Homeodomain protein

Overview
NameHomeodomain protein
Smed IDSMED30029233
Length (bp)1174
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Homeodomain protein (SMED30029233) t-SNE clustered cells

Violin plots show distribution of expression levels for Homeodomain protein (SMED30029233) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Homeodomain protein (SMED30029233) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Homeodomain protein (SMED30029233) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029233

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
central nervous systemSMED30029233h1SMcG0004569 SMED30029233smed_20140614PMID:27034770
Currie et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
neoblastSMED30029233h1SMcG0004569 SMED30029233smed_20140614PMID:27034770
Currie et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
central nervous systemSMED30029233h1SMcG0004569 SmedASXL_005553SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
central nervous systemSMED30029233h1SMcG0004569 SmedASXL_005553SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
head regionSMED30029233h1SMcG0004569 SmedASXL_005553SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neoblastSMED30029233h1SMcG0004569 SmedASXL_005553SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
neoblastSMED30029233h1SMcG0004569 SmedASXL_005553SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Smed sexual biotypeSMED30029233h1SMcG0004569 Contig53706uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029233h1SMcG0004569 Contig53706newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30029233h1SMcG0004569 dd_Smed_v6_24257_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Homeodomain protein vs. Ensembl Human
Match: HOXA7 (homeobox A7 [Source:HGNC Symbol;Acc:HGNC:5108])

HSP 1 Score: 123.25 bits (308), Expect = 2.028e-32
Identity = 56/74 (75.68%), Postives = 64/74 (86.49%), Query Frame = 1
Query:  742 QIWPWMTVVGPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKE 963
            +I+PWM   GP+   ++RGRQTY+R+QTLELEKEF FN YLTRRRRIEIAH LCL+ERQIKIWFQNRRMK KKE
Sbjct:  118 RIYPWMRSSGPD---RKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKE 188          
BLAST of Homeodomain protein vs. Ensembl Human
Match: HOXB7 (homeobox B7 [Source:HGNC Symbol;Acc:HGNC:5118])

HSP 1 Score: 120.553 bits (301), Expect = 1.697e-31
Identity = 54/74 (72.97%), Postives = 62/74 (83.78%), Query Frame = 1
Query:  742 QIWPWMTVVGPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKE 963
            +I+PWM   G     ++RGRQTY+R+QTLELEKEF +N YLTRRRRIEIAH LCL+ERQIKIWFQNRRMK KKE
Sbjct:  125 RIYPWMRSSG---TDRKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKE 195          
BLAST of Homeodomain protein vs. Ensembl Human
Match: HOXC6 (homeobox C6 [Source:HGNC Symbol;Acc:HGNC:5128])

HSP 1 Score: 114.39 bits (285), Expect = 6.010e-30
Identity = 56/79 (70.89%), Postives = 63/79 (79.75%), Query Frame = 1
Query:  742 QIWPWMTVVGPNS-----VQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKE 963
            QI+PWM  +  +S       +RRGRQ YSR+QTLELEKEF FN YLTRRRRIEIA+ LCL+ERQIKIWFQNRRMK KKE
Sbjct:   39 QIYPWMQRMNSHSGVGYGADRRRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKE 117          
BLAST of Homeodomain protein vs. Ensembl Human
Match: HOXC6 (homeobox C6 [Source:HGNC Symbol;Acc:HGNC:5128])

HSP 1 Score: 116.316 bits (290), Expect = 8.470e-30
Identity = 56/79 (70.89%), Postives = 63/79 (79.75%), Query Frame = 1
Query:  742 QIWPWMTVVGPNS-----VQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKE 963
            QI+PWM  +  +S       +RRGRQ YSR+QTLELEKEF FN YLTRRRRIEIA+ LCL+ERQIKIWFQNRRMK KKE
Sbjct:  121 QIYPWMQRMNSHSGVGYGADRRRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKE 199          
BLAST of Homeodomain protein vs. Ensembl Human
Match: HOXB6 (homeobox B6 [Source:HGNC Symbol;Acc:HGNC:5117])

HSP 1 Score: 115.931 bits (289), Expect = 9.971e-30
Identity = 55/81 (67.90%), Postives = 63/81 (77.78%), Query Frame = 1
Query:  745 IWPWM--------TVVGPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKE 963
            ++PWM        +  GP+    RRGRQTY+R+QTLELEKEF +N YLTRRRRIEIAH LCL+ERQIKIWFQNRRMK KKE
Sbjct:  127 VYPWMQRMNSCNSSSFGPSG---RRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKE 204          
BLAST of Homeodomain protein vs. Ensembl Celegans
Match: mab-5 (Homeobox protein mab-5 [Source:UniProtKB/Swiss-Prot;Acc:P10038])

HSP 1 Score: 103.605 bits (257), Expect = 7.546e-26
Identity = 47/76 (61.84%), Postives = 59/76 (77.63%), Query Frame = 1
Query:  736 AQQIWPWMTVVGPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKE 963
            +Q ++PWM + G    + +R RQTYSR QTLELEKEF ++ YLTR+RR EI+  L L+ERQ+KIWFQNRRMK KKE
Sbjct:  100 SQPVFPWMKMGGAKGGESKRTRQTYSRSQTLELEKEFHYHKYLTRKRRQEISETLHLTERQVKIWFQNRRMKHKKE 175          
BLAST of Homeodomain protein vs. Ensembl Celegans
Match: lin-39 (Homeobox protein lin-39 [Source:UniProtKB/Swiss-Prot;Acc:P34684])

HSP 1 Score: 100.138 bits (248), Expect = 4.232e-24
Identity = 49/81 (60.49%), Postives = 61/81 (75.31%), Query Frame = 1
Query:  730 GGAQQIWPWMTVV---GPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKE 963
            GGA  ++PWMT V      S  ++R R  Y+R+Q LELEKEF  + YLTR+RRIE+AH+L L+ERQ+KIWFQNRRMK KKE
Sbjct:  145 GGA--VYPWMTRVHSTTGGSRGEKRQRTAYTRNQVLELEKEFHTHKYLTRKRRIEVAHSLMLTERQVKIWFQNRRMKHKKE 223          
BLAST of Homeodomain protein vs. Ensembl Celegans
Match: lin-39 (Homeobox protein lin-39 [Source:UniProtKB/Swiss-Prot;Acc:P34684])

HSP 1 Score: 100.138 bits (248), Expect = 4.232e-24
Identity = 49/81 (60.49%), Postives = 61/81 (75.31%), Query Frame = 1
Query:  730 GGAQQIWPWMTVV---GPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKE 963
            GGA  ++PWMT V      S  ++R R  Y+R+Q LELEKEF  + YLTR+RRIE+AH+L L+ERQ+KIWFQNRRMK KKE
Sbjct:  145 GGA--VYPWMTRVHSTTGGSRGEKRQRTAYTRNQVLELEKEFHTHKYLTRKRRIEVAHSLMLTERQVKIWFQNRRMKHKKE 223          
BLAST of Homeodomain protein vs. Ensembl Celegans
Match: php-3 (Posterior Hox gene Paralog [Source:UniProtKB/TrEMBL;Acc:Q9XW88])

HSP 1 Score: 82.0333 bits (201), Expect = 1.818e-17
Identity = 35/62 (56.45%), Postives = 51/62 (82.26%), Query Frame = 1
Query:  790 RRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKERQQI 975
            R+ R+ Y++ QTLELEKEF +N Y+++++R E+A  L L+ERQ+KIWFQNRRMK KK++Q+ 
Sbjct:  200 RKKRKPYTKAQTLELEKEFLYNTYVSKQKRWELAKYLHLTERQVKIWFQNRRMKDKKQKQRT 261          
BLAST of Homeodomain protein vs. Ensembl Celegans
Match: php-3 (Posterior Hox gene Paralog [Source:UniProtKB/TrEMBL;Acc:Q9XW88])

