Voltage-dependent calcium channel gamma-5 subunit

Overview
NameVoltage-dependent calcium channel gamma-5 subunit
Smed IDSMED30029222
Length (bp)1882
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Voltage-dependent calcium channel gamma-5 subunit (SMED30029222) t-SNE clustered cells

Violin plots show distribution of expression levels for Voltage-dependent calcium channel gamma-5 subunit (SMED30029222) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Voltage-dependent calcium channel gamma-5 subunit (SMED30029222) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Voltage-dependent calcium channel gamma-5 subunit (SMED30029222) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029222

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30029222SMESG000005361.1 SmedASXL_007486SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30029222SMESG000005361.1 dd_Smed_v4_20066_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30029222SMESG000005361.1 dd_Smed_v6_20066_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Ensembl Human
Match: CACNG7 (calcium voltage-gated channel auxiliary subunit gamma 7 [Source:HGNC Symbol;Acc:HGNC:13626])

HSP 1 Score: 93.5893 bits (231), Expect = 1.585e-20
Identity = 69/220 (31.36%), Postives = 112/220 (50.91%), Query Frame = 3
Query:  339 SLTILTCLTACLGFIMLCVSVSTDNWLTTFERD--SQDNGTIV-IAIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPPNCTYIKYFKGKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTAGNVESEDKFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKH 989
            +LT+L+ +    G +++ ++VSTD WL   E     Q+  T V +A+H+GLWR C    FF    K                  C   +YF  +P+     +  E IL  ++ A  FP   L  +F+  ++S + +   +   L FV G  F+LSG+ L+VG+VLY+ SI+    +   +  SE  F Y YG SF F+  SF+L E +G+ ++YL+  ++
Sbjct:    8 ALTLLSSVFGACGLLLVGIAVSTDYWLYMEEGTVLPQNQTTEVKMALHAGLWRVC----FFAGREKG----------------RCVASEYFL-EPEINLVTENTENILKTVRTATPFPMVSLFLVFTAFVISNIGHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPSS--SEQYFHYRYGWSFAFAASSFLLKEGAGVMSVYLFTKRY 204          
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Ensembl Human
Match: CACNG7 (calcium voltage-gated channel auxiliary subunit gamma 7 [Source:HGNC Symbol;Acc:HGNC:13626])

HSP 1 Score: 93.5893 bits (231), Expect = 1.585e-20
Identity = 69/220 (31.36%), Postives = 112/220 (50.91%), Query Frame = 3
Query:  339 SLTILTCLTACLGFIMLCVSVSTDNWLTTFERD--SQDNGTIV-IAIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPPNCTYIKYFKGKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTAGNVESEDKFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKH 989
            +LT+L+ +    G +++ ++VSTD WL   E     Q+  T V +A+H+GLWR C    FF    K                  C   +YF  +P+     +  E IL  ++ A  FP   L  +F+  ++S + +   +   L FV G  F+LSG+ L+VG+VLY+ SI+    +   +  SE  F Y YG SF F+  SF+L E +G+ ++YL+  ++
Sbjct:    8 ALTLLSSVFGACGLLLVGIAVSTDYWLYMEEGTVLPQNQTTEVKMALHAGLWRVC----FFAGREKG----------------RCVASEYFL-EPEINLVTENTENILKTVRTATPFPMVSLFLVFTAFVISNIGHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPSS--SEQYFHYRYGWSFAFAASSFLLKEGAGVMSVYLFTKRY 204          
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Ensembl Human
Match: CACNG5 (calcium voltage-gated channel auxiliary subunit gamma 5 [Source:HGNC Symbol;Acc:HGNC:1409])

HSP 1 Score: 88.5817 bits (218), Expect = 7.672e-19
Identity = 71/227 (31.28%), Postives = 114/227 (50.22%), Query Frame = 3
Query:  318 SKFGKKNSLTILTCLTACLGFIMLCVSVSTDNWLTTFERD--SQDNGT-IVIAIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPPNCTYIKYFKGKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTAGNVESEDKFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKH 989
            S  G+K +LT+L+ + A  G  +L ++VSTD WL   E     Q+  T I +++HSGLWR C     F    ++     +  T   + P N                 +    +L  ++ A  FP   L  +F G IL+ + +       L FV G  F+LSG+ L+VG+VLY+ SI+    +   + E+   F Y YG SF F+  SF+LTE +G+ ++YL++ ++
Sbjct:    2 SACGRK-ALTLLSSVFAVCGLGLLGIAVSTDYWLYLEEGVIVPQNQSTEIKMSLHSGLWRVC-----FLAGEER----GRCFTIEYVMPMNTQLTS------------ESTVNVLKMIRSATPFPLVSLFFMFIGFILNNIGHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEMLNRTKDAET--YFNYKYGWSFAFAAISFLLTESAGVMSVYLFMKRY 204          
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Ensembl Human
Match: CACNG5 (calcium voltage-gated channel auxiliary subunit gamma 5 [Source:HGNC Symbol;Acc:HGNC:1409])

