ADP-ribosylation factor

Overview
NameADP-ribosylation factor
Smed IDSMED30029223
Length (bp)750
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ADP-ribosylation factor (SMED30029223) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ADP-ribosylation factor (SMED30029223) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029223

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30029223h1SMcG0019474 dd_Smed_v4_3198_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029223h1SMcG0019474 dd_Smed_v4_3198_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30029223h1SMcG0019474 dd_Smed_v4_3198_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ADP-ribosylation factor vs. Ensembl Human
Match: ARL4C (ADP ribosylation factor like GTPase 4C [Source:HGNC Symbol;Acc:HGNC:698])

HSP 1 Score: 133.65 bits (335), Expect = 2.978e-38
Identity = 76/169 (44.97%), Postives = 104/169 (61.54%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKN----YIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEALRLVYKMLSSTEKEFQK 673
            GLDSAGKT++LYRLK NEFV+++PT+GFN E IKL N     I    WDVGGQ KLR +W+ +    D +IYVVD+ D DR  EAK EL  +    E +  P+L++ANKQD   ++    I   L L ++IP   YHV    A+ G+GL E +  +Y+M+    K  ++
Sbjct:   20 GLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAKGISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGTPLLVIANKQDLPKSLPVAEIEKQLALHELIPATTYHVQPACAIIGEGLTEGMDKLYEMILKRRKSLKQ 188          
BLAST of ADP-ribosylation factor vs. Ensembl Human
Match: ARL4C (ADP ribosylation factor like GTPase 4C [Source:HGNC Symbol;Acc:HGNC:698])

HSP 1 Score: 133.65 bits (335), Expect = 4.089e-38
Identity = 76/169 (44.97%), Postives = 104/169 (61.54%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKN----YIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEALRLVYKMLSSTEKEFQK 673
            GLDSAGKT++LYRLK NEFV+++PT+GFN E IKL N     I    WDVGGQ KLR +W+ +    D +IYVVD+ D DR  EAK EL  +    E +  P+L++ANKQD   ++    I   L L ++IP   YHV    A+ G+GL E +  +Y+M+    K  ++
Sbjct:   20 GLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAKGISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGTPLLVIANKQDLPKSLPVAEIEKQLALHELIPATTYHVQPACAIIGEGLTEGMDKLYEMILKRRKSLKQ 188          
BLAST of ADP-ribosylation factor vs. Ensembl Human
Match: ARF3 (ADP ribosylation factor 3 [Source:HGNC Symbol;Acc:HGNC:654])

HSP 1 Score: 129.413 bits (324), Expect = 9.713e-37
Identity = 74/149 (49.66%), Postives = 105/149 (70.47%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEAL 625
            GLD+AGKT++LY+LK  E V++IPT+GFNVE ++ KN I FTVWDVGGQ K+R +W  +  +   LI+VVD++DR+R +EA+EEL+ +L  +E++   +L+ ANKQD   AM+A  I D L L  +  + +Y    C A SGDGL+E L
Sbjct:   24 GLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN-ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATC-ATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Human
Match: ARF3 (ADP ribosylation factor 3 [Source:HGNC Symbol;Acc:HGNC:654])

HSP 1 Score: 129.413 bits (324), Expect = 9.713e-37
Identity = 74/149 (49.66%), Postives = 105/149 (70.47%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEAL 625
            GLD+AGKT++LY+LK  E V++IPT+GFNVE ++ KN I FTVWDVGGQ K+R +W  +  +   LI+VVD++DR+R +EA+EEL+ +L  +E++   +L+ ANKQD   AM+A  I D L L  +  + +Y    C A SGDGL+E L
Sbjct:   24 GLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN-ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATC-ATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Human
Match: ARF1 (ADP ribosylation factor 1 [Source:HGNC Symbol;Acc:HGNC:652])

HSP 1 Score: 129.028 bits (323), Expect = 1.093e-36
Identity = 74/149 (49.66%), Postives = 105/149 (70.47%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEAL 625
            GLD+AGKT++LY+LK  E V++IPT+GFNVE ++ KN I FTVWDVGGQ K+R +W  +  +   LI+VVD++DR+R +EA+EEL+ +L  +E++   +L+ ANKQD   AM+A  I D L L  +  + +Y    C A SGDGL+E L
Sbjct:   24 GLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN-ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATC-ATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Celegans
Match: arf-6 (ADP-Ribosylation Factor related [Source:UniProtKB/TrEMBL;Acc:Q9U2S4])

HSP 1 Score: 129.798 bits (325), Expect = 2.262e-37
Identity = 78/149 (52.35%), Postives = 104/149 (69.80%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEAL 625
            GLD+AGKT++LY+LK  + V++IPTVGFNVE +  KN IKF VWDVGGQ K+R +W  + T   ALI+V+DA+DRDR  EA+ EL  I+N  E+K+  IL+ ANKQD A AM    I D L L++I  + +Y    C++ +GDGL E L
Sbjct:   20 GLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKN-IKFNVWDVGGQDKIRPLWRHYYTGTQALIFVMDAADRDRVDEARMELHRIINDREMKEAIILVFANKQDLADAMKPHEIQDKLGLTRIRDRNWYVQPSCAS-TGDGLHEGL 166          
BLAST of ADP-ribosylation factor vs. Ensembl Celegans
Match: arf-1.2 (ADP-ribosylation factor 1-like 2 [Source:UniProtKB/Swiss-Prot;Acc:Q10943])

HSP 1 Score: 128.642 bits (322), Expect = 6.841e-37
Identity = 73/149 (48.99%), Postives = 104/149 (69.80%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEAL 625
            GLD+AGKT++LY+LK  E V++IPT+GFNVE ++ KN I FTVWDVGGQ K+R +W  +  +   LI+VVD++DR+R  EA+EEL+ +L  +E++   +L+ ANKQD   AM+A  + D L L  +  + +Y    C A SGDGL+E L
Sbjct:   24 GLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN-ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGEAREELMRMLAEDELRDAVLLVFANKQDLPQAMNAAEVTDKLGLHSLRNRSWYIQATC-ATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Celegans
Match: arf-1.2 (ADP-ribosylation factor 1-like 2 [Source:UniProtKB/Swiss-Prot;Acc:Q10943])

HSP 1 Score: 128.642 bits (322), Expect = 6.841e-37
Identity = 73/149 (48.99%), Postives = 104/149 (69.80%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEAL 625
            GLD+AGKT++LY+LK  E V++IPT+GFNVE ++ KN I FTVWDVGGQ K+R +W  +  +   LI+VVD++DR+R  EA+EEL+ +L  +E++   +L+ ANKQD   AM+A  + D L L  +  + +Y    C A SGDGL+E L
Sbjct:   24 GLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN-ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGEAREELMRMLAEDELRDAVLLVFANKQDLPQAMNAAEVTDKLGLHSLRNRSWYIQATC-ATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Celegans
Match: arf-1.2 (ADP-ribosylation factor 1-like 2 [Source:UniProtKB/Swiss-Prot;Acc:Q10943])

HSP 1 Score: 128.642 bits (322), Expect = 6.841e-37
Identity = 73/149 (48.99%), Postives = 104/149 (69.80%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEAL 625
            GLD+AGKT++LY+LK  E V++IPT+GFNVE ++ KN I FTVWDVGGQ K+R +W  +  +   LI+VVD++DR+R  EA+EEL+ +L  +E++   +L+ ANKQD   AM+A  + D L L  +  + +Y    C A SGDGL+E L
Sbjct:   24 GLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN-ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGEAREELMRMLAEDELRDAVLLVFANKQDLPQAMNAAEVTDKLGLHSLRNRSWYIQATC-ATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Celegans
Match: arf-3 (ADP-Ribosylation Factor related; ADP-ribosylation factor related (20.5 kD) (Arf-3) [Source:UniProtKB/TrEMBL;Acc:G5EFK4])

HSP 1 Score: 125.176 bits (313), Expect = 1.452e-35
Identity = 73/159 (45.91%), Postives = 106/159 (66.67%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEALRLVYKMLSST 655
            GLD+AGKT++LY+LK  E V++IPT+GFNVE ++ KN I FTVWDVGGQ K+R +W  +  +   LI+VVD++D++R  E++EEL  +LN +E++   +L+ ANKQD   AM+A  + D L L  +  + +Y    C A  G GL+E L  +   LS T
Sbjct:   24 GLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN-ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDKERIEESREELHKMLNEDELRDATLLVFANKQDLPNAMTAAELTDKLGLHNLRSRQWYIQATC-ATQGHGLYEGLDWLSNQLSKT 180          
BLAST of ADP-ribosylation factor vs. Ensembl Fly
Match: Arf79F (gene:FBgn0010348 transcript:FBtr0332054)

HSP 1 Score: 129.798 bits (325), Expect = 3.080e-37
Identity = 75/149 (50.34%), Postives = 104/149 (69.80%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEAL 625
            GLD+AGKT++LY+LK  E V++IPT+GFNVE ++ KN I FTVWDVGGQ K+R +W  +  +   LI+VVD++DR+R  EA+EEL+ +L  +E++   +LI ANKQD   AM+A  I D L L  +  + +Y    C A SGDGL+E L
Sbjct:   24 GLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN-ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHSLRNRNWYIQATC-ATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Fly
Match: Arf79F (gene:FBgn0010348 transcript:FBtr0078573)