HSP 1 Score: 82.0333 bits (201), Expect = 1.818e-17
Identity = 35/62 (56.45%), Postives = 51/62 (82.26%), Query Frame = 1
Query:  790 RRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKERQQI 975
            R+ R+ Y++ QTLELEKEF +N Y+++++R E+A  L L+ERQ+KIWFQNRRMK KK++Q+ 
Sbjct:  200 RKKRKPYTKAQTLELEKEFLYNTYVSKQKRWELAKYLHLTERQVKIWFQNRRMKDKKQKQRT 261          
BLAST of Homeodomain protein vs. Ensembl Fly
Match: Ubx (gene:FBgn0003944 transcript:FBtr0083348)

HSP 1 Score: 137.502 bits (345), Expect = 7.655e-37
Identity = 61/81 (75.31%), Postives = 70/81 (86.42%), Query Frame = 1
Query:  745 IWPWMTVVGPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKERQQIRELN 987
             +PWM + G N + +RRGRQTY+R+QTLELEKEF  NHYLTRRRRIE+AH LCL+ERQIKIWFQNRRMKLKKE Q I+ELN
Sbjct:  239 FYPWMAIAGTNGL-RRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAIKELN 318          
BLAST of Homeodomain protein vs. Ensembl Fly
Match: abd-A (gene:FBgn0000014 transcript:FBtr0306337)

HSP 1 Score: 134.42 bits (337), Expect = 6.649e-36
Identity = 63/101 (62.38%), Postives = 74/101 (73.27%), Query Frame = 1
Query:  748 WPWMTVV----------------GPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKERQQIRELNDEITR 1002
            +PWMT+                 GPN   +RRGRQTY+R QTLELEKEF FNHYLTRRRRIEIAH LCL+ERQIKIWFQNRRMKLKKE + ++E+N++  R
Sbjct:  109 YPWMTLTDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARR 209          
BLAST of Homeodomain protein vs. Ensembl Fly
Match: abd-A (gene:FBgn0000014 transcript:FBtr0083387)

HSP 1 Score: 134.42 bits (337), Expect = 6.649e-36
Identity = 63/101 (62.38%), Postives = 74/101 (73.27%), Query Frame = 1
Query:  748 WPWMTVV----------------GPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKERQQIRELNDEITR 1002
            +PWMT+                 GPN   +RRGRQTY+R QTLELEKEF FNHYLTRRRRIEIAH LCL+ERQIKIWFQNRRMKLKKE + ++E+N++  R
Sbjct:  109 YPWMTLTDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARR 209          
BLAST of Homeodomain protein vs. Ensembl Fly
Match: abd-A (gene:FBgn0000014 transcript:FBtr0300485)

HSP 1 Score: 134.42 bits (337), Expect = 6.649e-36
Identity = 63/101 (62.38%), Postives = 74/101 (73.27%), Query Frame = 1
Query:  748 WPWMTVV----------------GPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKERQQIRELNDEITR 1002
            +PWMT+                 GPN   +RRGRQTY+R QTLELEKEF FNHYLTRRRRIEIAH LCL+ERQIKIWFQNRRMKLKKE + ++E+N++  R
Sbjct:  109 YPWMTLTDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARR 209          
BLAST of Homeodomain protein vs. Ensembl Fly
Match: abd-A (gene:FBgn0000014 transcript:FBtr0083388)

HSP 1 Score: 136.346 bits (342), Expect = 5.300e-35
Identity = 63/101 (62.38%), Postives = 74/101 (73.27%), Query Frame = 1
Query:  748 WPWMTVV----------------GPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKERQQIRELNDEITR 1002
            +PWMT+                 GPN   +RRGRQTY+R QTLELEKEF FNHYLTRRRRIEIAH LCL+ERQIKIWFQNRRMKLKKE + ++E+N++  R
Sbjct:  369 YPWMTLTDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARR 469          
BLAST of Homeodomain protein vs. Ensembl Zebrafish
Match: hoxb7a (homeobox B7a [Source:NCBI gene;Acc:58044])

HSP 1 Score: 121.324 bits (303), Expect = 7.564e-32
Identity = 55/74 (74.32%), Postives = 63/74 (85.14%), Query Frame = 1
Query:  742 QIWPWMTVVGPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKE 963
            +I+PWM   G +   ++RGRQTYSR+QTLELEKEF FN YL+RRRRIEIAH LCL+ERQIKIWFQNRRMK KKE
Sbjct:  133 RIYPWMRSTGAD---RKRGRQTYSRYQTLELEKEFHFNRYLSRRRRIEIAHALCLTERQIKIWFQNRRMKWKKE 203          
BLAST of Homeodomain protein vs. Ensembl Zebrafish
Match: hoxc6b (homeobox C6b [Source:NCBI gene;Acc:58045])

HSP 1 Score: 120.553 bits (301), Expect = 1.351e-31
Identity = 60/90 (66.67%), Postives = 68/90 (75.56%), Query Frame = 1
Query:  733 GAQQIWPWMTVVGPNSV----QKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKERQQIRELND 990
            G+ QI+PWM  +  + V     +RRGRQ YSR+QTLELEKEF +N YLTRRRRIEIA+ LCLSERQIKIWFQNRRMK KKE      LND
Sbjct:  113 GSVQIYPWMQRMNSHRVGYGSDRRRGRQIYSRYQTLELEKEFHYNRYLTRRRRIEIANTLCLSERQIKIWFQNRRMKWKKESNLTSILND 202          
BLAST of Homeodomain protein vs. Ensembl Zebrafish
Match: hoxc6b (homeobox C6b [Source:NCBI gene;Acc:58045])

HSP 1 Score: 120.168 bits (300), Expect = 1.989e-31
Identity = 60/91 (65.93%), Postives = 68/91 (74.73%), Query Frame = 1
Query:  733 GAQQIWPWMTVVGPNS-----VQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKERQQIRELND 990
            G+ QI+PWM  +  +S       +RRGRQ YSR+QTLELEKEF +N YLTRRRRIEIA+ LCLSERQIKIWFQNRRMK KKE      LND
Sbjct:  113 GSVQIYPWMQRMNSHSGVGYGSDRRRGRQIYSRYQTLELEKEFHYNRYLTRRRRIEIANTLCLSERQIKIWFQNRRMKWKKESNLTSILND 203          
BLAST of Homeodomain protein vs. Ensembl Zebrafish
Match: hoxc6b (homeobox C6b [Source:NCBI gene;Acc:58045])

HSP 1 Score: 119.398 bits (298), Expect = 2.208e-31
Identity = 60/91 (65.93%), Postives = 68/91 (74.73%), Query Frame = 1
Query:  733 GAQQIWPWMTVVGPNS-----VQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKERQQIRELND 990
            G+ QI+PWM  +  +S       +RRGRQ YSR+QTLELEKEF +N YLTRRRRIEIA+ LCLSERQIKIWFQNRRMK KKE      LND
Sbjct:   98 GSVQIYPWMQRMNSHSGVGYGSDRRRGRQIYSRYQTLELEKEFHYNRYLTRRRRIEIANTLCLSERQIKIWFQNRRMKWKKESNLTSILND 188          
BLAST of Homeodomain protein vs. Ensembl Zebrafish
Match: hoxb6a (homeobox B6a [Source:NCBI gene;Acc:30341])

HSP 1 Score: 117.472 bits (293), Expect = 2.162e-30
Identity = 56/81 (69.14%), Postives = 63/81 (77.78%), Query Frame = 1
Query:  745 IWPWM----TVVGPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKERQQI 975
            ++PWM    +  G      RRGRQTY+R+QTLELEKEF FN YLTRRRRIEIAH LCL+ERQIKIWFQNRRMK KKE + I
Sbjct:  132 VYPWMQRMNSCNGTFGNAGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKLI 212          
BLAST of Homeodomain protein vs. Ensembl Xenopus
Match: cd276 (CD276 molecule [Source:Xenbase;Acc:XB-GENE-921537])