HSP 1 Score: 88.5817 bits (218), Expect = 7.672e-19
Identity = 71/227 (31.28%), Postives = 114/227 (50.22%), Query Frame = 3
Query:  318 SKFGKKNSLTILTCLTACLGFIMLCVSVSTDNWLTTFERD--SQDNGT-IVIAIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPPNCTYIKYFKGKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTAGNVESEDKFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKH 989
            S  G+K +LT+L+ + A  G  +L ++VSTD WL   E     Q+  T I +++HSGLWR C     F    ++     +  T   + P N                 +    +L  ++ A  FP   L  +F G IL+ + +       L FV G  F+LSG+ L+VG+VLY+ SI+    +   + E+   F Y YG SF F+  SF+LTE +G+ ++YL++ ++
Sbjct:    2 SACGRK-ALTLLSSVFAVCGLGLLGIAVSTDYWLYLEEGVIVPQNQSTEIKMSLHSGLWRVC-----FLAGEER----GRCFTIEYVMPMNTQLTS------------ESTVNVLKMIRSATPFPLVSLFFMFIGFILNNIGHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEMLNRTKDAET--YFNYKYGWSFAFAAISFLLTESAGVMSVYLFMKRY 204          
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Ensembl Human
Match: CACNG7 (calcium voltage-gated channel auxiliary subunit gamma 7 [Source:HGNC Symbol;Acc:HGNC:13626])

HSP 1 Score: 82.4185 bits (202), Expect = 2.414e-17
Identity = 66/213 (30.99%), Postives = 104/213 (48.83%), Query Frame = 3
Query:  330 KKNSLTILTCLTACLGFIMLCVSVSTDNWLTTFERDS--QDNGTIV-IAIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPPNCTYIKYFKGKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTAGNVESEDKFVYDYGESFYFSVFSFVLTEFSGI 959
               +LT+L+ +    G +++ ++VSTD WL   E     Q+  T V +A+H+GLWR C    FF    K                  C   +YF  +P+     +  E IL  ++ A  FP   L  +F+  ++S + +   +   L FV G  F+LSG+ L+VG+VLY+ SI+    +   +  SE  F Y YG SF F+  SF+L E + +
Sbjct:    5 SSRALTLLSSVFGACGLLLVGIAVSTDYWLYMEEGTVLPQNQTTEVKMALHAGLWRVC----FFAGREKG----------------RCVASEYFL-EPEINLVTENTENILKTVRTATPFPMVSLFLVFTAFVISNIGHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPSS--SEQYFHYRYGWSFAFAASSFLLKEVTSV 194          
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Ensembl Fly
Match: stg1 (gene:FBgn0064123 transcript:FBtr0091649)

HSP 1 Score: 57.3806 bits (137), Expect = 2.523e-8
Identity = 52/220 (23.64%), Postives = 96/220 (43.64%), Query Frame = 3
Query:  342 LTILTCLTACLGFIMLCVSVSTDNWLTTFER--DSQDNGTIVIAIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPP--NCTYIKYFKGKPKGMAEIKPPEAILYDM-QPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTAGNVESEDKFV--YDYGESFYFSVFSFVLTEFSGIFAIYLYI 980
            L ++T + A +   ++  +++   WL T E+  ++  NGT         ++      +    +K +LW     T P +     NC  I YF  +           AI Y + +    F   G+  + S  I+  +  C  +     F  G LF++SG+ +L+G++ Y+  +     S      +    +    YG+SF+  VF F++TEF G+  I+L+I
Sbjct:  225 LWLITPVAASISVAIVIAALAGPQWLFTEEKLPNANYNGT-------ANFKALDDGAYITKYTKSSLW-ILCTTLPGLDADSYNCVKIDYFSNEGYQPDPHDSTAAIPYTVTKSCPIFLAAGVFLVIS-FIVFLIPTCSHQNNLYYFSAGILFIVSGLVMLIGLIAYISILKAEIGSKLRPRSTLQPALIKVSYGQSFFLFVFGFIVTEFVGVLNIFLFI 435          
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Ensembl Zebrafish
Match: cacng7a (calcium channel, voltage-dependent, gamma subunit 7a [Source:ZFIN;Acc:ZDB-GENE-060503-814])

