
CATTTTGGAATAGTGGGAGAATGCAACATTCAATACGCTCTGCATCCAGA
ATCTCTGGAATATTGTATAATTGAAATTAATGCCCGTTTGTCTCGGAGTT
CAGCGTTAGCCAGCAAAGCCACTGGCTATCCATTAGCTTTCATTGCCGCT
AAATTAGCTTTGGGAATTAAATTAACTGATATTAAAAATGCAACAACTCA
AATTACAAGTGCCTGTTTCGAACCAAGTTTGGACTATATTACCACTAAAA
TTCCAAGGTGGGATTTAGATAGATTTCACCATACTCCAAAAGAAATAGGC
TCTTCGATGAAAAGTGTTGGGGAGGTAATGGCGATTGGAAGAACTTTTGA
AGAATCTCTACAAAAAGCACTACGGATGACACACCCGTCATTAAATGGAC
TGACGAGCAAGTTGTCCGGAGGCAAGGATTATTCTGAAAACTTTGACTTG
GATAAGAATTTAATAACTCCTAGCAATAGTCGGATTCACCACATCACAAA
TGCGTTTGAGAAAGGATATTCAGTGGAAAAAATACACAGTTTAACAAAAA
TTGATCCGTGGTTTTTGCATAAAATAAAAAGAATAGTTGACTTAGCATTA
GACATTAGCGAAGTTAATGGAAACTTAAAATCTTTATCTCATGAAGAATT
GACTTTAGCTAAACAAGCTGGATTTTCAGATAAACAAATTGGTCTTTTAA
TCGGTAAATCAGAAATGGAAGTTAGGGAAATACGACAATCTATGAAAATT
ACACCATGGGTCAAACATATCGATACAATGGCAGCGGAATATCCGACTGT
AACAAACTATTTGTATTGTTCTTATAATGGAATGGAACATGATGTAACAT
TTGACAAGCAAGGCGTCATGGTTCTTGGATGCGGTCCATATCATATCGGT
AGTTCTGTTGAATTCGACTGGTGCGCGGTTTCTGCGATTCGAGCGTTGAG
AAAGTTTGGAGAGCAAACAGTCGTTATTAATCACAATCCAGAAACTGTCA
GTACAGATTTCGACGAAAGCGATAGACTTTATTTCGAAGAGTTGAGTTTG
GAAAGAGTTTTGGACATTTATCAATATGAAAATCCTAAAGGGGCGATTAT
TTCAGTCGGCGGACAAATACCTAATAATTTGGCCTTGCCACTATTTAAAA
ATTCAGTTAACATTCTTGGTACACATCCAAATAAAATTGATGATGCTGAA
GATCGTTCAAAGTTTTCTGCAATTCTAGACGAAATAGACGTCAAGCAAGC
TTCGTGGCGTTCATTGTCAAGCGTCGATGATGCTTTGGAATTCGCATCTA
GAGTCGGTTATCCTTGTTTGGTGAGGCCATCTTATATTTTATCTGGGTCC
GCCATGAATGTTGCGTATACGCCAAACGAATTAATTGGATTTCTAAAATC
AGCCAAACAAATATCTCAAGATTATCCTGTGGTAATAACCAAATTTTTAG
AAGGAGCAAAGGAAATTGAGTGTGACGCTATCGCTAAAGACGGAGTGATA
GTTTGTCATGCTCTTTCAGAACACATTGAAAATGCCGGAGTCCACAGCGG
AGATGCTACTTTGGTTCTTCCACCTCATACTATTTCAAAAGATATATCAA
CCCAAATTAGAGAAATTTCTTCAAAAATTGCTAAAAAATTTGAAATTTCG
GGACCTTTTAATGTTCAGTTTTTAGTAAAGGAAGGAGAGATTTTAGTAAT
TGAATGCAATTTAAGAGCGAGTAGGTCATGTCCTTTTGTATCAAAGACAA
TAGGAACAGATATGATTGCTACTGCCACCAAGGTTATGATGAATATTCCG
CTTGATGAAAAAGATTATTTTACAATTGATAATCCAAGAGAACCGAAAAA
TTATTTAGGAATCAAATCTCCGATGTTCAGCTGGCCAAGACTAACAAAAG
CTGATCCAGTTTTGAGATGTGAAATGTCCTCGACTGGAGAAGTAGCTTGT
TTTGGTGAAAATGTTTACACGGCTTTTTTAAAAGCTTTACAATCAAGTAA
TTTCCGTTTGCCAAGAAAGAATTCAAATATATTGATTGGACTTCAACACG
AATTCCAACCAAGATTTTTACCAACAGCCAAAAGTCTCCATGATCATGGA
TATAATATATATGCTACTGAGGCTACGGCAGAGTACTTGAAAATGCATAA
AATTCCTGCTAATTTGGTTTCATGGCCAACTTCGACTGAAGATTTTCAAA
ATTTAGATATTCCTGCAGCAACAAAATTAATATCGGACAAATTTTTTGAT
CTTGTTATCAATCTTCCAAATTACAAAACGAAATATGTCACTGAAAACTA
TCTGATTCGAAGAGCTGCAATCGATTCCGCAACACCTTTAATGATCAATT
TTGAATTAGTTAAAATGTTGGTGGAATCACTTGATCACGTTGATCTTGTT