HSP 1 Score: 123.635 bits (309), Expect = 6.805e-33
Identity = 56/77 (72.73%), Postives = 66/77 (85.71%), Query Frame = 1
Query:  742 QIWPWMTVVGPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKERQQ 972
            +I+PWM   GP+   ++RGRQTY+R+QTLELEKEF FN YLTRRRRIEIAH LCL+ERQIKIWFQNRRMK KKE ++
Sbjct:  109 RIYPWMRSSGPD---RKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKE 182          
BLAST of Homeodomain protein vs. Ensembl Xenopus
Match: HOXB7 (homeobox B7 [Source:NCBI gene;Acc:100494663])

HSP 1 Score: 121.709 bits (304), Expect = 4.892e-32
Identity = 55/74 (74.32%), Postives = 62/74 (83.78%), Query Frame = 1
Query:  742 QIWPWMTVVGPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKE 963
            +I+PWM   G     ++RGRQTY+R+QTLELEKEF FN YLTRRRRIEIAH LCL+ERQIKIWFQNRRMK KKE
Sbjct:  124 RIYPWMRSTG---ADRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKE 194          
BLAST of Homeodomain protein vs. Ensembl Xenopus
Match: HOXB6 (homeobox B6 [Source:NCBI gene;Acc:100124320])

HSP 1 Score: 120.168 bits (300), Expect = 2.348e-31
Identity = 58/84 (69.05%), Postives = 66/84 (78.57%), Query Frame = 1
Query:  736 AQQIWPWM--------TVVGPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKE 963
            A  ++PWM        +V GP+    RRGRQTY+R+QTLELEKEF FN YLTRRRRIEIAH+LCL+ERQIKIWFQNRRMK KKE
Sbjct:  123 ATPVYPWMQRMNSCNSSVFGPSG---RRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHSLCLTERQIKIWFQNRRMKWKKE 203          
BLAST of Homeodomain protein vs. Ensembl Xenopus
Match: zdhhc15 (zinc finger DHHC-type containing 15 [Source:Xenbase;Acc:XB-GENE-948859])

HSP 1 Score: 118.627 bits (296), Expect = 1.057e-30
Identity = 57/82 (69.51%), Postives = 65/82 (79.27%), Query Frame = 1
Query:  733 GAQQIWPWMTVVGPNS-----VQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKE 963
            G+ QI+PWM  +  +S       +RRGRQ YSR+QTLELEKEF FN YLTRRRRIEIA+ LCL+ERQIKIWFQNRRMK KKE
Sbjct:  118 GSIQIYPWMQRMNSHSGVGYGADRRRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKE 199          
BLAST of Homeodomain protein vs. Ensembl Xenopus
Match: aldh7a1 (aldehyde dehydrogenase 7 family member A1 [Source:Xenbase;Acc:XB-GENE-492001])

HSP 1 Score: 114.775 bits (286), Expect = 3.884e-29
Identity = 55/78 (70.51%), Postives = 61/78 (78.21%), Query Frame = 1
Query:  745 IWPWM----TVVGP-NSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKE 963
            ++PWM    +  GP      RRGRQTY+R QTLELEKEF FN YLTRRRRIEIA+ LCL+ERQIKIWFQNRRMK KKE
Sbjct:  136 VYPWMQRVNSCTGPVYGAHGRRGRQTYTRFQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKE 213          
BLAST of Homeodomain protein vs. Ensembl Mouse
Match: Hoxa7 (homeobox A7 [Source:MGI Symbol;Acc:MGI:96179])

HSP 1 Score: 124.79 bits (312), Expect = 3.946e-33
Identity = 56/76 (73.68%), Postives = 65/76 (85.53%), Query Frame = 1
Query:  742 QIWPWMTVVGPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKERQ 969
            +I+PWM   GP+   ++RGRQTY+R+QTLELEKEF FN YLTRRRRIEIAH LCL+ERQIKIWFQNRRMK KKE +
Sbjct:  117 RIYPWMRSSGPD---RKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHK 189          
BLAST of Homeodomain protein vs. Ensembl Mouse
Match: Hoxb7 (homeobox B7 [Source:MGI Symbol;Acc:MGI:96188])

HSP 1 Score: 123.635 bits (309), Expect = 7.525e-33
Identity = 55/74 (74.32%), Postives = 64/74 (86.49%), Query Frame = 1
Query:  742 QIWPWMTVVGPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKE 963
            +I+PWM   GP+   ++RGRQTY+R+QTLELEKEF +N YLTRRRRIEIAH LCL+ERQIKIWFQNRRMK KKE
Sbjct:  125 RIYPWMRSSGPD---RKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKE 195          
BLAST of Homeodomain protein vs. Ensembl Mouse
Match: Hoxb6 (homeobox B6 [Source:MGI Symbol;Acc:MGI:96187])

HSP 1 Score: 116.316 bits (290), Expect = 5.129e-30
Identity = 55/81 (67.90%), Postives = 63/81 (77.78%), Query Frame = 1
Query:  745 IWPWM--------TVVGPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKE 963
            ++PWM        +  GP+    RRGRQTY+R+QTLELEKEF +N YLTRRRRIEIAH LCL+ERQIKIWFQNRRMK KKE
Sbjct:  127 VYPWMQRMNSCNSSSFGPSG---RRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKE 204          
BLAST of Homeodomain protein vs. Ensembl Mouse
Match: Hoxb6 (homeobox B6 [Source:MGI Symbol;Acc:MGI:96187])

HSP 1 Score: 116.316 bits (290), Expect = 5.129e-30
Identity = 55/81 (67.90%), Postives = 63/81 (77.78%), Query Frame = 1
Query:  745 IWPWM--------TVVGPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKE 963
            ++PWM        +  GP+    RRGRQTY+R+QTLELEKEF +N YLTRRRRIEIAH LCL+ERQIKIWFQNRRMK KKE
Sbjct:  127 VYPWMQRMNSCNSSSFGPSG---RRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKE 204          
BLAST of Homeodomain protein vs. Ensembl Mouse
Match: Hoxc6 (homeobox C6 [Source:MGI Symbol;Acc:MGI:96197])

HSP 1 Score: 116.316 bits (290), Expect = 5.815e-30
Identity = 56/79 (70.89%), Postives = 63/79 (79.75%), Query Frame = 1
Query:  742 QIWPWMTVVGPNS-----VQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKE 963
            QI+PWM  +  +S       +RRGRQ YSR+QTLELEKEF FN YLTRRRRIEIA+ LCL+ERQIKIWFQNRRMK KKE
Sbjct:  121 QIYPWMQRMNSHSGVGYGADRRRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKE 199          
BLAST of Homeodomain protein vs. UniProt/SwissProt
Match: sp|Q01622|HLOX2_HELRO (Homeobox protein LOX2 (Fragment) OS=Helobdella robusta OX=6412 GN=LOX2 PE=2 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 3.119e-37
Identity = 67/93 (72.04%), Postives = 79/93 (84.95%), Query Frame = 1
Query:  733 GAQQIWPWMTVVGPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKERQQIRELNDEITRKTI 1011
            G+   +PWM++VGPNS Q+RRGRQTY+R+QTLELEKEF+FN YLTRRRRIE++H L L+ERQIKIWFQNRRMK KKE Q IRELN EI +  I
Sbjct:  199 GSAPSYPWMSIVGPNSNQRRRGRQTYTRYQTLELEKEFKFNRYLTRRRRIELSHTLYLTERQIKIWFQNRRMKEKKEVQAIRELN-EIEKTKI 290          
BLAST of Homeodomain protein vs. UniProt/SwissProt
Match: sp|Q8T940|UBX_JUNCO (Homeotic protein ultrabithorax OS=Junonia coenia OX=39708 GN=Ubx PE=2 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 3.363e-36
Identity = 61/83 (73.49%), Postives = 72/83 (86.75%), Query Frame = 1
Query:  745 IWPWMTVVGPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKERQQIRELNDE 993
             +PWM + G N + +RRGRQTY+R+QTLELEKEF  NHYLTRRRRIE+AH LCL+ERQIKIWFQNRRMKLKKE Q I+ELN++
Sbjct:  146 FYPWMAIAGANGL-RRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAIKELNEQ 227          
BLAST of Homeodomain protein vs. UniProt/SwissProt
Match: sp|P15856|ABDA_APIME (Homeobox protein abdominal-A homolog (Fragment) OS=Apis mellifera OX=7460 GN=ABD-A PE=3 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 7.677e-35
Identity = 57/73 (78.08%), Postives = 65/73 (89.04%), Query Frame = 1
Query:  769 GPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKERQQIRELN 987
            GPN   +RRGRQTY+R QTLELEKEF +NHYLTRRRRIEIAH LCL+ERQIKIWFQNRRMKLKKE + ++E+N
Sbjct:    2 GPNGCPRRRGRQTYTRFQTLELEKEFHYNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEIN 74          
BLAST of Homeodomain protein vs. UniProt/SwissProt
Match: sp|Q07961|ABDA_TRICA (Homeobox protein abdominal-A homolog OS=Tribolium castaneum OX=7070 GN=ABD-A PE=2 SV=2)