HSP 1 Score: 93.9745 bits (232), Expect = 8.197e-21
Identity = 70/221 (31.67%), Postives = 112/221 (50.68%), Query Frame = 3
Query:  336 NSLTILTCLTACLGFIMLCVSVSTDNWLTTFERD-SQDNGT--IVIAIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPPNCTYIKYFKGKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTAGNVESEDKFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKH 989
             +LT+L+ +    G +++ V+VSTD WL   E    Q N T  + +A+HSGLWR C     F    +K                 C   +YF  +P+     +    IL  ++ A  FP   LL +F+  ++S + +   +   L FV G  F+LSG+ L+VG+VLY+ SI+    +     E E  F Y YG SF F+  SF+L E +G+ ++YL++ ++
Sbjct:    7 RALTLLSSVFGACGLLLVGVAVSTDYWLLMEEGIILQQNQTTEVKMALHSGLWRVC-----FVAGPEKG---------------RCVASEYFT-EPEIEITTENTANILKMVRTATPFPMVSLLFVFTAFVISNIGHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPR--EPEQFFHYHYGWSFAFAASSFLLKEGAGVMSVYLFMKRY 204          
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Ensembl Zebrafish
Match: cacng7b (calcium channel, voltage-dependent, gamma subunit 7b [Source:ZFIN;Acc:ZDB-GENE-100921-51])

HSP 1 Score: 94.7449 bits (234), Expect = 1.126e-20
Identity = 70/220 (31.82%), Postives = 111/220 (50.45%), Query Frame = 3
Query:  339 SLTILTCLTACLGFIMLCVSVSTDNWLTTFERDS-QDNGTIVI--AIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPPNCTYIKYFKGKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTAGNVESEDKFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKH 989
            +LT+L+ +    G +++ V+V+TD WL   E    Q N T+ +  A+HSGLWR C    F     K                  C   +YF  +P+     +    IL  ++ A  FP   LL +F+  I+S + +   +   L FV G  F+LSG+ L+VG+VLY+ SI+    +     E E  F Y YG SF F+  SF+L E +G+ ++YL++ ++
Sbjct:    8 ALTLLSTVFGACGLLLVGVAVATDYWLLMEEGIVLQQNQTVDVKMALHSGLWRVC----FIAGTEKG----------------RCVASEYFT-EPEIEITTENTANILKMVRTATPFPMVSLLFVFTAFIISNVGHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRP--REPEQFFNYRYGWSFAFAASSFLLKEGAGVMSVYLFMKRY 204          
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Ensembl Zebrafish
Match: cacng7a (calcium channel, voltage-dependent, gamma subunit 7a [Source:ZFIN;Acc:ZDB-GENE-060503-814])

HSP 1 Score: 93.9745 bits (232), Expect = 1.872e-20
Identity = 70/221 (31.67%), Postives = 112/221 (50.68%), Query Frame = 3
Query:  336 NSLTILTCLTACLGFIMLCVSVSTDNWLTTFERD-SQDNGT--IVIAIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPPNCTYIKYFKGKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTAGNVESEDKFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKH 989
             +LT+L+ +    G +++ V+VSTD WL   E    Q N T  + +A+HSGLWR C     F    +K                 C   +YF  +P+     +    IL  ++ A  FP   LL +F+  ++S + +   +   L FV G  F+LSG+ L+VG+VLY+ SI+    +     E E  F Y YG SF F+  SF+L E +G+ ++YL++ ++
Sbjct:    7 RALTLLSSVFGACGLLLVGVAVSTDYWLLMEEGIILQQNQTTEVKMALHSGLWRVC-----FVAGPEKG---------------RCVASEYFT-EPEIEITTENTANILKMVRTATPFPMVSLLFVFTAFVISNIGHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPR--EPEQFFHYHYGWSFAFAASSFLLKEGAGVMSVYLFMKRY 204          
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Ensembl Zebrafish
Match: cacng7b (calcium channel, voltage-dependent, gamma subunit 7b [Source:ZFIN;Acc:ZDB-GENE-100921-51])

HSP 1 Score: 94.3597 bits (233), Expect = 2.223e-20
Identity = 70/221 (31.67%), Postives = 111/221 (50.23%), Query Frame = 3
Query:  336 NSLTILTCLTACLGFIMLCVSVSTDNWLTTFERDS-QDNGTIVI--AIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPPNCTYIKYFKGKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTAGNVESEDKFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKH 989
             +LT+L+ +    G +++ V+V+TD WL   E    Q N T+ +  A+HSGLWR C    F     K                  C   +YF  +P+     +    IL  ++ A  FP   LL +F+  I+S + +   +   L FV G  F+LSG+ L+VG+VLY+ SI+    +     E E  F Y YG SF F+  SF+L E +G+ ++YL++ ++
Sbjct:   34 RALTLLSTVFGACGLLLVGVAVATDYWLLMEEGIVLQQNQTVDVKMALHSGLWRVC----FIAGTEKG----------------RCVASEYFT-EPEIEITTENTANILKMVRTATPFPMVSLLFVFTAFIISNVGHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRP--REPEQFFNYRYGWSFAFAASSFLLKEGAGVMSVYLFMKRY 231          
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Ensembl Zebrafish
Match: cacng5b (calcium channel, voltage-dependent, gamma subunit 5b [Source:ZFIN;Acc:ZDB-GENE-120104-3])