ACAACGGATTCACTATTTAATTATCAAGCTGTGAAAACAGTTAATTAACT
GTAGTAGTTTTATAATATGGTTTGGCGTTTAGAGCTGTTTTAATAAATAC
AGACTTTGTTTTCTTTAAAAAAAA
back to top

protein sequence of SMED30029235-orf-1

>SMED30029235-orf-1 ID=SMED30029235-orf-1|Name=SMED30029235-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1493bp
MSLFRIARDVSLFKMHKNSLSISAFLSKRINMPTKARLHLNNGKVFSGYS
FGYDKSTAGELVFNTGLTGYPESLTDPSYRGQILTLTYPIVGNYGVPDTN
ARDSNGLMLNVESERIHVSGLIVQDYSERMSHWNSVKSLSQWLTDEKVPA
LFGIDTRMLTKIVRDSGNVLAKIEFDTDPIEFKDPNKSNLTADVSTNYIQ
VFGRGNPYKIVTVDCGIKHNMIKMLIARGAEVTLVPWDYDFTKDKYDGLF
ISNGPGDPALVSETVKNIKTVIETRNEPLFGICFGNQLVGLAAGATTYKL
PLGNRGHNQPVINVITNQAFITSQNHGYGLNTESLSDDWKVLFINANDKT
NEGIMNTKKPIFTAQFHPEACGGPTDTEFLFDAYMEMVKSKSKTTIIPSP
KTIDFEPPKVKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIETILM
NPNIASVQTNAEGDKQADFVYFLPVTAEFVEKVLEKERPDGILLSMGGQT
ALNVGIELHEKGILSKYSVKVLGTPIKSIIATEDRQSFADGLKEIGAKLA
PSRAVVSIEDAIEAANQIGYPVMVRAAFALGGLGSGIADNKEQLMDICKR
AFAMTNQVLIEQSLLGWKEVEYEVVRDAADNCITVCNMENFDPLGVHTGD
SIVVAPSQTLSNYEYHMLRETALKVIRHFGIVGECNIQYALHPESLEYCI
IEINARLSRSSALASKATGYPLAFIAAKLALGIKLTDIKNATTQITSACF
EPSLDYITTKIPRWDLDRFHHTPKEIGSSMKSVGEVMAIGRTFEESLQKA
LRMTHPSLNGLTSKLSGGKDYSENFDLDKNLITPSNSRIHHITNAFEKGY
SVEKIHSLTKIDPWFLHKIKRIVDLALDISEVNGNLKSLSHEELTLAKQA
GFSDKQIGLLIGKSEMEVREIRQSMKITPWVKHIDTMAAEYPTVTNYLYC
SYNGMEHDVTFDKQGVMVLGCGPYHIGSSVEFDWCAVSAIRALRKFGEQT
VVINHNPETVSTDFDESDRLYFEELSLERVLDIYQYENPKGAIISVGGQI
PNNLALPLFKNSVNILGTHPNKIDDAEDRSKFSAILDEIDVKQASWRSLS
SVDDALEFASRVGYPCLVRPSYILSGSAMNVAYTPNELIGFLKSAKQISQ
DYPVVITKFLEGAKEIECDAIAKDGVIVCHALSEHIENAGVHSGDATLVL
PPHTISKDISTQIREISSKIAKKFEISGPFNVQFLVKEGEILVIECNLRA
SRSCPFVSKTIGTDMIATATKVMMNIPLDEKDYFTIDNPREPKNYLGIKS
PMFSWPRLTKADPVLRCEMSSTGEVACFGENVYTAFLKALQSSNFRLPRK
NSNILIGLQHEFQPRFLPTAKSLHDHGYNIYATEATAEYLKMHKIPANLV
SWPTSTEDFQNLDIPAATKLISDKFFDLVINLPNYKTKYVTENYLIRRAA
IDSATPLMINFELVKMLVESLDHVDLVTTDSLFNYQAVKTVN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000067goblet cell
PLANA:0000421tail
PLANA:0000484secretory system
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR036480CarbP_synth_ssu_N_sf
IPR036897CarbamoylP_synth_lsu_oligo_sf
IPR036914MGS-like_dom_sf
IPR006275CarbamoylP_synth_lsu
IPR006274CarbamoylP_synth_ssu
IPR035686CPSase_GATase1
IPR005483CbamoylP_synth_lsu_CPSase_dom
IPR011607MGS-like_dom
IPR002474CarbamoylP_synth_ssu_N
IPR005480CarbamoylP_synth_lsu_oligo
IPR013816ATP_grasp_subdomain_2
IPR029062Class_I_gatase-like
IPR017926GATASE
IPR005479CbamoylP_synth_lsu-like_ATP-bd
IPR013815ATP_grasp_subdomain_1