HSP 1 Score: 129.798 bits (325), Expect = 3.080e-37
Identity = 75/149 (50.34%), Postives = 104/149 (69.80%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEAL 625
            GLD+AGKT++LY+LK  E V++IPT+GFNVE ++ KN I FTVWDVGGQ K+R +W  +  +   LI+VVD++DR+R  EA+EEL+ +L  +E++   +LI ANKQD   AM+A  I D L L  +  + +Y    C A SGDGL+E L
Sbjct:   24 GLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN-ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHSLRNRNWYIQATC-ATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Fly
Match: Arf79F (gene:FBgn0010348 transcript:FBtr0299906)

HSP 1 Score: 129.798 bits (325), Expect = 3.080e-37
Identity = 75/149 (50.34%), Postives = 104/149 (69.80%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEAL 625
            GLD+AGKT++LY+LK  E V++IPT+GFNVE ++ KN I FTVWDVGGQ K+R +W  +  +   LI+VVD++DR+R  EA+EEL+ +L  +E++   +LI ANKQD   AM+A  I D L L  +  + +Y    C A SGDGL+E L
Sbjct:   24 GLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN-ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHSLRNRNWYIQATC-ATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Fly
Match: Arf79F (gene:FBgn0010348 transcript:FBtr0299907)

HSP 1 Score: 129.798 bits (325), Expect = 3.080e-37
Identity = 75/149 (50.34%), Postives = 104/149 (69.80%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEAL 625
            GLD+AGKT++LY+LK  E V++IPT+GFNVE ++ KN I FTVWDVGGQ K+R +W  +  +   LI+VVD++DR+R  EA+EEL+ +L  +E++   +LI ANKQD   AM+A  I D L L  +  + +Y    C A SGDGL+E L
Sbjct:   24 GLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN-ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHSLRNRNWYIQATC-ATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Fly
Match: Arf79F (gene:FBgn0010348 transcript:FBtr0078571)

HSP 1 Score: 129.798 bits (325), Expect = 3.080e-37
Identity = 75/149 (50.34%), Postives = 104/149 (69.80%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEAL 625
            GLD+AGKT++LY+LK  E V++IPT+GFNVE ++ KN I FTVWDVGGQ K+R +W  +  +   LI+VVD++DR+R  EA+EEL+ +L  +E++   +LI ANKQD   AM+A  I D L L  +  + +Y    C A SGDGL+E L
Sbjct:   24 GLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN-ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHSLRNRNWYIQATC-ATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Zebrafish
Match: arl4cb (ADP-ribosylation factor-like 4Cb [Source:ZFIN;Acc:ZDB-GENE-040426-2382])

HSP 1 Score: 132.88 bits (333), Expect = 3.811e-38
Identity = 75/169 (44.38%), Postives = 104/169 (61.54%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKN----YIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEALRLVYKMLSSTEKEFQK 673
            GLDSAGKT++LYRLK NEFV+++PT+GFN E IKL N     I    WDVGGQ KLR +W+ +    D +IYVVD+ D DR  EAK EL  +    E +  P+L++ANKQD   ++S   I   L L ++ P   YH+    A+ G+GL E +  +Y+M+    K  ++
Sbjct:   20 GLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAKGISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGTPLLVIANKQDLPKSLSVADIEKQLALQELTPATTYHIQPACAIIGEGLHEGMDKLYEMIVKRRKSLKQ 188          
BLAST of ADP-ribosylation factor vs. Ensembl Zebrafish
Match: arl4cb (ADP-ribosylation factor-like 4Cb [Source:ZFIN;Acc:ZDB-GENE-040426-2382])

HSP 1 Score: 132.88 bits (333), Expect = 3.811e-38
Identity = 75/169 (44.38%), Postives = 104/169 (61.54%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKN----YIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEALRLVYKMLSSTEKEFQK 673
            GLDSAGKT++LYRLK NEFV+++PT+GFN E IKL N     I    WDVGGQ KLR +W+ +    D +IYVVD+ D DR  EAK EL  +    E +  P+L++ANKQD   ++S   I   L L ++ P   YH+    A+ G+GL E +  +Y+M+    K  ++
Sbjct:   20 GLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAKGISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGTPLLVIANKQDLPKSLSVADIEKQLALQELTPATTYHIQPACAIIGEGLHEGMDKLYEMIVKRRKSLKQ 188          
BLAST of ADP-ribosylation factor vs. Ensembl Zebrafish
Match: arl4ca (ADP-ribosylation factor-like 4Ca [Source:ZFIN;Acc:ZDB-GENE-050417-265])

HSP 1 Score: 132.109 bits (331), Expect = 6.525e-38
Identity = 75/169 (44.38%), Postives = 105/169 (62.13%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKN----YIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEALRLVYKMLSSTEKEFQK 673
            GLDSAGKT++LYRLK NEFV+++PT+GFN E IKL N     I    WDVGGQ KLR +W+ +    D +IYVVD+ D DR  EAK EL  +    E +  P+L++ANKQD   +++   I  +L L ++ P   YHV    A+ G+GL E +  +Y+M+    K  ++
Sbjct:   20 GLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAKGISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGTPLLVIANKQDLPKSLTVSEIEKHLALHELSPSTTYHVQPACAIIGEGLHEGMDKLYEMIVKRRKSLKQ 188          
BLAST of ADP-ribosylation factor vs. Ensembl Zebrafish
Match: arf1 (ADP-ribosylation factor 1 [Source:ZFIN;Acc:ZDB-GENE-010724-5])

HSP 1 Score: 129.413 bits (324), Expect = 4.896e-37
Identity = 74/149 (49.66%), Postives = 106/149 (71.14%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEAL 625
            GLD+AGKT++LY+LK  E V++IPT+GFNVE ++ KN I FTVWDVGGQ K+R +W  +  +   LI+VVD++DR+R +EA+EEL+ +L  +E+++  +L+ ANKQD   AM+A  I D L L  +  + +Y    C A SGDGL+E L
Sbjct:   23 GLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN-ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELREAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATC-ATSGDGLYEGL 169          
BLAST of ADP-ribosylation factor vs. Ensembl Zebrafish
Match: arf2a (ADP-ribosylation factor 2a [Source:ZFIN;Acc:ZDB-GENE-040122-4])

HSP 1 Score: 129.413 bits (324), Expect = 5.431e-37
Identity = 74/149 (49.66%), Postives = 104/149 (69.80%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEAL 625
            GLD+AGKT++LY+LK  E V++IPT+GFNVE ++ KN I FTVWDVGGQ K+R +W  +  +   LI+VVD++DR+R +EA+EEL  +L  +E++   +L+ ANKQD   AM+A  I D L L  +  + +Y    C A SGDGL+E L
Sbjct:   24 GLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN-ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATC-ATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Xenopus
Match: dcaf7 (DDB1 and CUL4 associated factor 7 [Source:Xenbase;Acc:XB-GENE-973762])

HSP 1 Score: 137.117 bits (344), Expect = 1.039e-39
Identity = 74/164 (45.12%), Postives = 114/164 (69.51%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEALRLVYKMLSSTEKEFQ 670
            GLD+AGKT++LY+LK NE +++IPT+GFNVE ++    + FTVWDVGGQ ++R++W+ + T+ D L++VVD++D +RF EA+ EL  IL+ EE++ +P +++ANKQD  GA     + + L L +I   P +HV  C A +GDGL E L +   ++    K+FQ
Sbjct:   26 GLDAAGKTTVLYKLKFNETITTIPTIGFNVETVEPMRNVSFTVWDVGGQGRIRALWKHYFTNTDGLVFVVDSADCERFQEARLELEAILDAEEMRGVPFVVMANKQDLPGARRPMEVAEELGLPKIQGHP-WHVQGCCAATGDGLVEGLEVFTNLV----KQFQ 184          
BLAST of ADP-ribosylation factor vs. Ensembl Xenopus
Match: arl4c (ADP ribosylation factor like GTPase 4C [Source:NCBI gene;Acc:549461])

HSP 1 Score: 130.568 bits (327), Expect = 3.994e-37
Identity = 74/169 (43.79%), Postives = 103/169 (60.95%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKN----YIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEALRLVYKMLSSTEKEFQK 673
            GLDSAGKT++LYRLK NEFV+++PT+GFN E I+L N     I    WDVGGQ KLR +W+ +    D +IYVVD+ D DR  EAK EL  +    E    P+L++ANKQD   +++   I   L L ++ P   YHV    A+ G+GL E +  +Y+M+    K  ++
Sbjct:   20 GLDSAGKTTVLYRLKFNEFVNTVPTIGFNTERIRLSNGAAKGISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDSDRLEEAKTELHKVTKFAENLGTPLLVIANKQDLPKSLAVPEIERQLALQELSPSTPYHVQPACAIIGEGLTEGMDKLYEMILKRRKTLKQ 188          
BLAST of ADP-ribosylation factor vs. Ensembl Xenopus
Match: arf3 (ADP ribosylation factor 3 [Source:NCBI gene;Acc:100145191])