HSP 1 Score: 89.3521 bits (220), Expect = 2.340e-19
Identity = 71/228 (31.14%), Postives = 113/228 (49.56%), Query Frame = 3
Query:  318 SKFGKKNSLTILTCLTACLGFIMLCVSVSTDNWLTTFE---RDSQDNGTIVIAIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPPNCTYIKYFKGKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSIS-QAFDSTAGNVESEDKFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKH 989
            S  G+K +LT+L+ + A     +L ++VSTD WL   E        +  I ++IHSGLWR C    F     +                  C  I+Y       +   +   ++L  ++ A  FP   L  +F G +L+ + +       L FV G  F+LSG+ L+VG+VLY+ SI+ + F+ T  N   E  F Y YG SF F+  SF+LTE +G+ ++YL++ ++
Sbjct:    2 SACGRK-ALTLLSSVFAVCSLGLLGIAVSTDYWLYLEEGVILPLNQSTDIRMSIHSGLWRVC----FLAGEERG----------------RCFTIEYVMPMSVQLTS-ESTVSVLKMIRSATPFPLVSLFFMFIGFVLNNIGHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEMFNRTKSN---EAYFSYKYGWSFAFAAISFLLTESAGVMSVYLFMKRY 204          
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Ensembl Xenopus
Match: kifap3 (kinesin-associated protein 3 [Source:Xenbase;Acc:XB-GENE-942612])

HSP 1 Score: 89.7373 bits (221), Expect = 2.609e-19
Identity = 64/220 (29.09%), Postives = 107/220 (48.64%), Query Frame = 3
Query:  339 SLTILTCLTACLGFIMLCVSVSTDNWLTTFE---RDSQDNGTIVIAIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPPNCTYIKYFKGKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTAGNVESEDKFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKH 989
            +LT+L+ +    G +++ ++VSTD WL   E           + +A+H+GLWR C     F    +K                 C   ++F G P      +    IL  ++ A  FP   L  +F+  ++S + +   +   L FV G  F+LSG+ L+VG+VLY+ SI+    +   +  SE  F Y YG SF F+  SF+L E +G+ ++YL+  ++
Sbjct:    8 ALTLLSSVFGACGLLLVGIAVSTDYWLHMEEGIVLPQNQTTEVKMALHAGLWRVC-----FVAGREKG---------------RCVASEFFHG-PDTDIVTENTANILKTIRSATPFPMVSLFLVFTAFVISNIGHIRPQRTILAFVSGIFFILSGLSLIVGLVLYISSINDEVMNRPSS--SEQYFHYRYGWSFAFAASSFLLKEGAGVMSVYLFTKRY 204          
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Ensembl Xenopus
Match: ehd4 (EH domain containing 4 [Source:Xenbase;Acc:XB-GENE-1000711])

HSP 1 Score: 78.1814 bits (191), Expect = 3.851e-15
Identity = 64/231 (27.71%), Postives = 104/231 (45.02%), Query Frame = 3
Query:  348 ILTCLTACLGFIMLCVSVSTDNWLTTF----ERDSQDNGTIV----IAIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPPNCTYIKYFKGKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTAGNVESED--KFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKHRHYIRVK 1010
            ++T + A   F ++ ++V TD WL +      + + DN T      +  HSGLWR C     F  + KK      +  FP+    +  Y            E    E +L  ++ ++ FP   +  LF G +    S   +    +I   G  FV +G+  ++GI++Y+ +        AG+    D  K  Y YG SFYF   SF++ E  G+ A++++I KHR  IR K
Sbjct:   11 LITTVGAFAAFSLMTIAVGTDYWLYSRGVCKAKSTNDNETSKKNEEVMTHSGLWRTCCLEGAFRGMCKK------IDHFPE----DADY------------EQDTAEYLLRAVRASSIFPILSVGLLFFGGLCVAASEFYKNKHNVILSAGIFFVSAGLSNIIGIIVYISA-------NAGDPGQSDSKKSNYSYGWSFYFGALSFIIAEMVGVLAVHMFIEKHRQ-IRAK 211          
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Ensembl Xenopus
Match: cacng2 (calcium channel, voltage-dependent, gamma subunit 2 [Source:NCBI gene;Acc:100125024])