IPR016185PreATP-grasp_dom_sf
IPR011761ATP-grasp
Vocabulary: biological process
TermDefinition
GO:0006807nitrogen compound metabolic process
GO:0000050urea cycle
GO:0001889liver development
GO:0006207'de novo' pyrimidine nucleobase biosynthetic process
GO:0006508proteolysis
GO:0006541glutamine metabolic process
GO:0007494midgut development
GO:0008152metabolic process
GO:0009636response to toxic substance
GO:0010043response to zinc ion
GO:0014075response to amine
GO:0019240citrulline biosynthetic process
GO:0019433triglyceride catabolic process
GO:0032094response to food
GO:0032496response to lipopolysaccharide
GO:0033762response to glucagon
GO:0034201response to oleic acid
GO:0042311vasodilation
GO:0042493response to drug
GO:0042594response to starvation
GO:0043200response to amino acid
GO:0044344cellular response to fibroblast growth factor stimulus
GO:0046209nitric oxide metabolic process
GO:0048545response to steroid hormone
GO:0050667homocysteine metabolic process
GO:0051384response to glucocorticoid
GO:0051591response to cAMP
GO:0055081anion homeostasis
GO:0060416response to growth hormone
GO:0070365hepatocyte differentiation
GO:0070409carbamoyl phosphate biosynthetic process
GO:0071320cellular response to cAMP
GO:0071377cellular response to glucagon stimulus
GO:0071400cellular response to oleic acid
GO:0071548response to dexamethasone
GO:1903718cellular response to ammonia
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0003824catalytic activity
GO:0046872metal ion binding
GO:0000166nucleotide binding
GO:0004087carbamoyl-phosphate synthase (ammonia) activity
GO:0004088carbamoyl-phosphate synthase (glutamine-hydrolyzing) activity
GO:0004175endopeptidase activity
GO:0005509calcium ion binding
GO:0005515protein binding
GO:0005543phospholipid binding
GO:0016595glutamate binding
GO:0016874ligase activity
GO:0032403protein complex binding
GO:0072341modified amino acid binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005730nucleolus
GO:0005737cytoplasm
GO:0005739mitochondrion
GO:0005743mitochondrial inner membrane
GO:0005759mitochondrial matrix
GO:0042645mitochondrial nucleoid
GO:0043234protein complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00099CPSGATASEcoord: 210..224
score: 44.06
coord: 320..331
score: 58.88
coord: 278..294
score: 63.04
coord: 295..312
score: 54.83
coord: 246..260
score: 70.87
NoneNo IPR availablePRINTSPR00096GATASEcoord: 278..289
score: 53.22
coord: 363..376