HSP 1 Score: 129.413 bits (324), Expect = 8.804e-37
Identity = 74/149 (49.66%), Postives = 105/149 (70.47%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEAL 625
            GLD+AGKT++LY+LK  E V++IPT+GFNVE ++ KN I FTVWDVGGQ K+R +W  +  +   LI+VVD++DR+R +EA+EEL+ +L  +E++   +L+ ANKQD   AM+A  I D L L  +  + +Y    C A SGDGL+E L
Sbjct:   24 GLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN-ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATC-ATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Xenopus
Match: fibp (fibroblast growth factor (acidic) intracellular binding protein [Source:Xenbase;Acc:XB-GENE-481175])

HSP 1 Score: 129.028 bits (323), Expect = 1.002e-36
Identity = 74/149 (49.66%), Postives = 104/149 (69.80%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEAL 625
            GLD+AGKT++LY+LK  E V++IPT+GFNVE ++ KN I FTVWDVGGQ K+R +W  +  +   LI+VVD++DR+R +EA+EEL  +L  +E++   +L+ ANKQD   AM+A  I D L L  +  + +Y    C A SGDGL+E L
Sbjct:   24 GLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN-ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATC-ATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Xenopus
Match: arf5 (ADP ribosylation factor 5 [Source:NCBI gene;Acc:394614])

HSP 1 Score: 129.028 bits (323), Expect = 1.283e-36
Identity = 74/149 (49.66%), Postives = 105/149 (70.47%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEAL 625
            GLD+AGKT++LY+LK  E V++IPT+GFNVE ++ KN I FTVWDVGGQ K+R +W  +  +   LI+VVD++DR+R +EA+EEL+ +L  +E++   +L+ ANKQD   AM+A  I D L L  +  + +Y    C A SGDGL+E L
Sbjct:   24 GLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN-ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATC-ATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Mouse
Match: Arl4d (ADP-ribosylation factor-like 4D [Source:MGI Symbol;Acc:MGI:1933155])

HSP 1 Score: 135.961 bits (341), Expect = 3.304e-39
Identity = 76/165 (46.06%), Postives = 103/165 (62.42%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLK----NYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEALRLVYKMLSSTEK 661
            GLDSAGKTSLLYRLK  EFV S+PT GFN E I++       I F VWDVGGQ KLR +W  +    D L++VVD+++ +R  EA+ EL  I    + + +P+L+LANKQDQ GA+SA  +   L + ++      HV  CSA+ G GL   L  +Y+M+   +K
Sbjct:   28 GLDSAGKTSLLYRLKFKEFVQSVPTKGFNTEKIRVPLGGSRGITFQVWDVGGQEKLRPLWRSYTRRTDGLVFVVDSAETERLEEARMELHRISKASDNQGVPVLVLANKQDQPGALSAAEVEKRLAVRELAAATLTHVQGCSAVDGLGLQPGLEHLYEMILKRKK 192          
BLAST of ADP-ribosylation factor vs. Ensembl Mouse
Match: Arl4c (ADP-ribosylation factor-like 4C [Source:MGI Symbol;Acc:MGI:2445172])

HSP 1 Score: 133.65 bits (335), Expect = 2.044e-38
Identity = 76/169 (44.97%), Postives = 104/169 (61.54%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKN----YIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEALRLVYKMLSSTEKEFQK 673
            GLDSAGKT++LYRLK NEFV+++PT+GFN E IKL N     I    WDVGGQ KLR +W+ +    D +IYVVD+ D DR  EAK EL  +    E +  P+L++ANKQD   ++    I   L L ++IP   YHV    A+ G+GL E +  +Y+M+    K  ++
Sbjct:   20 GLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAKGISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGTPLLVIANKQDLPKSLPVAEIEKQLALHELIPATTYHVQPACAIIGEGLTEGMDKLYEMILKRRKSLKQ 188          
BLAST of ADP-ribosylation factor vs. Ensembl Mouse
Match: Arl4c (ADP-ribosylation factor-like 4C [Source:MGI Symbol;Acc:MGI:2445172])

HSP 1 Score: 133.65 bits (335), Expect = 2.044e-38
Identity = 76/169 (44.97%), Postives = 104/169 (61.54%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKN----YIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEALRLVYKMLSSTEKEFQK 673
            GLDSAGKT++LYRLK NEFV+++PT+GFN E IKL N     I    WDVGGQ KLR +W+ +    D +IYVVD+ D DR  EAK EL  +    E +  P+L++ANKQD   ++    I   L L ++IP   YHV    A+ G+GL E +  +Y+M+    K  ++
Sbjct:   20 GLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAKGISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGTPLLVIANKQDLPKSLPVAEIEKQLALHELIPATTYHVQPACAIIGEGLTEGMDKLYEMILKRRKSLKQ 188          
BLAST of ADP-ribosylation factor vs. Ensembl Mouse
Match: Arl4c (ADP-ribosylation factor-like 4C [Source:MGI Symbol;Acc:MGI:2445172])

HSP 1 Score: 133.65 bits (335), Expect = 2.044e-38
Identity = 76/169 (44.97%), Postives = 104/169 (61.54%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKN----YIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEALRLVYKMLSSTEKEFQK 673
            GLDSAGKT++LYRLK NEFV+++PT+GFN E IKL N     I    WDVGGQ KLR +W+ +    D +IYVVD+ D DR  EAK EL  +    E +  P+L++ANKQD   ++    I   L L ++IP   YHV    A+ G+GL E +  +Y+M+    K  ++
Sbjct:   20 GLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAKGISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGTPLLVIANKQDLPKSLPVAEIEKQLALHELIPATTYHVQPACAIIGEGLTEGMDKLYEMILKRRKSLKQ 188          
BLAST of ADP-ribosylation factor vs. Ensembl Mouse
Match: Arf3 (ADP-ribosylation factor 3 [Source:MGI Symbol;Acc:MGI:99432])

HSP 1 Score: 129.413 bits (324), Expect = 6.668e-37
Identity = 74/149 (49.66%), Postives = 105/149 (70.47%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEAL 625
            GLD+AGKT++LY+LK  E V++IPT+GFNVE ++ KN I FTVWDVGGQ K+R +W  +  +   LI+VVD++DR+R +EA+EEL+ +L  +E++   +L+ ANKQD   AM+A  I D L L  +  + +Y    C A SGDGL+E L
Sbjct:   24 GLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN-ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATC-ATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. UniProt/SwissProt
Match: sp|Q99PE9|ARL4D_MOUSE (ADP-ribosylation factor-like protein 4D OS=Mus musculus OX=10090 GN=Arl4d PE=2 SV=2)

HSP 1 Score: 135.961 bits (341), Expect = 2.311e-38
Identity = 76/165 (46.06%), Postives = 103/165 (62.42%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLK----NYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEALRLVYKMLSSTEK 661
            GLDSAGKTSLLYRLK  EFV S+PT GFN E I++       I F VWDVGGQ KLR +W  +    D L++VVD+++ +R  EA+ EL  I    + + +P+L+LANKQDQ GA+SA  +   L + ++      HV  CSA+ G GL   L  +Y+M+   +K
Sbjct:   28 GLDSAGKTSLLYRLKFKEFVQSVPTKGFNTEKIRVPLGGSRGITFQVWDVGGQEKLRPLWRSYTRRTDGLVFVVDSAETERLEEARMELHRISKASDNQGVPVLVLANKQDQPGALSAAEVEKRLAVRELAAATLTHVQGCSAVDGLGLQPGLEHLYEMILKRKK 192          
BLAST of ADP-ribosylation factor vs. UniProt/SwissProt
Match: sp|O00909|ARF1_DICDI (ADP-ribosylation factor 1 OS=Dictyostelium discoideum OX=44689 GN=arfA PE=1 SV=3)

HSP 1 Score: 133.65 bits (335), Expect = 9.052e-38
Identity = 76/161 (47.20%), Postives = 108/161 (67.08%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEALRLVYKMLSSTEK 661
            GLD+AGKT++LY+LK  E V++IPT+GFNVE ++ KN I FTVWDVGGQ K+R +W  +  +   LI+VVD++DR+R  EA +EL  +LN +E++   +L+  NKQD   AMS   + D LNL  +  + +Y    C A SGDGL+E L  +   L+S+ K
Sbjct:   24 GLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEFKN-INFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIQEACDELTKMLNEDELRDAVLLVFCNKQDLPNAMSVAEVTDKLNLHSLRSRKWYIQSTC-ATSGDGLYEGLDWLSNTLTSSSK 182          
BLAST of ADP-ribosylation factor vs. UniProt/SwissProt
Match: sp|P61208|ARL4C_MOUSE (ADP-ribosylation factor-like protein 4C OS=Mus musculus OX=10090 GN=Arl4c PE=2 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 1.430e-37
Identity = 76/169 (44.97%), Postives = 104/169 (61.54%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKN----YIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEALRLVYKMLSSTEKEFQK 673
            GLDSAGKT++LYRLK NEFV+++PT+GFN E IKL N     I    WDVGGQ KLR +W+ +    D +IYVVD+ D DR  EAK EL  +    E +  P+L++ANKQD   ++    I   L L ++IP   YHV    A+ G+GL E +  +Y+M+    K  ++
Sbjct:   20 GLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAKGISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGTPLLVIANKQDLPKSLPVAEIEKQLALHELIPATTYHVQPACAIIGEGLTEGMDKLYEMILKRRKSLKQ 188          
BLAST of ADP-ribosylation factor vs. UniProt/SwissProt
Match: sp|P56559|ARL4C_HUMAN (ADP-ribosylation factor-like protein 4C OS=Homo sapiens OX=9606 GN=ARL4C PE=1 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 1.430e-37
Identity = 76/169 (44.97%), Postives = 104/169 (61.54%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKN----YIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEALRLVYKMLSSTEKEFQK 673
            GLDSAGKT++LYRLK NEFV+++PT+GFN E IKL N     I    WDVGGQ KLR +W+ +    D +IYVVD+ D DR  EAK EL  +    E +  P+L++ANKQD   ++    I   L L ++IP   YHV    A+ G+GL E +  +Y+M+    K  ++
Sbjct:   20 GLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAKGISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGTPLLVIANKQDLPKSLPVAEIEKQLALHELIPATTYHVQPACAIIGEGLTEGMDKLYEMILKRRKSLKQ 188          
BLAST of ADP-ribosylation factor vs. UniProt/SwissProt
Match: sp|Q7RVM2|ARF_NEUCR (ADP-ribosylation factor OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU08340 PE=3 SV=3)