HSP 1 Score: 134.035 bits (336), Expect = 1.431e-34
Identity = 62/91 (68.13%), Postives = 71/91 (78.02%), Query Frame = 1
Query:  748 WPWMT-----------VVGPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKERQQIRELN 987
            +PWM+           V GPN   +RRGRQTY+R QTLELEKEF FNHYLTRRRRIEIAH LCL+ERQIKIWFQNRRMKLKKE + ++E+N
Sbjct:  192 YPWMSITDWMSPFDRVVCGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEIN 282          
BLAST of Homeodomain protein vs. UniProt/SwissProt
Match: sp|O76762|ABDA_ANOGA (Homeobox protein abdominal-A homolog OS=Anopheles gambiae OX=7165 GN=abd-A PE=2 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 1.775e-34
Identity = 59/80 (73.75%), Postives = 69/80 (86.25%), Query Frame = 1
Query:  766 VGPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKERQQIRELNDEITRK 1005
             GPN   +RRGRQTY+R QTLELEKEF FNHYLTRRRRIEIAH LCL+ERQIKIWFQNRRMKLKKE + ++E+N++  R+
Sbjct:  131 AGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARRE 210          
BLAST of Homeodomain protein vs. TrEMBL
Match: P91714 (Homeodomain protein OS=Girardia tigrina OX=6162 GN=DthoxF PE=2 SV=2)

HSP 1 Score: 407.912 bits (1047), Expect = 1.524e-137
Identity = 236/398 (59.30%), Postives = 271/398 (68.09%), Query Frame = 1
Query:  205 MKNDFLATISNNFTVESFDKCNKSHLPELFTRGISSGVDDSCKMMNQNTFWSSNMPHLMAAAAVGG--------------------------HYPPFPVTSVMAGVDQ-----------------------------------------KNLPQIDIDLHSDPVLSDSHQGCLPLSHTFPXXXXXXXXXXXXXXXXIGLYSNYPNQMQSIDELDDDKFDMDCPLRNDQKYTDXXXXXXXXXXGGAQQIWPWMTVVGPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKERQQIRELNDEITRKTISKKHLSSNYNWESVSVSSGGADDESYGLVNMSAPVN--------IMGQQ*SQ*IIFICNTCC 1173
            MKN+FLA+ISNNF V SFDK  KSHLP+LFTRGISSGVD SCKMMNQNT         + A AVGG                          H P      + +GVD+                                         K+L QID+DLHSD V+ DSHQ C+ L H FP+ NNN +SLSSFN+FAIGLYSNYPNQ+Q+IDE+ DDKF++DC +R++QK+ +NE NS +R++GGAQQIWPWMTVVGPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKERQQIRELNDEITRKTISKKHLSSNYNWESVSVS  G D ES GLVN S+ VN        ++GQ  ++ ++  C+ C 
Sbjct:    1 MKNNFLASISNNFGVNSFDKYGKSHLPKLFTRGISSGVDKSCKMMNQNTVLVKWYALQLMATAVGGHYPAFPGRLLLWPGSNRDSFDKYGKSHLPELFTKGISSGVDESSQNDESDTFWSKWYASVNGSGLGVVIILHFRSVCYGRVEPKHLSQIDLDLHSDQVIPDSHQACMSLPHAFPNNNNNTSSLSSFNTFAIGLYSNYPNQIQNIDEIGDDKFEIDCSMRSEQKFNENETNSGTRNDGGAQQIWPWMTVVGPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKERQQIRELNDEITRKTISKKHLSSNYNWESVSVSK-GPDHESGGLVNFSSLVNKTRQLLSLLIGQLPNKYLLIFCSFCV 397          
BLAST of Homeodomain protein vs. TrEMBL
Match: Q26081 (Homeodomain protein (Fragment) OS=Polycelis nigra OX=39786 GN=Pnox1 a PE=4 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 1.860e-49
Identity = 84/93 (90.32%), Postives = 88/93 (94.62%), Query Frame = 1
Query:  772 PNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKERQQIRELNDEITRKTISKKH-LSSNYNWE 1047
            PNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKERQQI+ELNDE++RK  SKK  +S NYNWE
Sbjct:    1 PNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKERQQIQELNDELSRKVKSKKQNMSVNYNWE 93          
BLAST of Homeodomain protein vs. TrEMBL
Match: A0A068Y797 (Homeodomain protein OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000824700 PE=4 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 2.018e-49
Identity = 80/98 (81.63%), Postives = 92/98 (93.88%), Query Frame = 1
Query:  730 GGAQQIWPWMTVVGPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKERQQIRELNDEITRKTISKKH 1023
            G  +QIWPWMTVVGPNSVQ+RRGRQTYSR QTLELEKEFQ++HYLTRRRRIEIAH+LCL+ERQIKIWFQNRRMKLKKERQQI++LNDE+ R+ +S+ H
Sbjct:  204 GSMEQIWPWMTVVGPNSVQRRRGRQTYSRFQTLELEKEFQYSHYLTRRRRIEIAHSLCLTERQIKIWFQNRRMKLKKERQQIKDLNDEMNRRIMSESH 301          
BLAST of Homeodomain protein vs. TrEMBL
Match: A0A068WDW5 (Homeodomain protein OS=Echinococcus granulosus OX=6210 GN=EgrG_000824700 PE=4 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 2.741e-49
Identity = 80/98 (81.63%), Postives = 92/98 (93.88%), Query Frame = 1
Query:  730 GGAQQIWPWMTVVGPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKERQQIRELNDEITRKTISKKH 1023
            G  +QIWPWMTVVGPNSVQ+RRGRQTYSR QTLELEKEFQ++HYLTRRRRIEIAH+LCL+ERQIKIWFQNRRMKLKKERQQI++LNDE+ R+ +S+ H
Sbjct:  208 GSMEQIWPWMTVVGPNSVQRRRGRQTYSRFQTLELEKEFQYSHYLTRRRRIEIAHSLCLTERQIKIWFQNRRMKLKKERQQIKDLNDEMNRRIMSESH 305          
BLAST of Homeodomain protein vs. TrEMBL
Match: A0A158QEJ7 (Homeobox domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS7526 PE=4 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 1.752e-47
Identity = 78/97 (80.41%), Postives = 92/97 (94.85%), Query Frame = 1
Query:  739 QQIWPWMTVVGPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKERQQIRELNDEITRKTI--SKKH 1023
            +QIWPWMTVVGPNSVQ+RRGRQTYSR QTLELEKEFQ++HYLTRRRR+EIAH+LCL+ERQIKIWFQNRRMKLKKERQQI++LN+E+ R+ +  S+KH
Sbjct:  154 EQIWPWMTVVGPNSVQRRRGRQTYSRFQTLELEKEFQYSHYLTRRRRVEIAHSLCLTERQIKIWFQNRRMKLKKERQQIKDLNEEMNRRLMNESQKH 250          
BLAST of Homeodomain protein vs. Ensembl Cavefish
Match: hoxb7a (homeobox B7 [Source:NCBI gene;Acc:103045369])