score: 45.56
coord: 249..258
score: 61.43
NoneNo IPR availableGENE3DG3DSA:3.40.50.20coord: 959..1067
e-value: 7.5E-39
score: 133.8
NoneNo IPR availableGENE3DG3DSA:3.30.470.20coord: 1072..1339
e-value: 6.0E-97
score: 326.0
NoneNo IPR availableGENE3DG3DSA:3.40.50.20coord: 406..522
e-value: 1.4E-46
score: 158.8
NoneNo IPR availableGENE3DG3DSA:3.30.470.20coord: 526..805
e-value: 3.8E-118
score: 395.7
NoneNo IPR availablePANTHERPTHR11405:SF38CARBAMOYL-PHOSPHATE SYNTHASE [AMMONIA], MITOCHONDRIALcoord: 24..1489
NoneNo IPR availablePANTHERPTHR11405CARBAMOYLTRANSFERASE FAMILY MEMBERcoord: 24..1489
NoneNo IPR availablePROSITEPS51855MGScoord: 1345..1492
score: 18.782
NoneNo IPR availableCDDcd01423MGS_CPS_I_IIIcoord: 1352..1469
e-value: 3.44673E-30
score: 113.934
NoneNo IPR availableSUPERFAMILYSSF56059Glutathione synthetase ATP-binding domain-likecoord: 534..803
NoneNo IPR availableSUPERFAMILYSSF56059Glutathione synthetase ATP-binding domain-likecoord: 1078..1342
IPR005483Carbamoyl-phosphate synthase large subunit, CPSase domainPRINTSPR00098CPSASEcoord: 451..461
score: 56.76
coord: 422..436
score: 85.2
coord: 700..729
score: 78.86
coord: 608..627
score: 68.66
coord: 643..660
score: 82.93
coord: 574..586
score: 67.73
coord: 782..800
score: 80.49
IPR002474Carbamoyl-phosphate synthase small subunit, N-terminal domainSMARTSM01097CPSase_sm_chain_2coord: 34..174
e-value: 6.4E-75
score: 264.9
IPR002474Carbamoyl-phosphate synthase small subunit, N-terminal domainPFAMPF00988CPSase_sm_chaincoord: 36..173
e-value: 2.7E-48
score: 163.0
IPR011607Methylglyoxal synthase-like domainSMARTSM00851MGS_2acoord: 1365..1459
e-value: 3.3E-6
score: 36.6
IPR011607Methylglyoxal synthase-like domainPFAMPF02142MGScoord: 1367..1457
e-value: 5.8E-13
score: 48.8
IPR005480Carbamoyl-phosphate synthetase, large subunit oligomerisation domainSMARTSM01096CPSase_L_D3_2coord: 827..952
e-value: 1.4E-55
score: 200.7
IPR005480Carbamoyl-phosphate synthetase, large subunit oligomerisation domainPFAMPF02787CPSase_L_D3coord: 830..952
e-value: 8.0E-38
score: 129.5
IPR029062Class I glutamine amidotransferase-likeGENE3DG3DSA:3.40.50.880coord: 185..392
e-value: 3.5E-55
score: 189.0
IPR029062Class I glutamine amidotransferase-likeSUPERFAMILYSSF52317Class I glutamine amidotransferase-likecoord: 184..390
IPR017926Glutamine amidotransferasePFAMPF00117GATasecoord: 213..386
e-value: 4.7E-41
score: 140.7
IPR017926Glutamine amidotransferasePROSITEPS51273GATASE_TYPE_1coord: 209..394