HSP 1 Score: 132.494 bits (332), Expect = 3.154e-37
Identity = 76/149 (51.01%), Postives = 106/149 (71.14%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEAL 625
            GLD+AGKT++LY+LK  E V++IPT+GFNVE ++ KN I+FTVWDVGGQ K+R +W  +  +   +I+VVD++DRDR  EA+EEL  +LN +E++   +L+ ANKQD   AM+A  I D L LS +  + +Y    C A +GDGLFE L
Sbjct:   27 GLDAAGKTTILYKLKLGEVVTTIPTIGFNVETVEYKN-IQFTVWDVGGQDKIRPLWRHYFQNTQGIIFVVDSNDRDRVVEAREELQRMLNEDELRDALLLVFANKQDLPNAMNAAEITDKLGLSSLRQRSWYIQATC-ATTGDGLFEGL 173          
BLAST of ADP-ribosylation factor vs. TrEMBL
Match: A0A484ECC5 (Uncharacterized protein OS=Bremia lactucae OX=4779 GN=CCR75_009416 PE=3 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 8.919e-41
Identity = 77/158 (48.73%), Postives = 112/158 (70.89%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEALRLVYKMLSS 652
            GLD+AGKT+LLYR+K  E +++IPT+GFNVE  + KN IKFT WD+GGQ K+RS+W+ +++H DA+I+VVDA+D +R  EAK+ L  I   +E+    +L+ ANKQDQ  A+SA+ + + L LS++   P  HV  C A +GDG++E L  + K L+ 
Sbjct:   31 GLDAAGKTTLLYRIKSGELIATIPTIGFNVETFEYKN-IKFTAWDIGGQDKIRSLWKHYLSHNDAVIFVVDAADLERIDEAKQALHLIFEADELADTKVLVYANKQDQPCALSAEEVRERLELSEMTANPV-HVQPCVATTGDGIYEGLDWLCKALTG 186          
BLAST of ADP-ribosylation factor vs. TrEMBL
Match: B8Y7T0 (ADP-ribosylation factor OS=Phytophthora cinnamomi OX=4785 PE=2 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 2.292e-38
Identity = 77/157 (49.04%), Postives = 110/157 (70.06%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEALRLVYKMLS 649
            GLD+AGKT+LLY++K  E V++IPT+GFNVE  + KN IKFT WD+GGQ K+RS+W+ ++ + DA+I+VVDA+D +R  EAK+ L  I   EE+    +L+ ANKQDQ  A+SA+ + + L LS+    P  HV  C A SGDG++E L  + + +S
Sbjct:   31 GLDAAGKTTLLYKIKLGELVTTIPTIGFNVETFEYKN-IKFTAWDIGGQEKIRSLWKHYLCNNDAVIFVVDAADLERVDEAKQALHLIFEAEELANTKLLVYANKQDQPNALSAEELRERLELSEATKNP-THVQPCVATSGDGIYEGLDWLSRAVS 185          
BLAST of ADP-ribosylation factor vs. TrEMBL
Match: A0A4U1F501 (Uncharacterized protein OS=Monodon monoceros OX=40151 GN=EI555_013969 PE=3 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 5.185e-38
Identity = 79/165 (47.88%), Postives = 103/165 (62.42%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLK----NYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEALRLVYKMLSSTEK 661
            GLDSAGKTSLLYRLK  EFV S+PT GFN E I++       I F VWDVGGQ KLR +W  +    D L++VVDA++ +R  EAK EL  I    + + +P+L+LANKQDQ GA+SA  +   L + ++   P  HV  CSA+ G GL   L  +Y M+   +K
Sbjct:   27 GLDSAGKTSLLYRLKFKEFVQSVPTKGFNTEKIRVPLGGSRSITFQVWDVGGQEKLRPLWRSYTRRTDGLVFVVDATEAERLEEAKVELHRISRASDNQGVPVLVLANKQDQPGALSAAEVEKRLAVGELAAAPLTHVQGCSAVDGLGLQPGLERLYGMILKRKK 191          
BLAST of ADP-ribosylation factor vs. TrEMBL
Match: A0A2Y9MP73 (ADP-ribosylation factor-like protein 4D OS=Delphinapterus leucas OX=9749 GN=ARL4D PE=3 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 5.185e-38
Identity = 79/165 (47.88%), Postives = 103/165 (62.42%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLK----NYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEALRLVYKMLSSTEK 661
            GLDSAGKTSLLYRLK  EFV S+PT GFN E I++       I F VWDVGGQ KLR +W  +    D L++VVDA++ +R  EAK EL  I    + + +P+L+LANKQDQ GA+SA  +   L + ++   P  HV  CSA+ G GL   L  +Y M+   +K
Sbjct:   27 GLDSAGKTSLLYRLKFKEFVQSVPTKGFNTEKIRVPLGGSRSITFQVWDVGGQEKLRPLWRSYTRRTDGLVFVVDATEAERLEEAKVELHRISRASDNQGVPVLVLANKQDQPGALSAAEVEKRLAVGELAAAPLTHVQGCSAVDGLGLQPGLERLYGMILKRKK 191          
BLAST of ADP-ribosylation factor vs. TrEMBL
Match: A0A2P4XIX5 (ADP ribosylation factor OS=Phytophthora palmivora var. palmivora OX=611791 GN=PHPALM_18767 PE=3 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 8.450e-38
Identity = 76/157 (48.41%), Postives = 109/157 (69.43%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEALRLVYKMLS 649
            GLD+AGKT+LLY++K  E V++IPT+GFNVE  + KN +KFT WD+GGQ K+RS+W+ ++ + DA+I+VVDASD DR  EAK+ L  I   EE+    +L+ ANKQDQ  A+SA  I + + LS++   P + V  C A  GDG++E L  + K ++
Sbjct:   31 GLDAAGKTTLLYKIKLGELVTTIPTIGFNVETFEYKN-VKFTAWDIGGQEKIRSLWKHYLFNNDAVIFVVDASDLDRIDEAKQALHLIFEAEELANTKLLVYANKQDQPNALSADEIRERMELSEVTKNPTF-VQPCVATHGDGIYEGLDWLSKAVT 185          
BLAST of ADP-ribosylation factor vs. Ensembl Cavefish
Match: arl4cb (ADP-ribosylation factor-like protein 4C [Source:NCBI gene;Acc:103025196])

HSP 1 Score: 132.88 bits (333), Expect = 3.445e-38
Identity = 76/169 (44.97%), Postives = 104/169 (61.54%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKN----YIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEALRLVYKMLSSTEKEFQK 673
            GLDSAGKT++LYRLK NEFV+++PT+GFN E IKL N     I    WDVGGQ KLR +W+ +    D +IYVVD+ D DR  EAK EL  +    E +  P+L++ANKQD   ++    I   L LS++ P   YHV    A+ G+GL E +  +Y+M+    K  ++
Sbjct:   20 GLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGAAKGISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGTPLLVIANKQDLPRSLPVADIEKQLALSELTPSTSYHVQPACAIIGEGLHEGMDKLYEMIVKRRKALKQ 188          
BLAST of ADP-ribosylation factor vs. Ensembl Cavefish
Match: arf2a (ADP-ribosylation factor 1-like [Source:NCBI gene;Acc:103045652])

HSP 1 Score: 129.413 bits (324), Expect = 4.602e-37
Identity = 74/149 (49.66%), Postives = 104/149 (69.80%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEAL 625
            GLD+AGKT++LY+LK  E V++IPT+GFNVE ++ KN I FTVWDVGGQ K+R +W  +  +   LI+VVD++DR+R +EA+EEL  +L  +E++   +L+ ANKQD   AM+A  I D L L  +  + +Y    C A SGDGL+E L
Sbjct:   24 GLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN-ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATC-ATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Cavefish
Match: arf1 (ADP-ribosylation factor 1 [Source:NCBI gene;Acc:103038497])