HSP 1 Score: 122.094 bits (305), Expect = 3.580e-32
Identity = 56/74 (75.68%), Postives = 63/74 (85.14%), Query Frame = 1
Query:  742 QIWPWMTVVGPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKE 963
            +I+PWM   G +   ++RGRQTYSR+QTLELEKEF FN YLTRRRRIEIAH LCL+ERQIKIWFQNRRMK KKE
Sbjct:  135 RIYPWMRSTGAD---RKRGRQTYSRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKE 205          
BLAST of Homeodomain protein vs. Ensembl Cavefish
Match: hoxb6a (homeobox protein Hox-B6a [Source:NCBI gene;Acc:103045875])

HSP 1 Score: 116.701 bits (291), Expect = 3.374e-30
Identity = 56/81 (69.14%), Postives = 63/81 (77.78%), Query Frame = 1
Query:  745 IWPWM----TVVGPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKERQQI 975
            ++PWM    +  G      RRGRQTY+R+QTLELEKEF FN YLTRRRRIEIAH LCL+ERQIKIWFQNRRMK KKE + I
Sbjct:  130 VYPWMQRMNSCNGTFGNPGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKLI 210          
BLAST of Homeodomain protein vs. Ensembl Cavefish
Match: hoxc6a (homeobox C6 [Source:NCBI gene;Acc:103034651])

HSP 1 Score: 115.931 bits (289), Expect = 6.367e-30
Identity = 57/82 (69.51%), Postives = 64/82 (78.05%), Query Frame = 1
Query:  733 GAQQIWPWMTVVGPNS-----VQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKE 963
            G  QI+PWM  +  +S       +RRGRQ YSR+QTLELEKEF FN YLTRRRRIEIA+ LCL+ERQIKIWFQNRRMK KKE
Sbjct:  118 GNIQIYPWMQRMNSHSGVGYGSDRRRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKE 199          
BLAST of Homeodomain protein vs. Ensembl Cavefish
Match: hoxb6b (homeobox protein Hox-B6b [Source:NCBI gene;Acc:103030519])

HSP 1 Score: 113.62 bits (283), Expect = 3.118e-29
Identity = 54/77 (70.13%), Postives = 60/77 (77.92%), Query Frame = 1
Query:  745 IWPWM----TVVGPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKE 963
            ++PWM    +  G      RRGRQTY+R QTLELEKEF FN YLTRRRRIEI+H LCL+ERQIKIWFQNRRMK KKE
Sbjct:  121 VYPWMQRMNSCNGIPGNTGRRGRQTYTRFQTLELEKEFHFNRYLTRRRRIEISHALCLTERQIKIWFQNRRMKWKKE 197          
BLAST of Homeodomain protein vs. Ensembl Cavefish
Match: hoxb5a (homeobox protein Hox-B5a [Source:NCBI gene;Acc:111192049])

HSP 1 Score: 114.775 bits (286), Expect = 5.399e-29
Identity = 56/85 (65.88%), Postives = 63/85 (74.12%), Query Frame = 1
Query:  730 GGAQQIWPWMT-------VVGPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKE 963
            G A QI+PWM        + GP+    +R R  Y+R+QTLELEKEF FN YLTRRRRIEIAH LCLSERQIKIWFQNRRMK KK+
Sbjct:  177 GQAPQIFPWMRKLHISHDMTGPDG---KRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKD 258          
BLAST of Homeodomain protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005057.1 (pep scaffold:Pmarinus_7.0:GL483321:9136:13526:-1 gene:ENSPMAG00000004598.1 transcript:ENSPMAT00000005057.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 108.612 bits (270), Expect = 1.712e-29
Identity = 53/73 (72.60%), Postives = 61/73 (83.56%), Query Frame = 1
Query:  745 IWPWMTVVGPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKE 963
            ++PWM   GP    +RRGRQTYSR+QTLELEKEF FN YLTR+RRIE++H L LSERQ+KIWFQNRRMK KKE
Sbjct:   16 VFPWMRPQGP---ARRRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHVLGLSERQVKIWFQNRRMKWKKE 85          
BLAST of Homeodomain protein vs. Ensembl Sea Lamprey
Match: hoxb7a (homeobox B7a [Source:NCBI gene;Acc:58044])

HSP 1 Score: 106.686 bits (265), Expect = 4.613e-29
Identity = 50/58 (86.21%), Postives = 55/58 (94.83%), Query Frame = 1
Query:  790 RRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKE 963
            +RGRQTYSR+QTLELEKEF FN YLTRRRR+EIAH+LCL+ERQIKIWFQNRRMK KKE
Sbjct:    5 KRGRQTYSRYQTLELEKEFHFNRYLTRRRRVEIAHSLCLTERQIKIWFQNRRMKWKKE 62          
BLAST of Homeodomain protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011116.1 (pep scaffold:Pmarinus_7.0:GL482944:7995:8174:-1 gene:ENSPMAG00000010089.1 transcript:ENSPMAT00000011116.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.916 bits (263), Expect = 6.698e-29
Identity = 48/59 (81.36%), Postives = 55/59 (93.22%), Query Frame = 1
Query:  790 RRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKER 966
            R+GR++YSRHQ+LELEKEF FN YL RRRR+EIAH+LCLSERQ+KIWFQNRRMK KKER
Sbjct:    2 RKGRRSYSRHQSLELEKEFHFNRYLARRRRVEIAHSLCLSERQVKIWFQNRRMKWKKER 60          
BLAST of Homeodomain protein vs. Ensembl Sea Lamprey
Match: hoxd4a (homeobox D4a [Source:NCBI gene;Acc:30329])

HSP 1 Score: 97.8265 bits (242), Expect = 1.510e-25
Identity = 46/58 (79.31%), Postives = 50/58 (86.21%), Query Frame = 1
Query:  790 RRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKE 963
            +R R  Y+R Q LELEKEF FN YLTRRRRIEIAH+LCLSERQIKIWFQNRRMK KK+
Sbjct:    3 KRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHSLCLSERQIKIWFQNRRMKWKKD 60          
BLAST of Homeodomain protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011242.1 (pep scaffold:Pmarinus_7.0:GL476758:607601:607780:-1 gene:ENSPMAG00000010215.1 transcript:ENSPMAT00000011242.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.1149 bits (209), Expect = 3.512e-21
Identity = 41/59 (69.49%), Postives = 47/59 (79.66%), Query Frame = 1
Query:  790 RRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKER 966
            R+ R  YS+ QTLELEKEF FN YLTR RR E+A  L L+ERQ+KIWFQNRRMKLKK +
Sbjct:    2 RKKRCPYSKQQTLELEKEFLFNMYLTRDRRYEVARGLNLTERQVKIWFQNRRMKLKKMK 60          
BLAST of Homeodomain protein vs. Ensembl Yeast
Match: YOX1 (Homeobox transcriptional repressor; binds to Mcm1p and to early cell cycle boxes (ECBs) in the promoters of cell cycle-regulated genes expressed in M/G1 phase; expression is cell cycle-regulated; phosphorylated by Cdc28p; relocalizes from nucleus to cytoplasm upon DNA replication stress; YOX1 has a paralog, YHP1, that arose from the whole genome duplication [Source:SGD;Acc:S000004489])

HSP 1 Score: 48.1358 bits (113), Expect = 1.154e-6
Identity = 23/77 (29.87%), Postives = 45/77 (58.44%), Query Frame = 1
Query:  736 AQQIWPWMTVVGPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKER 966
            +Q+ +P       N+   RR R+  S  +   L+ EF+     ++ +RIE+A +  ++E+ ++IWFQN+R  +K++R
Sbjct:  159 SQETFPKKEPKIDNAPLARRKRRRTSSQELSILQAEFEKCPAPSKEKRIELAESCHMTEKAVQIWFQNKRQAVKRQR 235          
BLAST of Homeodomain protein vs. Ensembl Nematostella
Match: ANTHOX7 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S272])