HSP 1 Score: 75.8702 bits (185), Expect = 2.316e-14
Identity = 59/242 (24.38%), Postives = 102/242 (42.15%), Query Frame = 3
Query:  348 ILTCLTACLGFIMLCVSVSTDNWL--------TTFERDSQDNGTIVIAIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPPNCTYIKYFKGKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTAGNVESED--KFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKHRHYIRVKREKIIARSQSV 1043
            +LT + A   F ++ ++V TD WL         +   +        +  HSGLWR C     F  V K+      +  FP+    +  Y            E    E  L  ++ ++ FP   ++ LF G +    S   +    +I   G  FV +G+  ++GI++Y+        + AG+    D  K  Y YG SFYF   SF++ E  G+ A++++I +H+      R     +S ++
Sbjct:   11 LLTTVGAFAAFSLMTIAVGTDYWLYSRGVCKSKSISENETSKKNEEVMTHSGLWRTCCLEGNFKGVCKQ------IDHFPE----DADY------------EADTAEYFLRAVRASSIFPILSVILLFMGGLCIAASEFYKTRHNIILSAGIFFVSAGLSNIIGIIVYI-------SANAGDPSKSDSKKNSYSYGWSFYFGALSFIIAEMVGVLAVHMFIDRHKQLRATARATDYLQSSAI 223          
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Ensembl Xenopus
Match: ddr2 (discoidin domain receptor tyrosine kinase 2 [Source:Xenbase;Acc:XB-GENE-983827])

HSP 1 Score: 73.1738 bits (178), Expect = 2.307e-13
Identity = 63/255 (24.71%), Postives = 106/255 (41.57%), Query Frame = 3
Query:  330 KKNSLTILTCLTACLGFIMLCVSVSTDNWL---------------TTFERDSQDNGTIVIAIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIH--PPNCTYIKYFKGKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTAGNVESEDKFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKHRHYIRVKREKIIARSQSV 1043
            +K    +LT + A   F ++ +++ TD WL                T ++D +D G +    HSGLWR C             L   K     KI+  P +  Y            +    E +L  ++ ++ FP    + L  G +    S   +  + +I   G LFV +G+  ++G+++Y   IS          + E K  Y YG SFYF   SF++ E  G+ A+ +YI K+R      R ++I    ++
Sbjct:   16 EKGVQILLTTVGAFAAFGLMTIAIGTDYWLYARAFICNTTNISSEETPQKDKKDPGGLT---HSGLWRIC------------CLEGQKRGICVKINHFPEDTDY------------DHDSAEYLLRVVRASSIFPILSAMLLLLGGLCVAASRVYKSKRNIILGAGILFVAAGLSNIIGVIVY---ISANAGDPGTKRDDEKKSHYSYGWSFYFGGLSFIIAEMIGVLAVNIYIEKNREAHCKSRTELIKNPSAI 240          
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Ensembl Xenopus
Match: cacng2 (calcium channel, voltage-dependent, gamma subunit 2 [Source:NCBI gene;Acc:100125024])

HSP 1 Score: 59.6918 bits (143), Expect = 5.301e-9
Identity = 57/246 (23.17%), Postives = 94/246 (38.21%), Query Frame = 3
Query:  348 ILTCLTACLGFIMLCVSVSTDNWL--------TTFERDSQDNGTIVIAIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPPNCTYIKYFKGKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILS--FLSYCD--QKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTAGNVESED--KFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKHRHYIRVKREKIIARSQSV 1043
            +LT + A   F ++ ++V TD WL         +   +        +  HSGLWR C     F  V                    C  I +F            PE   Y+   A +F    +L  F   I S   L +C   Q     +       + +G+  ++GI++Y+ +        AG+    D  K  Y YG SFYF   SF++ E  G+ A++++I +H+      R     +S ++
Sbjct:   11 LLTTVGAFAAFSLMTIAVGTDYWLYSRGVCKSKSISENETSKKNEEVMTHSGLWRTCCLEGNFKGV--------------------CKQIDHF------------PEDADYEADTAEYFLRNLVLCFFFYLICSPFSLYFCKIFQYFLYSLLFSFSCLMTTGLSNIIGIIVYISA-------NAGDPSKSDSKKNSYSYGWSFYFGALSFIIAEMVGVLAVHMFIDRHKQLRATARATDYLQSSAI 217          
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Ensembl Mouse
Match: Cacng7 (calcium channel, voltage-dependent, gamma subunit 7 [Source:MGI Symbol;Acc:MGI:1932374])

HSP 1 Score: 93.5893 bits (231), Expect = 1.088e-20
Identity = 69/220 (31.36%), Postives = 112/220 (50.91%), Query Frame = 3
Query:  339 SLTILTCLTACLGFIMLCVSVSTDNWLTTFERD--SQDNGTIV-IAIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPPNCTYIKYFKGKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTAGNVESEDKFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKH 989
            +LT+L+ +    G +++ ++VSTD WL   E     Q+  T V +A+H+GLWR C    FF    K                  C   +YF  +P+     +  E IL  ++ A  FP   L  +F+  ++S + +   +   L FV G  F+LSG+ L+VG+VLY+ SI+    +   +  SE  F Y YG SF F+  SF+L E +G+ ++YL+  ++
Sbjct:    8 ALTLLSSVFGACGLLLVGIAVSTDYWLYMEEGTVLPQNQTTEVKMALHAGLWRVC----FFAGREKG----------------RCVASEYFL-EPEINLVTENTENILKTVRTATPFPMVSLFLVFTAFVISNIGHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPSS--SEQYFHYRYGWSFAFAASSFLLKEGAGVMSVYLFTKRY 204          
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Ensembl Mouse
Match: Cacng7 (calcium channel, voltage-dependent, gamma subunit 7 [Source:MGI Symbol;Acc:MGI:1932374])