HSP 1 Score: 129.413 bits (324), Expect = 4.670e-37
Identity = 74/149 (49.66%), Postives = 106/149 (71.14%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEAL 625
            GLD+AGKT++LY+LK  E V++IPT+GFNVE ++ KN I FTVWDVGGQ K+R +W  +  +   LI+VVD++DR+R +EA+EEL+ +L  +E+++  +L+ ANKQD   AM+A  I D L L  +  + +Y    C A SGDGL+E L
Sbjct:   23 GLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN-ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELREAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATC-ATSGDGLYEGL 169          
BLAST of ADP-ribosylation factor vs. Ensembl Cavefish
Match: arf2b (ADP-ribosylation factor 1 [Source:NCBI gene;Acc:103047326])

HSP 1 Score: 128.642 bits (322), Expect = 6.811e-37
Identity = 75/149 (50.34%), Postives = 104/149 (69.80%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEAL 625
            GLD+AGKT++LY+LK  E V++IPT+GFNVE ++ KN I FTVWDVGGQ K+R +W  +  +   LI+VVD++DR+R +EA+EEL  +L  +E++   +LI ANKQD   AM+A  I D L L  +  + +Y    C A SGDGL+E L
Sbjct:   17 GLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN-ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHALRHRNWYIQATC-ATSGDGLYEGL 163          
BLAST of ADP-ribosylation factor vs. Ensembl Cavefish
Match: arf2b (ADP-ribosylation factor 1 [Source:NCBI gene;Acc:103047326])

HSP 1 Score: 129.028 bits (323), Expect = 8.225e-37
Identity = 75/149 (50.34%), Postives = 104/149 (69.80%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEAL 625
            GLD+AGKT++LY+LK  E V++IPT+GFNVE ++ KN I FTVWDVGGQ K+R +W  +  +   LI+VVD++DR+R +EA+EEL  +L  +E++   +LI ANKQD   AM+A  I D L L  +  + +Y    C A SGDGL+E L
Sbjct:   24 GLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN-ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHALRHRNWYIQATC-ATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Sea Lamprey
Match: arf2a (ADP-ribosylation factor 2a [Source:ZFIN;Acc:ZDB-GENE-040122-4])

HSP 1 Score: 129.798 bits (325), Expect = 7.776e-38
Identity = 74/149 (49.66%), Postives = 105/149 (70.47%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEAL 625
            GLD+AGKT++LY+LK  E V++IPT+GFNVE ++ KN I FTVWDVGGQ K+R +W  +  +   LI+VVD++DR+R +EA+EEL+ +L  +E++   +L+ ANKQD   AM+A  I D L L  +  + +Y    C A SGDGL+E L
Sbjct:   24 GLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN-ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRNAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRNWYIQATC-ATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Sea Lamprey
Match: arf1 (ADP-ribosylation factor 1 [Source:ZFIN;Acc:ZDB-GENE-010724-5])

HSP 1 Score: 129.028 bits (323), Expect = 1.253e-37
Identity = 74/149 (49.66%), Postives = 105/149 (70.47%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEAL 625
            GLD+AGKT++LY+LK  E V++IPT+GFNVE ++ KN I FTVWDVGGQ K+R +W  +  +   LI+VVD++DR+R +EA+EEL+ +L  +E++   +L+ ANKQD   AM+A  I D L L  +  + +Y    C A SGDGL+E L
Sbjct:   23 GLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN-ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATC-ATSGDGLYEGL 169          
BLAST of ADP-ribosylation factor vs. Ensembl Sea Lamprey
Match: arf2a (ADP-ribosylation factor 2a [Source:ZFIN;Acc:ZDB-GENE-040122-4])

HSP 1 Score: 125.176 bits (313), Expect = 4.162e-36
Identity = 72/149 (48.32%), Postives = 104/149 (69.80%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEAL 625
            GLD+AGKT++LY+LK  E V++IPT+GFNVE ++ KN I FTVWDVGGQ K+R +W  +  +   LI+VVD++DR+R +EA+EEL+ +L  +E++   +L+ ANKQD   AM+A  I D L L  +  + +Y   Q +   GDGL+E L
Sbjct:   24 GLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN-ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWY--IQATPPVGDGLYEGL 169          
BLAST of ADP-ribosylation factor vs. Ensembl Sea Lamprey
Match: ARL4A (ADP ribosylation factor like GTPase 4A [Source:HGNC Symbol;Acc:HGNC:695])

HSP 1 Score: 124.79 bits (312), Expect = 9.248e-36
Identity = 65/165 (39.39%), Postives = 103/165 (62.42%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKL----KNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEALRLVYKMLSSTEK 661
            GLDSAGKT++LYRLK NEFV+++PT+GFN+E ++        + F  WDVGGQ +LR +W  +    D +++VVD+ D +R  EA+ EL  +    E + +P+L++ANKQD   A++   +   L L+++ P   +H+    A+ G+GL E L  +Y+M+    K
Sbjct:   27 GLDSAGKTTVLYRLKFNEFVNTVPTIGFNMEKVRPGAGGARGVSFQFWDVGGQERLRPLWRSYTRRTDGVVFVVDSVDAERLEEARTELHRVARTPECQGVPVLVVANKQDLPAALAPAEVERLLALAELGPAALWHLQPACAIIGEGLPEGLDKLYEMILRRRK 191          
BLAST of ADP-ribosylation factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011118.1 (pep scaffold:Pmarinus_7.0:GL482736:15659:16189:-1 gene:ENSPMAG00000010091.1 transcript:ENSPMAT00000011118.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 123.25 bits (308), Expect = 2.007e-35
Identity = 71/149 (47.65%), Postives = 101/149 (67.79%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEAL 625
            GLD+AGKT++LY+LK  + V++IPTVGFNVE +  KN ++F VWDVGGQ K+R +W  + T    LI+VVD +DRDR  EA++EL  I+N  E++   IL+ ANKQD   AM    + + L L+++  + +Y V    A +GDGL+E L
Sbjct:   21 GLDAAGKTTILYKLKLGQPVTTIPTVGFNVETVTYKN-VRFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRVDEARQELHRIINDREMRDAIILVFANKQDLTDAMRPHEVQEKLGLTRVRDRNWY-VQPACASTGDGLYEGL 167          
BLAST of ADP-ribosylation factor vs. Ensembl Yeast
Match: ARF1 (ADP-ribosylation factor; GTPase of the Ras superfamily involved in regulation of coated vesicle formation in intracellular trafficking within the Golgi; ARF1 has a paralog, ARF2, that arose from the whole genome duplication; arf1 arf2 double null mutation is complemented by human ARF1, ARF4, ARF5, or ARF6 [Source:SGD;Acc:S000002351])

HSP 1 Score: 129.798 bits (325), Expect = 4.813e-38
Identity = 71/149 (47.65%), Postives = 103/149 (69.13%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEAL 625
            GLD AGKT++LY+LK  E +++IPT+GFNVE ++ KN I FTVWDVGGQ ++RS+W  +  + + +I+VVD++DR R  EA+E +  +LN +E++    L+ ANKQD   AMSA  I + L L  I  +P++    C A SG+GL+E L
Sbjct:   24 GLDGAGKTTVLYKLKLGEVITTIPTIGFNVETVQYKN-ISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAAWLVFANKQDLPEAMSAAEITEKLGLHSIRNRPWFIQATC-ATSGEGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Yeast
Match: ARF2 (ADP-ribosylation factor; GTPase of the Ras superfamily involved in regulation of coated formation vesicles in intracellular trafficking within the Golgi; ARF2 has a paralog, ARF1, that arose from the whole genome duplication; arf1 arf2 double null mutation is complemented by human ARF1, ARF4, ARF5, or ARF6 [Source:SGD;Acc:S000002296])

HSP 1 Score: 129.028 bits (323), Expect = 1.055e-37
Identity = 70/149 (46.98%), Postives = 103/149 (69.13%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEAL 625
            GLD AGKT++LY+LK  E +++IPT+GFNVE ++ KN I FTVWDVGGQ ++RS+W  +  + + +I+V+D++DR R  EA+E +  +LN +E++    L+ ANKQD   AMSA  I + L L  I  +P++    C A SG+GL+E L
Sbjct:   24 GLDGAGKTTVLYKLKLGEVITTIPTIGFNVETVQYKN-ISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVIDSNDRSRIGEAREVMQRMLNEDELRNAVWLVFANKQDLPEAMSAAEITEKLGLHSIRNRPWFIQSTC-ATSGEGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Yeast
Match: ARF3 (Glucose-repressible ADP-ribosylation factor; GTPase of Ras superfamily involved in regulating cell polarity and invasive growth; localizes to dynamic spots at plasma membrane and modulates PtdIns(4,5)P2 levels to facilitate endocytosis; required for localization of endocytic protein Lsb5p to correct cortical site in cells; also has mRNA binding activity; homolog of mammalian Arf6 [Source:SGD;Acc:S000005620])