HSP 1 Score: 83.9593 bits (206), Expect = 8.405e-19
Identity = 41/83 (49.40%), Postives = 54/83 (65.06%), Query Frame = 1
Query:  739 QQIWPWMTVV-----GPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKERQQ 972
            Q I+PWM        G      +R R +Y+  Q LELEKEF +N YL   RR E+A+ + L+ERQ+K+WFQNRRMKLKK+ +Q
Sbjct:   78 QPIYPWMRTKKSGSRGIGGKHTKRYRTSYTNRQLLELEKEFHYNKYLCGTRRRELANAMKLTERQVKVWFQNRRMKLKKDEKQ 160          
BLAST of Homeodomain protein vs. Ensembl Nematostella
Match: MOXB (MoxB; Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR28])

HSP 1 Score: 77.0258 bits (188), Expect = 1.321e-17
Identity = 37/64 (57.81%), Postives = 48/64 (75.00%), Query Frame = 1
Query:  769 GPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKK 960
              N  +KR+ R  +++HQ  ELE EFQ N+YLTR RR EIA +L L+ERQ+K+WFQNRRMK K+
Sbjct:   10 AKNLGKKRKERTAFTKHQIQELENEFQRNNYLTRLRRYEIAVSLDLTERQVKVWFQNRRMKWKR 73          
BLAST of Homeodomain protein vs. Ensembl Nematostella
Match: EDO45896 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRW6])

HSP 1 Score: 75.8702 bits (185), Expect = 1.371e-17
Identity = 37/57 (64.91%), Postives = 44/57 (77.19%), Query Frame = 1
Query:  793 RGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKE 963
            + R  YS  Q +ELEKEF +N YL R RRIEIA +L L+E+Q+KIWFQNRRMK KKE
Sbjct:    3 KNRTIYSTRQLVELEKEFHYNRYLCRPRRIEIAQSLELTEKQVKIWFQNRRMKWKKE 59          
BLAST of Homeodomain protein vs. Ensembl Nematostella
Match: EDO49445 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGM9])

HSP 1 Score: 76.2554 bits (186), Expect = 1.517e-17
Identity = 33/62 (53.23%), Postives = 47/62 (75.81%), Query Frame = 1
Query:  799 RQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKERQQIREL 984
            R  ++  Q LE+EKEF ++HY++R RRIEI   L LSE+Q++ WFQNRRMKLK+E + + E+
Sbjct:    1 RSAFTTVQQLEIEKEFLYDHYVSRVRRIEIVMALDLSEKQVRTWFQNRRMKLKREAKNVEEV 62          
BLAST of Homeodomain protein vs. Ensembl Nematostella
Match: ANTHOX1A.NV (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGM8])

HSP 1 Score: 77.7962 bits (190), Expect = 2.734e-17
Identity = 38/59 (64.41%), Postives = 44/59 (74.58%), Query Frame = 1
Query:  787 KRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKE 963
            K R R  Y+R Q LELEKEF F  YLT+ RR E+A  L L+ERQ+KIWFQNRRMK KK+
Sbjct:   79 KHRKRMAYTRIQLLELEKEFHFTRYLTKERRTEMARMLDLTERQVKIWFQNRRMKWKKD 137          
BLAST of Homeodomain protein vs. Ensembl Medaka
Match: hoxb6b (homeobox protein Hox-B6b [Source:NCBI gene;Acc:101164012])

HSP 1 Score: 119.398 bits (298), Expect = 5.565e-31
Identity = 56/78 (71.79%), Postives = 61/78 (78.21%), Query Frame = 1
Query:  745 IWPWM-----TVVGPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKE 963
            I+PWM        GP     RRGRQTY+R+QTLELEKEF FN YLTRRRRIEI+H LCL+ERQIKIWFQNRRMK KKE
Sbjct:  154 IYPWMQRMNACSAGPFGTSGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEISHALCLTERQIKIWFQNRRMKWKKE 231          
BLAST of Homeodomain protein vs. Ensembl Medaka
Match: HOXA7 (homeobox A7 [Source:NCBI gene;Acc:110015904])

HSP 1 Score: 115.931 bits (289), Expect = 6.506e-30
Identity = 52/77 (67.53%), Postives = 64/77 (83.12%), Query Frame = 1
Query:  742 QIWPWMTVVGPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKERQQ 972
            +++PWM    PN   ++RGRQTYSR+QTLELEKEF FN YL+RRRR+EIAH L L+ERQIKIWFQNRRMK KK+ ++
Sbjct:  111 RMYPWMQASDPN---RKRGRQTYSRYQTLELEKEFHFNRYLSRRRRVEIAHALTLTERQIKIWFQNRRMKWKKDHKE 184          
BLAST of Homeodomain protein vs. Ensembl Medaka
Match: ENSORLT00000021318.2 (homeobox protein Hox-B6a [Source:NCBI gene;Acc:101155275])

HSP 1 Score: 115.546 bits (288), Expect = 1.504e-29
Identity = 56/77 (72.73%), Postives = 61/77 (79.22%), Query Frame = 1
Query:  745 IWPWMTVV----GPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKE 963
            I+PWM  +    G      RRGRQTY+R+QTLELEKEF FN YLTRRRRIEIAH LCL+ERQIKIWFQNRRMK KKE
Sbjct:  156 IYPWMQRMNACNGTFGSPGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKE 232          
BLAST of Homeodomain protein vs. Ensembl Medaka
Match: hoxc6a (homeobox C6 [Source:NCBI gene;Acc:101173938])

HSP 1 Score: 114.775 bits (286), Expect = 2.188e-29
Identity = 63/119 (52.94%), Postives = 78/119 (65.55%), Query Frame = 1
Query:  745 IWPWMTVVGPNSV------QKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKERQQIRELNDEITRKTISKKHLSSNYNWESVSVSSGGADDE 1083
            I+PWM  +  +S        +RRGRQ YSR+QTLELEKEF FN YLTRRRRIEIA+ LCL+ERQIKIWFQNRRMK KKE       ++  +  T S++  +S  N  S +   G  DD+
Sbjct:  121 IYPWMQRMNSHSAGVGYGTDRRRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKE-------SNLTSTVTGSEQTGASQENERSGATEEGKEDDK 232          
BLAST of Homeodomain protein vs. Ensembl Medaka
Match: hoxa5a (homeobox A5a [Source:NCBI gene;Acc:58055])

HSP 1 Score: 113.62 bits (283), Expect = 1.976e-28
Identity = 59/115 (51.30%), Postives = 72/115 (62.61%), Query Frame = 1
Query:  640 LDDDKFDMDCPLRNDQKYTDXXXXXXXXXXGGAQQIWPWMT-------VVGPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKE 963
            L  D      PL +++      +   + S+    QI+PWM        + GP   + +R R  Y+R+QTLELEKEF FN YLTRRRRIEIAH LCLSERQIKIWFQNRRMK KK+
Sbjct:  173 LSRDCVSKASPLEDEKAAGSAPSTPQNASDSAQPQIYPWMRKLHISHDISGP---EGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKD 284          
BLAST of Homeodomain protein vs. Planmine SMEST
Match: SMESG000043155.1 (SMESG000043155.1)