HSP 1 Score: 93.5893 bits (231), Expect = 1.088e-20
Identity = 69/220 (31.36%), Postives = 112/220 (50.91%), Query Frame = 3
Query:  339 SLTILTCLTACLGFIMLCVSVSTDNWLTTFERD--SQDNGTIV-IAIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPPNCTYIKYFKGKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTAGNVESEDKFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKH 989
            +LT+L+ +    G +++ ++VSTD WL   E     Q+  T V +A+H+GLWR C    FF    K                  C   +YF  +P+     +  E IL  ++ A  FP   L  +F+  ++S + +   +   L FV G  F+LSG+ L+VG+VLY+ SI+    +   +  SE  F Y YG SF F+  SF+L E +G+ ++YL+  ++
Sbjct:    8 ALTLLSSVFGACGLLLVGIAVSTDYWLYMEEGTVLPQNQTTEVKMALHAGLWRVC----FFAGREKG----------------RCVASEYFL-EPEINLVTENTENILKTVRTATPFPMVSLFLVFTAFVISNIGHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPSS--SEQYFHYRYGWSFAFAASSFLLKEGAGVMSVYLFTKRY 204          
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Ensembl Mouse
Match: Cacng5 (calcium channel, voltage-dependent, gamma subunit 5 [Source:MGI Symbol;Acc:MGI:2157946])

HSP 1 Score: 90.5077 bits (223), Expect = 1.091e-19
Identity = 73/227 (32.16%), Postives = 113/227 (49.78%), Query Frame = 3
Query:  318 SKFGKKNSLTILTCLTACLGFIMLCVSVSTDNWLTTFERD--SQDNGTIV-IAIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPPNCTYIKYFKGKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTAGNVESEDKFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKH 989
            S  G+K +LT+L+ + A  G  +L ++VSTD WL   E     Q+  T V +++HSGLWR C    F     +                  C  I+Y       M   +    +L  ++ A  FP   L  +F G ILS + +       L FV G  F+LSG+ L+VG+VLY+ SI+    +   + E+   F Y YG SF F+  SF+LTE +G+ ++YL++ ++
Sbjct:    2 SACGRK-ALTLLSSVFAVCGLGLLGIAVSTDYWLYLEEGIILPQNQSTEVKMSLHSGLWRVC----FLAGEERG----------------RCFTIEYVMPMNSQMTS-ESTVNVLKMIRSATPFPLVSLFFMFIGFILSNIGHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEMLNRTKDAET--YFNYKYGWSFAFAAISFLLTESAGVMSVYLFMKRY 204          
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Ensembl Mouse
Match: Cacng5 (calcium channel, voltage-dependent, gamma subunit 5 [Source:MGI Symbol;Acc:MGI:2157946])

HSP 1 Score: 90.5077 bits (223), Expect = 1.091e-19
Identity = 73/227 (32.16%), Postives = 113/227 (49.78%), Query Frame = 3
Query:  318 SKFGKKNSLTILTCLTACLGFIMLCVSVSTDNWLTTFERD--SQDNGTIV-IAIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPPNCTYIKYFKGKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTAGNVESEDKFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKH 989
            S  G+K +LT+L+ + A  G  +L ++VSTD WL   E     Q+  T V +++HSGLWR C    F     +                  C  I+Y       M   +    +L  ++ A  FP   L  +F G ILS + +       L FV G  F+LSG+ L+VG+VLY+ SI+    +   + E+   F Y YG SF F+  SF+LTE +G+ ++YL++ ++
Sbjct:    2 SACGRK-ALTLLSSVFAVCGLGLLGIAVSTDYWLYLEEGIILPQNQSTEVKMSLHSGLWRVC----FLAGEERG----------------RCFTIEYVMPMNSQMTS-ESTVNVLKMIRSATPFPLVSLFFMFIGFILSNIGHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEMLNRTKDAET--YFNYKYGWSFAFAAISFLLTESAGVMSVYLFMKRY 204          
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Ensembl Mouse
Match: Cacng3 (calcium channel, voltage-dependent, gamma subunit 3 [Source:MGI Symbol;Acc:MGI:1859165])