HSP 1 Score: 117.472 bits (293), Expect = 2.397e-33
Identity = 70/149 (46.98%), Postives = 100/149 (67.11%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEAL 625
            GLD AGKT++LY+LK N+  +S PTVGFNVE +  KN +KF +WDVGGQ +LR +W  +     ALI+V+D+S R+R  EAKEEL +I+  +E++ + +L+ ANKQD   AM  + ++D L L + +    + V   +ALSG GL E L
Sbjct:   24 GLDKAGKTTILYKLKLNKIKTSTPTVGFNVETVTYKN-VKFNMWDVGGQQRLRPLWRHYFPATTALIFVIDSSARNRMEEAKEELYSIIGEKEMENVVLLVWANKQDLKDAMKPQEVSDFLELEKNLKNQPWCVIGSNALSGQGLVEGL 171          
BLAST of ADP-ribosylation factor vs. Ensembl Yeast
Match: ARL1 (Soluble GTPase with a role in regulation of membrane traffic; regulates potassium influx; role in membrane organization at trans-Golgi network; required for delivery of Atg9p to the phagophore assembly site during autophagy under high temperature stress; required with Ypt6p for starvation-induced autophagy; required for the CVT pathway under non-starvation conditions; G protein of the Ras superfamily, similar to ADP-ribosylation factor [Source:SGD;Acc:S000000368])

HSP 1 Score: 116.316 bits (290), Expect = 9.225e-33
Identity = 66/149 (44.30%), Postives = 99/149 (66.44%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEAL 625
            GLD AGKT++LYRL+  E V++ PT+GFNVE +  KN +K  VWD+GGQ  +R  W  +     A+I+VVD++D+DR S A +EL  +L  EE++   +L+ ANKQDQ GA+SA  ++  LNL ++  +  + +   SA+ G+G+ E L
Sbjct:   25 GLDGAGKTTILYRLQIGEVVTTKPTIGFNVETLSYKN-LKLNVWDLGGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMSTASKELHLMLQEEELQDAALLVFANKQDQPGALSASEVSKELNLVELKDRS-WSIVASSAIKGEGITEGL 171          
BLAST of ADP-ribosylation factor vs. Ensembl Yeast
Match: ARL3 (ARF-like small GTPase of the RAS superfamily; required for recruitment of Arl1p, a GTPase that regulates membrane traffic, to the Golgi apparatus; NatC-catalyzed N-terminal acetylation regulates Golgi membrane association mediated by interaction with membrane receptor, Sys1p; similar to ADP-ribosylation factor and orthologous to mammalian ARFRP1 [Source:SGD;Acc:S000005972])

HSP 1 Score: 85.8853 bits (211), Expect = 4.469e-21
Identity = 67/170 (39.41%), Postives = 100/170 (58.82%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDN-----EFVSSI-PTVGFNVEDIKL--KNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLN-LSQIIPKPFYHVHQCSALSGDGLFEALRLVYKMLSSTEK 661
            GLD+AGKT+ L  LK       + +  I PTVG NV  I +  K  +KF  WDVGGQ  LRSMW ++ + C  +I++VD+SDR+R  E    L +++  EEI+ +PIL+LANKQD+   M  + I +  N +++ I      V   SAL+G+G+ +A+  +   L   +K
Sbjct:   24 GLDNAGKTTFLETLKKEYSLAFKALEKIQPTVGQNVATIPVDSKQILKF--WDVGGQESLRSMWSEYYSLCHGIIFIVDSSDRERLDECSTTLQSVVMDEEIEGVPILMLANKQDRQDRMEVQDIKEVFNKIAEHISARDSRVLPISALTGEGVKDAIEWMIVRLERNKK 191          
BLAST of ADP-ribosylation factor vs. Ensembl Nematostella
Match: EDO48392 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJK4])

HSP 1 Score: 137.502 bits (345), Expect = 1.465e-40
Identity = 74/149 (49.66%), Postives = 109/149 (73.15%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEAL 625
            GLD+AGKT++LYRLK  E VS++PT+GFNVE +  KN I FTVWD+GGQ K+R++W  +   C  +I+VVD++DR+R  EA+ EL  +L  EE++++ +L++ANKQD A AM+A  I + L L++I  +P++ V    A+ G+GLFE L
Sbjct:   24 GLDNAGKTTILYRLKLEEVVSTVPTLGFNVETVTYKN-ISFTVWDIGGQDKIRALWRVYYQGCQGIIFVVDSADRERAEEARNELHKLLAEEELQQVILLVIANKQDMANAMTASEIREKLKLNEIRGRPWF-VQSACAVKGEGLFEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Nematostella
Match: EDO42156 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S214])

HSP 1 Score: 129.413 bits (324), Expect = 2.129e-37
Identity = 75/149 (50.34%), Postives = 104/149 (69.80%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEAL 625
            GLD+AGKT++LY+LK  E V++IPT+GFNVE ++ KN I FTVWDVGGQ K+R +W  +  +   LI+VVD++DR+R  EA+EEL  +LN +E++   +L+ ANKQD   AM+A  I D L L  +  + +Y    C A SGDGL+E L
Sbjct:   24 GLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN-ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGEAREELNRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRNRQWYIQATC-ATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Nematostella
Match: EDO48359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJD9])

HSP 1 Score: 125.561 bits (314), Expect = 6.133e-36
Identity = 73/149 (48.99%), Postives = 102/149 (68.46%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEAL 625
            GLD+AGKT++LY+LK  E V++IPT+GFNVE ++ KN I FTVWDVGGQ K+R +W  +  +   LIYVVD++DR+R +E+KEEL  +L  +E+K   +L++ANKQD   A+S   I + L L  I  + +Y    C A  G GL+E L
Sbjct:   24 GLDAAGKTTILYKLKLGEIVTTIPTIGFNVESVEYKN-ISFTVWDVGGQDKIRPLWRHYFQNTQGLIYVVDSNDRERVNESKEELNKMLQEDELKDAVVLVMANKQDLPNALSVSEITEKLGLQSIRDRQWYIQAAC-ATQGTGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Nematostella
Match: EDO48360 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJE1])

HSP 1 Score: 125.176 bits (313), Expect = 1.614e-35
Identity = 73/149 (48.99%), Postives = 102/149 (68.46%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEAL 625
            GLD+AGKT++LY+LK  E V++IPT+GFNVE ++ KN I FTVWDVGGQ K+R +W  +  +   LIYVVD++DR+R +E+KEEL  +L  +E+K   +L++ANKQD   A+S   I + L L  I  + +Y    C A  G GL+E L
Sbjct:   24 GLDAAGKTTILYKLKLGEIVTTIPTIGFNVESVEYKN-ISFTVWDVGGQDKIRPLWRHYFQNTQGLIYVVDSNDRERVNESKEELNKMLQEDELKDAVVLVMANKQDLPNALSVSEITEKLGLQSIRDRQWYIQAAC-ATQGTGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Nematostella
Match: EDO36373 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIW3])

HSP 1 Score: 121.709 bits (304), Expect = 1.514e-34
Identity = 74/149 (49.66%), Postives = 105/149 (70.47%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEAL 625
            GLD+AGKT++LY LK +E V++IPT+GFNVE ++ KN IKFTVWD+GGQ K+R +W  +      LI+VVD++DRDR  EAKEEL  +L  EE+K+  +L+LANKQD   +MS   +++ L+L  +  + +Y    C AL G G++E L
Sbjct:   24 GLDAAGKTTILYHLKLDEPVNTIPTIGFNVEVVEYKN-IKFTVWDIGGQDKIRLLWRLYFQETQGLIFVVDSNDRDRIQEAKEELFKLLKEEELKRAALLVLANKQDLPDSMSTTELSEKLSLHTLRSRNWYIQATC-ALKGQGVYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Medaka
Match: arl4cb (ADP ribosylation factor like GTPase 4C [Source:NCBI gene;Acc:101160857])

HSP 1 Score: 131.339 bits (329), Expect = 1.036e-37
Identity = 75/169 (44.38%), Postives = 103/169 (60.95%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKN----YIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEALRLVYKMLSSTEKEFQK 673
            GLDSAGKT++LYRLK NEFV+++PT+GFN E IKL N     I    WDVGGQ KLR +W+ +    D +IYVVD+ D DR  EAK EL  +    E +  P+L++ANKQD   ++    I   L L ++ P   YHV    A+ G+GL E +  +Y+M+    K  ++
Sbjct:   20 GLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAKGISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGTPLLVIANKQDLPKSLPVADIEKQLALHELTPSTTYHVQPACAIIGEGLHEGMDKLYEMIVKRRKSLKQ 188          
BLAST of ADP-ribosylation factor vs. Ensembl Medaka
Match: ENSORLT00000005690.2 (ADP ribosylation factor 1 [Source:NCBI gene;Acc:101175109])

HSP 1 Score: 129.413 bits (324), Expect = 3.652e-37
Identity = 75/158 (47.47%), Postives = 108/158 (68.35%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEALRLVYKMLSS 652
            GLD+AGKT++LY+LK  E V++IPT+GFNVE ++ KN I FTVWDVGGQ K+R +W  +  +   LI+VVD++DR+R  EA+EEL+ +L  +E++   +L+ ANKQD   AM+A  + D LNL  +  + +Y    C A +GDGL+E L  +   L S
Sbjct:   19 GLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN-ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERCGEAREELLRMLAEDELRDAVLLVFANKQDLPNAMNAAELTDKLNLHSLRNRNWYIQATC-ATTGDGLYEGLDWLSNQLKS 174          
BLAST of ADP-ribosylation factor vs. Ensembl Medaka
Match: ENSORLT00000017697.2 (ADP ribosylation factor 1 [Source:NCBI gene;Acc:101175109])