HSP 1 Score: 712.605 bits (1838), Expect = 0.000e+0
Identity = 366/366 (100.00%), Postives = 366/366 (100.00%), Query Frame = 1
Query:   37 MMSSCLQQFDANAFIIDNDNPMKTRNFMIENSICDSIRPGYSDLLTDSRTNYHDLAMKNDFLATISNNFTVESFDKCNKSHLPELFTRGISSGVDDSCKMMNQNTFWSSNMPHLMAAAAVGGHYPPFPVTSVMAGVDQKNLPQIDIDLHSDPVLSDSHQGCLPLSHTFPXXXXXXXXXXXXXXXXIGLYSNYPNQMQSIDELDDDKFDMDCPLRNDQKYTDXXXXXXXXXXGGAQQIWPWMTVVGPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKERQQIRELNDEITRKTISKKHLSSNYNWESVSVSSGGADDESYGLVNMSAPVNIMGQQ 1134
            MMSSCLQQFDANAFIIDNDNPMKTRNFMIENSICDSIRPGYSDLLTDSRTNYHDLAMKNDFLATISNNFTVESFDKCNKSHLPELFTRGISSGVDDSCKMMNQNTFWSSNMPHLMAAAAVGGHYPPFPVTSVMAGVDQKNLPQIDIDLHSDPVLSDSHQGCLPLSHTFPSANNNNTSLSSFNSFAIGLYSNYPNQMQSIDELDDDKFDMDCPLRNDQKYTDNENNSNSRSEGGAQQIWPWMTVVGPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKERQQIRELNDEITRKTISKKHLSSNYNWESVSVSSGGADDESYGLVNMSAPVNIMGQQ
Sbjct:    1 MMSSCLQQFDANAFIIDNDNPMKTRNFMIENSICDSIRPGYSDLLTDSRTNYHDLAMKNDFLATISNNFTVESFDKCNKSHLPELFTRGISSGVDDSCKMMNQNTFWSSNMPHLMAAAAVGGHYPPFPVTSVMAGVDQKNLPQIDIDLHSDPVLSDSHQGCLPLSHTFPSANNNNTSLSSFNSFAIGLYSNYPNQMQSIDELDDDKFDMDCPLRNDQKYTDNENNSNSRSEGGAQQIWPWMTVVGPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKERQQIRELNDEITRKTISKKHLSSNYNWESVSVSSGGADDESYGLVNMSAPVNIMGQQ 366          
BLAST of Homeodomain protein vs. Planmine SMEST
Match: SMESG000022667.1 (SMESG000022667.1)

HSP 1 Score: 113.235 bits (282), Expect = 1.020e-28
Identity = 54/77 (70.13%), Postives = 60/77 (77.92%), Query Frame = 1
Query:  745 IWPWMT----VVGPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKE 963
            ++ WM        PNS   +R RQTY+RHQTLELEKEF FN YLTRRRRIEIAH+L L+ERQIKIWFQNRRMK KKE
Sbjct:  145 LYSWMNPKSGADNPNSSNNKRTRQTYTRHQTLELEKEFHFNKYLTRRRRIEIAHSLILTERQIKIWFQNRRMKWKKE 221          
BLAST of Homeodomain protein vs. Planmine SMEST
Match: SMESG000044469.1 (SMESG000044469.1)

HSP 1 Score: 105.531 bits (262), Expect = 6.598e-27
Identity = 50/78 (64.10%), Postives = 58/78 (74.36%), Query Frame = 1
Query:  748 WPWMTVVGPN------SVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKE 963
            +PWM            S + +R RQ YSR QTLELEKEF +N YLTRRRRIEIA+++CLSERQIKIWFQNRRMK KK+
Sbjct:   86 FPWMQKSNTRKNKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKYKKD 163          
BLAST of Homeodomain protein vs. Planmine SMEST
Match: SMESG000079807.1 (SMESG000079807.1)

HSP 1 Score: 108.227 bits (269), Expect = 1.985e-26
Identity = 54/83 (65.06%), Postives = 64/83 (77.11%), Query Frame = 1
Query:  745 IWPWMT--VVGPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKERQQIRELN 987
            ++PWM   +   +S   +R RQTY+R+QTLELEKEF FN YLTRRRRIEIAH L L+ERQIKIWFQNRRMK KK+   I +LN
Sbjct:  197 VYPWMNPKMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKD-HNIPKLN 278          
BLAST of Homeodomain protein vs. Planmine SMEST
Match: SMESG000079807.1 (SMESG000079807.1)