HSP 1 Score: 80.4925 bits (197), Expect = 5.017e-16
Identity = 64/238 (26.89%), Postives = 107/238 (44.96%), Query Frame = 3
Query:  348 ILTCLTACLGFIMLCVSVSTDNWLTTF----ERDSQDNGTIV----IAIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPPNCTYIKYFKGKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTAGNVESED-KFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKHRHYIRVKREKIIARS 1034
            ++T + A   F ++ ++V TD WL +      + + DN T      +  HSGLWR C     F  V KK      +  FP+    +  Y            E    E +L  ++ ++ FP   +  LF G +    S   +    +I   G  FV +G+  ++GI++Y+        + AG+    D K  Y YG SFYF  FSF++ E  G+ A+++YI KH+        +++ +S
Sbjct:   11 LITTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKSTSDNETSRKNEEVMTHSGLWRTCCLEGAFRGVCKK------IDHFPE----DADY------------EQDTAEYLLRAVRASSVFPILSVTLLFFGGLCVAASEFHRSRHSVILSAGIFFVSAGLSNIIGIIVYI-------SANAGDPGQRDSKKSYSYGWSFYFGAFSFIIAEIVGVVAVHIYIEKHQQLRARSHSELLKKS 219          
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. UniProt/SwissProt
Match: sp|P62957|CCG7_RAT (Voltage-dependent calcium channel gamma-7 subunit OS=Rattus norvegicus OX=10116 GN=Cacng7 PE=1 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 7.610e-20
Identity = 69/220 (31.36%), Postives = 112/220 (50.91%), Query Frame = 3
Query:  339 SLTILTCLTACLGFIMLCVSVSTDNWLTTFERD--SQDNGTIV-IAIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPPNCTYIKYFKGKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTAGNVESEDKFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKH 989
            +LT+L+ +    G +++ ++VSTD WL   E     Q+  T V +A+H+GLWR C    FF    K                  C   +YF  +P+     +  E IL  ++ A  FP   L  +F+  ++S + +   +   L FV G  F+LSG+ L+VG+VLY+ SI+    +   +  SE  F Y YG SF F+  SF+L E +G+ ++YL+  ++
Sbjct:    8 ALTLLSSVFGACGLLLVGIAVSTDYWLYMEEGTVLPQNQTTEVKMALHAGLWRVC----FFAGREKG----------------RCVASEYFL-EPEINLVTENTENILKTVRTATPFPMVSLFLVFTAFVISNIGHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPSS--SEQYFHYRYGWSFAFAASSFLLKEGAGVMSVYLFTKRY 204          
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. UniProt/SwissProt
Match: sp|P62956|CCG7_MOUSE (Voltage-dependent calcium channel gamma-7 subunit OS=Mus musculus OX=10090 GN=Cacng7 PE=1 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 7.610e-20
Identity = 69/220 (31.36%), Postives = 112/220 (50.91%), Query Frame = 3
Query:  339 SLTILTCLTACLGFIMLCVSVSTDNWLTTFERD--SQDNGTIV-IAIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPPNCTYIKYFKGKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTAGNVESEDKFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKH 989
            +LT+L+ +    G +++ ++VSTD WL   E     Q+  T V +A+H+GLWR C    FF    K                  C   +YF  +P+     +  E IL  ++ A  FP   L  +F+  ++S + +   +   L FV G  F+LSG+ L+VG+VLY+ SI+    +   +  SE  F Y YG SF F+  SF+L E +G+ ++YL+  ++
Sbjct:    8 ALTLLSSVFGACGLLLVGIAVSTDYWLYMEEGTVLPQNQTTEVKMALHAGLWRVC----FFAGREKG----------------RCVASEYFL-EPEINLVTENTENILKTVRTATPFPMVSLFLVFTAFVISNIGHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPSS--SEQYFHYRYGWSFAFAASSFLLKEGAGVMSVYLFTKRY 204          
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. UniProt/SwissProt
Match: sp|P62955|CCG7_HUMAN (Voltage-dependent calcium channel gamma-7 subunit OS=Homo sapiens OX=9606 GN=CACNG7 PE=1 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 7.610e-20
Identity = 69/220 (31.36%), Postives = 112/220 (50.91%), Query Frame = 3
Query:  339 SLTILTCLTACLGFIMLCVSVSTDNWLTTFERD--SQDNGTIV-IAIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPPNCTYIKYFKGKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTAGNVESEDKFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKH 989
            +LT+L+ +    G +++ ++VSTD WL   E     Q+  T V +A+H+GLWR C    FF    K                  C   +YF  +P+     +  E IL  ++ A  FP   L  +F+  ++S + +   +   L FV G  F+LSG+ L+VG+VLY+ SI+    +   +  SE  F Y YG SF F+  SF+L E +G+ ++YL+  ++