HSP 1 Score: 129.413 bits (324), Expect = 3.705e-37
Identity = 75/158 (47.47%), Postives = 108/158 (68.35%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEALRLVYKMLSS 652
            GLD+AGKT++LY+LK  E V++IPT+GFNVE ++ KN I FTVWDVGGQ K+R +W  +  +   LI+VVD++DR+R  EA+EEL+ +L  +E++   +L+ ANKQD   AM+A  + D LNL  +  + +Y    C A +GDGL+E L  +   L S
Sbjct:   18 GLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN-ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERCGEAREELLRMLAEDELRDAVLLVFANKQDLPNAMNAAELTDKLNLHSLRNRNWYIQATC-ATTGDGLYEGLDWLSNQLKS 173          
BLAST of ADP-ribosylation factor vs. Ensembl Medaka
Match: ENSORLT00000042909.1 (ADP ribosylation factor 3 [Source:NCBI gene;Acc:101170343])

HSP 1 Score: 129.413 bits (324), Expect = 5.204e-37
Identity = 74/149 (49.66%), Postives = 105/149 (70.47%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEAL 625
            GLD+AGKT++LY+LK  E V++IPT+GFNVE ++ KN I FTVWDVGGQ K+R +W  +  +   LI+VVD++DR+R +EA+EEL+ +L  +E++   +L+ ANKQD   AM+A  I D L L  +  + +Y    C A SGDGL+E L
Sbjct:   24 GLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN-ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATC-ATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Ensembl Medaka
Match: arf3b (ADP-ribosylation factor 3 [Source:NCBI gene;Acc:101174416])

HSP 1 Score: 129.413 bits (324), Expect = 5.204e-37
Identity = 74/149 (49.66%), Postives = 105/149 (70.47%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEAL 625
            GLD+AGKT++LY+LK  E V++IPT+GFNVE ++ KN I FTVWDVGGQ K+R +W  +  +   LI+VVD++DR+R +EA+EEL+ +L  +E++   +L+ ANKQD   AM+A  I D L L  +  + +Y    C A SGDGL+E L
Sbjct:   24 GLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN-ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATC-ATSGDGLYEGL 170          
BLAST of ADP-ribosylation factor vs. Planmine SMEST
Match: SMESG000070013.1 (SMESG000070013.1)

HSP 1 Score: 299.671 bits (766), Expect = 7.637e-104
Identity = 167/171 (97.66%), Postives = 168/171 (98.25%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEALRLVYKMLSSTEKEFQKHYTIQD 691
            GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVE IKLKNYIKFTVWDVGGQVKLRSMWEQH +H DALIYVVDASDRDRFSEAKEELITILNLEEIKKIPILILANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEALRLVYKMLSSTEKEFQKHYTIQD
Sbjct:   27 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEVIKLKNYIKFTVWDVGGQVKLRSMWEQHASHSDALIYVVDASDRDRFSEAKEELITILNLEEIKKIPILILANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEALRLVYKMLSSTEKEFQKHYTIQD 197          
BLAST of ADP-ribosylation factor vs. Planmine SMEST
Match: SMESG000070013.1 (SMESG000070013.1)

HSP 1 Score: 192.586 bits (488), Expect = 9.208e-63
Identity = 114/117 (97.44%), Postives = 115/117 (98.29%), Query Frame = 2
Query:  341 MWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEALRLVYKMLSSTEKEFQKHYTIQD 691
            MWEQH +H DALIYVVDASDRDRFSEAKEELITILNLEEIKKIPILILANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEALRLVYKMLSSTEKEFQKHYTIQD
Sbjct:    1 MWEQHASHSDALIYVVDASDRDRFSEAKEELITILNLEEIKKIPILILANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEALRLVYKMLSSTEKEFQKHYTIQD 117          
BLAST of ADP-ribosylation factor vs. Planmine SMEST
Match: SMESG000052750.1 (SMESG000052750.1)

HSP 1 Score: 148.673 bits (374), Expect = 8.234e-45
Identity = 76/155 (49.03%), Postives = 114/155 (73.55%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEALRLVYKM 643
            GLD+AGKT++LY+LK NE V++IPT+GFNVE++ +   +KFT+WDVGGQ K+R +W+ + T+C  LIYVVD++D +R  E+++EL  I   +E++ +PI+++ANKQD   AMS   I + L LS++ P   +H+  C A+SGDGL+EAL    K+
Sbjct:    3 GLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPSRIVEGLELSKLKPTHKWHIQACCAVSGDGLYEALEAAGKL 157          
BLAST of ADP-ribosylation factor vs. Planmine SMEST
Match: SMESG000052739.1 (SMESG000052739.1)

HSP 1 Score: 148.673 bits (374), Expect = 8.234e-45
Identity = 76/155 (49.03%), Postives = 114/155 (73.55%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEALRLVYKM 643
            GLD+AGKT++LY+LK NE V++IPT+GFNVE++ +   +KFT+WDVGGQ K+R +W+ + T+C  LIYVVD++D +R  E+++EL  I   +E++ +PI+++ANKQD   AMS   I + L LS++ P   +H+  C A+SGDGL+EAL    K+
Sbjct:    3 GLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPSRIVEGLELSKLKPTHKWHIQACCAVSGDGLYEALEAAGKL 157          
BLAST of ADP-ribosylation factor vs. Planmine SMEST
Match: SMESG000052739.1 (SMESG000052739.1)