HSP 1 Score: 107.842 bits (268), Expect = 2.580e-26
Identity = 54/83 (65.06%), Postives = 64/83 (77.11%), Query Frame = 1
Query:  745 IWPWMT--VVGPNSVQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKKERQQIRELN 987
            ++PWM   +   +S   +R RQTY+R+QTLELEKEF FN YLTRRRRIEIAH L L+ERQIKIWFQNRRMK KK+   I +LN
Sbjct:  200 VYPWMNPKMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKD-HNIPKLN 281          
The following BLAST results are available for this feature:
BLAST of Homeodomain protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HOXA72.028e-3275.68homeobox A7 [Source:HGNC Symbol;Acc:HGNC:5108][more]
HOXB71.697e-3172.97homeobox B7 [Source:HGNC Symbol;Acc:HGNC:5118][more]
HOXC66.010e-3070.89homeobox C6 [Source:HGNC Symbol;Acc:HGNC:5128][more]
HOXC68.470e-3070.89homeobox C6 [Source:HGNC Symbol;Acc:HGNC:5128][more]
HOXB69.971e-3067.90homeobox B6 [Source:HGNC Symbol;Acc:HGNC:5117][more]
back to top
BLAST of Homeodomain protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mab-57.546e-2661.84Homeobox protein mab-5 [Source:UniProtKB/Swiss-Pr... [more]
lin-394.232e-2460.49Homeobox protein lin-39 [Source:UniProtKB/Swiss-P... [more]
lin-394.232e-2460.49Homeobox protein lin-39 [Source:UniProtKB/Swiss-P... [more]
php-31.818e-1756.45Posterior Hox gene Paralog [Source:UniProtKB/TrEM... [more]
php-31.818e-1756.45Posterior Hox gene Paralog [Source:UniProtKB/TrEM... [more]
back to top
BLAST of Homeodomain protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ubx7.655e-3775.31gene:FBgn0003944 transcript:FBtr0083348[more]
abd-A6.649e-3662.38gene:FBgn0000014 transcript:FBtr0306337[more]
abd-A6.649e-3662.38gene:FBgn0000014 transcript:FBtr0083387[more]
abd-A6.649e-3662.38gene:FBgn0000014 transcript:FBtr0300485[more]
abd-A5.300e-3562.38gene:FBgn0000014 transcript:FBtr0083388[more]
back to top
BLAST of Homeodomain protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hoxb7a7.564e-3274.32homeobox B7a [Source:NCBI gene;Acc:58044][more]
hoxc6b1.351e-3166.67homeobox C6b [Source:NCBI gene;Acc:58045][more]
hoxc6b1.989e-3165.93homeobox C6b [Source:NCBI gene;Acc:58045][more]
hoxc6b2.208e-3165.93homeobox C6b [Source:NCBI gene;Acc:58045][more]
hoxb6a2.162e-3069.14homeobox B6a [Source:NCBI gene;Acc:30341][more]
back to top
BLAST of Homeodomain protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cd2766.805e-3372.73CD276 molecule [Source:Xenbase;Acc:XB-GENE-921537][more]
HOXB74.892e-3274.32homeobox B7 [Source:NCBI gene;Acc:100494663][more]
HOXB62.348e-3169.05homeobox B6 [Source:NCBI gene;Acc:100124320][more]
zdhhc151.057e-3069.51zinc finger DHHC-type containing 15 [Source:Xenbas... [more]
aldh7a13.884e-2970.51aldehyde dehydrogenase 7 family member A1 [Source:... [more]
back to top
BLAST of Homeodomain protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hoxa73.946e-3373.68homeobox A7 [Source:MGI Symbol;Acc:MGI:96179][more]
Hoxb77.525e-3374.32homeobox B7 [Source:MGI Symbol;Acc:MGI:96188][more]
Hoxb65.129e-3067.90homeobox B6 [Source:MGI Symbol;Acc:MGI:96187][more]
Hoxb65.129e-3067.90homeobox B6 [Source:MGI Symbol;Acc:MGI:96187][more]
Hoxc65.815e-3070.89homeobox C6 [Source:MGI Symbol;Acc:MGI:96197][more]
back to top
BLAST of Homeodomain protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q01622|HLOX2_HELRO3.119e-3772.04Homeobox protein LOX2 (Fragment) OS=Helobdella rob... [more]
sp|Q8T940|UBX_JUNCO3.363e-3673.49Homeotic protein ultrabithorax OS=Junonia coenia O... [more]
sp|P15856|ABDA_APIME7.677e-3578.08Homeobox protein abdominal-A homolog (Fragment) OS... [more]
sp|Q07961|ABDA_TRICA1.431e-3468.13Homeobox protein abdominal-A homolog OS=Tribolium ... [more]
sp|O76762|ABDA_ANOGA1.775e-3473.75Homeobox protein abdominal-A homolog OS=Anopheles ... [more]
back to top
BLAST of Homeodomain protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
P917141.524e-13759.30Homeodomain protein OS=Girardia tigrina OX=6162 GN... [more]
Q260811.860e-4990.32Homeodomain protein (Fragment) OS=Polycelis nigra ... [more]
A0A068Y7972.018e-4981.63Homeodomain protein OS=Echinococcus multilocularis... [more]
A0A068WDW52.741e-4981.63Homeodomain protein OS=Echinococcus granulosus OX=... [more]
A0A158QEJ71.752e-4780.41Homeobox domain-containing protein OS=Hymenolepis ... [more]
back to top
BLAST of Homeodomain protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hoxb7a3.580e-3275.68homeobox B7 [Source:NCBI gene;Acc:103045369][more]
hoxb6a3.374e-3069.14homeobox protein Hox-B6a [Source:NCBI gene;Acc:103... [more]
hoxc6a6.367e-3069.51homeobox C6 [Source:NCBI gene;Acc:103034651][more]
hoxb6b3.118e-2970.13homeobox protein Hox-B6b [Source:NCBI gene;Acc:103... [more]
hoxb5a5.399e-2965.88homeobox protein Hox-B5a [Source:NCBI gene;Acc:111... [more]
back to top
BLAST of Homeodomain protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005057.11.712e-2972.60pep scaffold:Pmarinus_7.0:GL483321:9136:13526:-1 g... [more]
hoxb7a4.613e-2986.21homeobox B7a [Source:NCBI gene;Acc:58044][more]
ENSPMAT00000011116.16.698e-2981.36pep scaffold:Pmarinus_7.0:GL482944:7995:8174:-1 ge... [more]
hoxd4a1.510e-2579.31homeobox D4a [Source:NCBI gene;Acc:30329][more]
ENSPMAT00000011242.13.512e-2169.49pep scaffold:Pmarinus_7.0:GL476758:607601:607780:-... [more]
back to top
BLAST of Homeodomain protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
YOX11.154e-629.87Homeobox transcriptional repressor; binds to Mcm1p... [more]
back to top
BLAST of Homeodomain protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
ANTHOX78.405e-1949.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
MOXB1.321e-1757.81MoxB; Predicted protein [Source:UniProtKB/TrEMBL;... [more]
EDO458961.371e-1764.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494451.517e-1753.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
ANTHOX1A.NV2.734e-1764.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Homeodomain protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hoxb6b5.565e-3171.79homeobox protein Hox-B6b [Source:NCBI gene;Acc:101... [more]
HOXA76.506e-3067.53homeobox A7 [Source:NCBI gene;Acc:110015904][more]
ENSORLT00000021318.21.504e-2972.73homeobox protein Hox-B6a [Source:NCBI gene;Acc:101... [more]
hoxc6a2.188e-2952.94homeobox C6 [Source:NCBI gene;Acc:101173938][more]
hoxa5a1.976e-2851.30homeobox A5a [Source:NCBI gene;Acc:58055][more]
back to top
BLAST of Homeodomain protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043155.10.000e+0100.00SMESG000043155.1[more]
SMESG000022667.11.020e-2870.13SMESG000022667.1[more]
SMESG000044469.16.598e-2764.10SMESG000044469.1[more]
SMESG000079807.11.985e-2665.06SMESG000079807.1[more]
SMESG000079807.12.580e-2665.06SMESG000079807.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029233 ID=SMED30029233|Name=Homeodomain protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1174bp
TTCCGATCTCGAAAATTTATTTATTTTATGTGAATTATGATGAGTTCCTG
TTTGCAACAATTTGACGCTAACGCATTCATTATTGACAATGATAATCCAA
TGAAAACTAGAAATTTTATGATTGAAAATTCAATTTGCGATTCAATTCGA
CCTGGTTACTCCGATCTGTTGACAGATTCCAGAACAAATTATCATGATTT
AGCGATGAAAAATGATTTTCTAGCGACAATATCGAATAATTTCACTGTGG
AATCCTTTGATAAATGCAACAAATCACATCTTCCGGAATTATTTACGAGA
GGCATTAGTTCCGGGGTCGATGATTCGTGTAAAATGATGAATCAAAACAC
GTTTTGGTCCAGCAATATGCCTCATTTAATGGCAGCAGCAGCAGTCGGTG
GACATTACCCACCATTTCCAGTTACTTCAGTTATGGCGGGAGTTGACCAG
AAAAACTTACCGCAAATTGACATCGATTTACATTCCGATCCAGTTTTATC
TGATTCACATCAAGGCTGTTTGCCTTTGTCCCATACATTCCCAAGTGCTA
ACAATAACAACACGTCACTGTCATCTTTCAATTCCTTTGCAATTGGTTTA
TATTCGAACTATCCCAATCAAATGCAGAGCATAGATGAACTCGATGATGA
TAAGTTTGACATGGATTGTCCGTTAAGAAACGATCAAAAATACACAGATA
ATGAAAACAATTCCAATTCCCGAAGTGAAGGAGGAGCCCAACAAATTTGG
CCTTGGATGACTGTTGTTGGTCCGAATTCTGTTCAAAAGCGCCGAGGAAG
ACAAACATATAGCAGACATCAAACTCTTGAATTGGAAAAAGAATTTCAAT
TCAATCACTACTTGACCCGTCGACGTCGAATTGAAATTGCTCACAATCTT
TGTTTGTCTGAACGACAAATAAAAATCTGGTTTCAGAATCGACGAATGAA
ACTGAAAAAAGAACGACAGCAAATTCGAGAATTGAACGACGAAATTACAA
GGAAAACGATCTCCAAGAAACATTTATCCTCGAATTACAACTGGGAATCC
GTTTCAGTAAGTAGTGGAGGAGCTGATGATGAATCGTACGGATTGGTAAA
CATGTCAGCACCTGTAAATATTATGGGACAACAATAATCTCAGTAGATAA
TATTTATTTGCAATACTTGCTGCT
back to top

protein sequence of SMED30029233-orf-1

>SMED30029233-orf-1 ID=SMED30029233-orf-1|Name=SMED30029233-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=367bp
MMSSCLQQFDANAFIIDNDNPMKTRNFMIENSICDSIRPGYSDLLTDSRT
NYHDLAMKNDFLATISNNFTVESFDKCNKSHLPELFTRGISSGVDDSCKM
MNQNTFWSSNMPHLMAAAAVGGHYPPFPVTSVMAGVDQKNLPQIDIDLHS
DPVLSDSHQGCLPLSHTFPSANNNNTSLSSFNSFAIGLYSNYPNQMQSID
ELDDDKFDMDCPLRNDQKYTDNENNSNSRSEGGAQQIWPWMTVVGPNSVQ
KRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQ
NRRMKLKKERQQIRELNDEITRKTISKKHLSSNYNWESVSVSSGGADDES
YGLVNMSAPVNIMGQQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000103central nervous system
PLANA:0000418head
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR029020Ammonium/urea_transptr
IPR020479Homeobox_metazoa
IPR001356Homeobox_dom
IPR009057Homeobox-like_sf
IPR017970Homeobox_CS
IPR003119SAP_A
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0043565sequence-specific DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 299..326
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 232..312
e-value: 5.3E-31
score: 108.4
NoneNo IPR availablePANTHERPTHR45659FAMILY NOT NAMEDcoord: 170..322
NoneNo IPR availablePANTHERPTHR45659:SF4HOMEOTIC PROTEIN ULTRABITHORAXcoord: 170..322
IPR020479Homeobox domain, metazoaPRINTSPR00024HOMEOBOXcoord: 288..298
score: 63.02
coord: 273..284
score: 49.67
coord: 298..307
score: 80.72
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 251..313
e-value: 2.0E-23
score: 93.8
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 252..308
e-value: 3.1E-20
score: 71.8
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 249..309
score: 21.087
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 252..310
e-value: 6.5297E-24
score: 91.1508
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 284..307
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 236..309