score: 29.004
IPR005479Carbamoyl-phosphate synthetase large subunit-like, ATP-binding domainPFAMPF02786CPSase_L_D2coord: 1078..1280
e-value: 4.7E-32
score: 111.2
coord: 534..736
e-value: 4.8E-82
score: 274.5
IPR005479Carbamoyl-phosphate synthetase large subunit-like, ATP-binding domainPROSITEPS00867CPSASE_2coord: 700..707
IPR005479Carbamoyl-phosphate synthetase large subunit-like, ATP-binding domainPROSITEPS00867CPSASE_2coord: 1243..1250
IPR005479Carbamoyl-phosphate synthetase large subunit-like, ATP-binding domainPROSITEPS00866CPSASE_1coord: 570..584
IPR005479Carbamoyl-phosphate synthetase large subunit-like, ATP-binding domainPROSITEPS00866CPSASE_1coord: 1114..1128
IPR013815ATP-grasp fold, subdomain 1GENE3DG3DSA:3.30.1490.20coord: 1091..1160
e-value: 6.0E-97
score: 326.0
IPR036480Carbamoyl-phosphate synthase small subunit, N-terminal domain superfamilyGENE3DG3DSA:3.50.30.20coord: 34..184
e-value: 1.7E-54
score: 185.2
IPR036480Carbamoyl-phosphate synthase small subunit, N-terminal domain superfamilySUPERFAMILYSSF52021Carbamoyl phosphate synthetase, small subunit N-terminal domaincoord: 35..182
IPR036897Carbamoyl-phosphate synthetase, large subunit oligomerisation domain superfamilyGENE3DG3DSA:1.10.1030.10coord: 808..957
e-value: 1.3E-47
score: 163.1
IPR036897Carbamoyl-phosphate synthetase, large subunit oligomerisation domain superfamilySUPERFAMILYSSF48108Carbamoyl phosphate synthetase, large subunit connection domaincoord: 798..959
IPR036914Methylglyoxal synthase-like domain superfamilyGENE3DG3DSA:3.40.50.1380coord: 1347..1489
e-value: 4.7E-31
score: 109.1
IPR036914Methylglyoxal synthase-like domain superfamilySUPERFAMILYSSF52335Methylglyoxal synthase-likecoord: 1353..1474
IPR006275Carbamoyl-phosphate synthase, large subunitTIGRFAMTIGR01369TIGR01369coord: 409..1470
e-value: 0.0
score: 1455.0
IPR006274Carbamoyl-phosphate synthase, small subunitTIGRFAMTIGR01368TIGR01368coord: 37..389
e-value: 1.4E-129
score: 430.2
IPR011761ATP-grasp foldPROSITEPS50975ATP_GRASPcoord: 1083..1274
score: 40.354
IPR011761ATP-grasp foldPROSITEPS50975ATP_GRASPcoord: 539..731
score: 40.98
IPR035686Carbamoyl-phosphate synthase small subunit, GATase1 domainCDDcd01744GATase1_CPSasecoord: 210..385
e-value: 5.42504E-101
score: 318.286
IPR016185Pre-ATP-grasp domain superfamilySUPERFAMILYSSF52440PreATP-grasp domaincoord: 409..533
IPR016185Pre-ATP-grasp domain superfamilySUPERFAMILYSSF52440PreATP-grasp domaincoord: 961..1079