HSP 1 Score: 148.673 bits (374), Expect = 1.480e-44
Identity = 76/155 (49.03%), Postives = 114/155 (73.55%), Query Frame = 2
Query:  179 GLDSAGKTSLLYRLKDNEFVSSIPTVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASDRDRFSEAXXXXXXXXXXXXXXXXXXXXXANKQDQAGAMSAKYINDNLNLSQIIPKPFYHVHQCSALSGDGLFEALRLVYKM 643
            GLD+AGKT++LY+LK NE V++IPT+GFNVE++ +   +KFT+WDVGGQ K+R +W+ + T+C  LIYVVD++D +R  E+++EL  I   +E++ +PI+++ANKQD   AMS   I + L LS++ P   +H+  C A+SGDGL+EAL    K+
Sbjct:   27 GLDAAGKTTILYKLKLNETVTTIPTIGFNVEEVSIGKGLKFTIWDVGGQEKIRLLWKHYYTNCHGLIYVVDSNDAERLKESRDELFAIAECDEMRNVPIVVIANKQDLPNAMSPSRIVEGLELSKLKPTHKWHIQACCAVSGDGLYEALEAAGKL 181          
The following BLAST results are available for this feature:
BLAST of ADP-ribosylation factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARL4C2.978e-3844.97ADP ribosylation factor like GTPase 4C [Source:HGN... [more]
ARL4C4.089e-3844.97ADP ribosylation factor like GTPase 4C [Source:HGN... [more]
ARF39.713e-3749.66ADP ribosylation factor 3 [Source:HGNC Symbol;Acc:... [more]
ARF39.713e-3749.66ADP ribosylation factor 3 [Source:HGNC Symbol;Acc:... [more]
ARF11.093e-3649.66ADP ribosylation factor 1 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of ADP-ribosylation factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arf-62.262e-3752.35ADP-Ribosylation Factor related [Source:UniProtKB... [more]
arf-1.26.841e-3748.99ADP-ribosylation factor 1-like 2 [Source:UniProtK... [more]
arf-1.26.841e-3748.99ADP-ribosylation factor 1-like 2 [Source:UniProtK... [more]
arf-1.26.841e-3748.99ADP-ribosylation factor 1-like 2 [Source:UniProtK... [more]
arf-31.452e-3545.91ADP-Ribosylation Factor related; ADP-ribosylation ... [more]
back to top
BLAST of ADP-ribosylation factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Arf79F3.080e-3750.34gene:FBgn0010348 transcript:FBtr0332054[more]
Arf79F3.080e-3750.34gene:FBgn0010348 transcript:FBtr0078573[more]
Arf79F3.080e-3750.34gene:FBgn0010348 transcript:FBtr0299906[more]
Arf79F3.080e-3750.34gene:FBgn0010348 transcript:FBtr0299907[more]
Arf79F3.080e-3750.34gene:FBgn0010348 transcript:FBtr0078571[more]
back to top
BLAST of ADP-ribosylation factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arl4cb3.811e-3844.38ADP-ribosylation factor-like 4Cb [Source:ZFIN;Acc:... [more]
arl4cb3.811e-3844.38ADP-ribosylation factor-like 4Cb [Source:ZFIN;Acc:... [more]
arl4ca6.525e-3844.38ADP-ribosylation factor-like 4Ca [Source:ZFIN;Acc:... [more]
arf14.896e-3749.66ADP-ribosylation factor 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
arf2a5.431e-3749.66ADP-ribosylation factor 2a [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of ADP-ribosylation factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dcaf71.039e-3945.12DDB1 and CUL4 associated factor 7 [Source:Xenbase;... [more]
arl4c3.994e-3743.79ADP ribosylation factor like GTPase 4C [Source:NCB... [more]
arf38.804e-3749.66ADP ribosylation factor 3 [Source:NCBI gene;Acc:10... [more]
fibp1.002e-3649.66fibroblast growth factor (acidic) intracellular bi... [more]
arf51.283e-3649.66ADP ribosylation factor 5 [Source:NCBI gene;Acc:39... [more]
back to top
BLAST of ADP-ribosylation factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Arl4d3.304e-3946.06ADP-ribosylation factor-like 4D [Source:MGI Symbol... [more]
Arl4c2.044e-3844.97ADP-ribosylation factor-like 4C [Source:MGI Symbol... [more]
Arl4c2.044e-3844.97ADP-ribosylation factor-like 4C [Source:MGI Symbol... [more]
Arl4c2.044e-3844.97ADP-ribosylation factor-like 4C [Source:MGI Symbol... [more]
Arf36.668e-3749.66ADP-ribosylation factor 3 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of ADP-ribosylation factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q99PE9|ARL4D_MOUSE2.311e-3846.06ADP-ribosylation factor-like protein 4D OS=Mus mus... [more]
sp|O00909|ARF1_DICDI9.052e-3847.20ADP-ribosylation factor 1 OS=Dictyostelium discoid... [more]
sp|P61208|ARL4C_MOUSE1.430e-3744.97ADP-ribosylation factor-like protein 4C OS=Mus mus... [more]
sp|P56559|ARL4C_HUMAN1.430e-3744.97ADP-ribosylation factor-like protein 4C OS=Homo sa... [more]
sp|Q7RVM2|ARF_NEUCR3.154e-3751.01ADP-ribosylation factor OS=Neurospora crassa (stra... [more]
back to top
BLAST of ADP-ribosylation factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A484ECC58.919e-4148.73Uncharacterized protein OS=Bremia lactucae OX=4779... [more]
B8Y7T02.292e-3849.04ADP-ribosylation factor OS=Phytophthora cinnamomi ... [more]
A0A4U1F5015.185e-3847.88Uncharacterized protein OS=Monodon monoceros OX=40... [more]
A0A2Y9MP735.185e-3847.88ADP-ribosylation factor-like protein 4D OS=Delphin... [more]
A0A2P4XIX58.450e-3848.41ADP ribosylation factor OS=Phytophthora palmivora ... [more]
back to top
BLAST of ADP-ribosylation factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arl4cb3.445e-3844.97ADP-ribosylation factor-like protein 4C [Source:NC... [more]
arf2a4.602e-3749.66ADP-ribosylation factor 1-like [Source:NCBI gene;A... [more]
arf14.670e-3749.66ADP-ribosylation factor 1 [Source:NCBI gene;Acc:10... [more]
arf2b6.811e-3750.34ADP-ribosylation factor 1 [Source:NCBI gene;Acc:10... [more]
arf2b8.225e-3750.34ADP-ribosylation factor 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of ADP-ribosylation factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arf2a7.776e-3849.66ADP-ribosylation factor 2a [Source:ZFIN;Acc:ZDB-GE... [more]
arf11.253e-3749.66ADP-ribosylation factor 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
arf2a4.162e-3648.32ADP-ribosylation factor 2a [Source:ZFIN;Acc:ZDB-GE... [more]
ARL4A9.248e-3639.39ADP ribosylation factor like GTPase 4A [Source:HGN... [more]
ENSPMAT00000011118.12.007e-3547.65pep scaffold:Pmarinus_7.0:GL482736:15659:16189:-1 ... [more]
back to top
BLAST of ADP-ribosylation factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ARF14.813e-3847.65ADP-ribosylation factor; GTPase of the Ras superfa... [more]
ARF21.055e-3746.98ADP-ribosylation factor; GTPase of the Ras superfa... [more]
ARF32.397e-3346.98Glucose-repressible ADP-ribosylation factor; GTPas... [more]
ARL19.225e-3344.30Soluble GTPase with a role in regulation of membra... [more]
ARL34.469e-2139.41ARF-like small GTPase of the RAS superfamily; requ... [more]
back to top
BLAST of ADP-ribosylation factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO483921.465e-4049.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421562.129e-3750.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483596.133e-3648.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483601.614e-3548.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO363731.514e-3449.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ADP-ribosylation factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arl4cb1.036e-3744.38ADP ribosylation factor like GTPase 4C [Source:NCB... [more]
ENSORLT00000005690.23.652e-3747.47ADP ribosylation factor 1 [Source:NCBI gene;Acc:10... [more]
ENSORLT00000017697.23.705e-3747.47ADP ribosylation factor 1 [Source:NCBI gene;Acc:10... [more]
ENSORLT00000042909.15.204e-3749.66ADP ribosylation factor 3 [Source:NCBI gene;Acc:10... [more]
arf3b5.204e-3749.66ADP-ribosylation factor 3 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of ADP-ribosylation factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000070013.17.637e-10497.66SMESG000070013.1[more]
SMESG000070013.19.208e-6397.44SMESG000070013.1[more]
SMESG000052750.18.234e-4549.03SMESG000052750.1[more]
SMESG000052739.18.234e-4549.03SMESG000052739.1[more]
SMESG000052739.11.480e-4449.03SMESG000052739.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029223 ID=SMED30029223|Name=ADP-ribosylation factor|organism=Schmidtea mediterranea sexual|type=transcript|length=750bp
CAACATGCAACTTATCTATCTATATTAGTTAAATTAGAATTTGACCGAAT
CTTATACGATTTTAAAATGGTTGAATGATGTAAATAATACATTATATATT
ATGGGAATCATTAATTGCAGATCGAATAATCTTCTCTGTAGCTCCAAATC
ATCGAAACATAAGCGACTTTTGATTTTAGGTCTCGACAGTGCTGGAAAAA
CCTCCCTACTTTACCGATTGAAAGATAATGAATTTGTCAGCTCCATTCCT
ACGGTTGGATTCAATGTTGAAGATATCAAATTGAAAAATTACATCAAATT
TACAGTATGGGATGTCGGAGGTCAAGTGAAGCTGAGATCAATGTGGGAAC
AGCACGTCACCCACTGTGATGCGTTGATCTATGTTGTTGATGCAAGTGAC
CGCGACAGGTTTTCAGAAGCAAAAGAAGAGCTAATTACGATACTAAATCT
CGAAGAAATCAAAAAGATTCCAATTTTAATTTTGGCCAATAAACAGGACC
AAGCCGGTGCCATGTCTGCAAAATATATAAATGACAATCTGAATTTGAGC
CAGATCATTCCCAAACCATTTTATCATGTTCATCAATGTTCTGCTCTTTC
TGGAGATGGACTCTTCGAAGCTTTGAGGTTGGTTTACAAAATGTTGTCGA
GTACAGAAAAAGAATTTCAGAAACACTATACTATTCAAGATTAATAATAT
CAAGAAAATATCATTTCTTATGATTCAAATTCAAACAACTAATAAATTTT
back to top

protein sequence of SMED30029223-orf-1

>SMED30029223-orf-1 ID=SMED30029223-orf-1|Name=SMED30029223-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=198bp
MGIINCRSNNLLCSSKSSKHKRLLILGLDSAGKTSLLYRLKDNEFVSSIP
TVGFNVEDIKLKNYIKFTVWDVGGQVKLRSMWEQHVTHCDALIYVVDASD
RDRFSEAKEELITILNLEEIKKIPILILANKQDQAGAMSAKYINDNLNLS
QIIPKPFYHVHQCSALSGDGLFEALRLVYKMLSSTEKEFQKHYTIQD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR005225Small_GTP-bd_dom
IPR006689Small_GTPase_ARF/SAR
IPR027417P-loop_NTPase
IPR024156Small_GTPase_ARF
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0000166nucleotide binding
Vocabulary: biological process
TermDefinition
GO:0007264small GTPase mediated signal transduction
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005634nucleus
GO:0005730nucleolus
GO:0005737cytoplasm
GO:0005886plasma membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006689Small GTPase superfamily, ARF/SAR typePRINTSPR00328SAR1GTPBPcoord: 22..45
score: 58.09
coord: 123..144
score: 40.91
coord: 78..103
score: 34.39
IPR006689Small GTPase superfamily, ARF/SAR typePFAMPF00025Arfcoord: 16..180
e-value: 4.9E-57
score: 192.2
NoneNo IPR availableSMARTSM00178sar_sub_1coord: 4..182
e-value: 1.0E-25
score: 101.4
NoneNo IPR availableSMARTSM00177arf_sub_2coord: 1..186
e-value: 9.0E-53
score: 191.3
NoneNo IPR availableSMARTSM00175rab_sub_5coord: 22..184
e-value: 8.0E-5
score: -49.5
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 21..182
e-value: 1.7E-54
score: 185.8
NoneNo IPR availablePANTHERPTHR11711ADP RIBOSYLATION FACTOR-RELATEDcoord: 10..188
NoneNo IPR availablePANTHERPTHR11711:SF363coord: 10..188
NoneNo IPR availablePROSITEPS51417ARFcoord: 14..182
score: 20.659
NoneNo IPR availableCDDcd00878Arf_Arlcoord: 22..175
e-value: 7.64636E-71
score: 210.125
IPR005225Small GTP-binding protein domainTIGRFAMTIGR00231TIGR00231coord: 19..153
e-value: 8.7E-23
score: 78.9
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 17..184