Sbjct:    8 ALTLLSSVFGACGLLLVGIAVSTDYWLYMEEGTVLPQNQTTEVKMALHAGLWRVC----FFAGREKG----------------RCVASEYFL-EPEINLVTENTENILKTVRTATPFPMVSLFLVFTAFVISNIGHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPSS--SEQYFHYRYGWSFAFAASSFLLKEGAGVMSVYLFTKRY 204          
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. UniProt/SwissProt
Match: sp|Q8VHW8|CCG5_RAT (Voltage-dependent calcium channel gamma-5 subunit OS=Rattus norvegicus OX=10116 GN=Cacng5 PE=1 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 7.628e-19
Identity = 73/227 (32.16%), Postives = 113/227 (49.78%), Query Frame = 3
Query:  318 SKFGKKNSLTILTCLTACLGFIMLCVSVSTDNWLTTFERD--SQDNGTIV-IAIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPPNCTYIKYFKGKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTAGNVESEDKFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKH 989
            S  G+K +LT+L+ + A  G  +L ++VSTD WL   E     Q+  T V +++HSGLWR C    F     +                  C  I+Y       M   +    +L  ++ A  FP   L  +F G ILS + +       L FV G  F+LSG+ L+VG+VLY+ SI+    +   + E+   F Y YG SF F+  SF+LTE +G+ ++YL++ ++
Sbjct:    2 STCGRK-ALTLLSSVFAVCGLGLLGIAVSTDYWLYLEEGIILPQNQSTEVKMSLHSGLWRVC----FLAGEERG----------------RCFTIEYVMPMNSQMTS-ESTVNVLKMIRSATPFPLVSLFFMFIGFILSNIGHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEMLNRTKDAET--YFNYKYGWSFAFAAISFLLTESAGVMSVYLFMKRY 204          
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. UniProt/SwissProt
Match: sp|Q8VHW4|CCG5_MOUSE (Voltage-dependent calcium channel gamma-5 subunit OS=Mus musculus OX=10090 GN=Cacng5 PE=1 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 7.628e-19
Identity = 73/227 (32.16%), Postives = 113/227 (49.78%), Query Frame = 3
Query:  318 SKFGKKNSLTILTCLTACLGFIMLCVSVSTDNWLTTFERD--SQDNGTIV-IAIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPPNCTYIKYFKGKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTAGNVESEDKFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKH 989
            S  G+K +LT+L+ + A  G  +L ++VSTD WL   E     Q+  T V +++HSGLWR C    F     +                  C  I+Y       M   +    +L  ++ A  FP   L  +F G ILS + +       L FV G  F+LSG+ L+VG+VLY+ SI+    +   + E+   F Y YG SF F+  SF+LTE +G+ ++YL++ ++
Sbjct:    2 SACGRK-ALTLLSSVFAVCGLGLLGIAVSTDYWLYLEEGIILPQNQSTEVKMSLHSGLWRVC----FLAGEERG----------------RCFTIEYVMPMNSQMTS-ESTVNVLKMIRSATPFPLVSLFFMFIGFILSNIGHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEMLNRTKDAET--YFNYKYGWSFAFAAISFLLTESAGVMSVYLFMKRY 204          
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. TrEMBL
Match: A0A210QZQ1 (Voltage-dependent calcium channel gamma-5 subunit OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT06032 PE=4 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 5.027e-36
Identity = 93/241 (38.59%), Postives = 133/241 (55.19%), Query Frame = 3
Query:  330 KKNSLTILTCLTACLGFIMLCVSVSTDNWLTTFER-DSQDNGTIVIAIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPPNCTYIKYF--KGKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTA-GNVESEDKFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKHRHYIRVKREKIIARSQS 1040
            KK  L I+T   AC  F +L ++V+TD WL T +R     NG++     SGLWR+C+                   T   IH  NC YI+YF       G+ +    +AIL  M+ + +FP   LL L  G I+ F+ +C+   K L FV G LFVL+G+  LVGI+LY+GSI++   +   GN   E KF Y YG SF  +V SF LTE SG+F++YLYI +++H  R K ++++   Q+
Sbjct:    6 KKRLLMIMTSACACAAFGLLSIAVATDYWLFTMDRLKETSNGSVYDRFWSGLWRKCRI------------------TDQPIHHMNCEYIRYFTMNDDRDGLPQT---DAILLTMRRSTWFPLASLLILLIGTIICFVGHCNSGRKNLTFVCGILFVLAGLCTLVGIILYIGSITEEVGNKGKGNSMEEPKFKYFYGSSFMMAVSSFALTELSGVFSVYLYITRYKHSQRKKLQQMLKSEQN 225          
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. TrEMBL
Match: A0A1S3JYB3 (voltage-dependent calcium channel gamma-5 subunit-like OS=Lingula unguis OX=7574 GN=LOC106177219 PE=4 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 7.705e-29
Identity = 81/242 (33.47%), Postives = 124/242 (51.24%), Query Frame = 3
Query:  327 GKKNSLTILTCLTACLGFIMLCVSVSTDNWLTTFERDSQDNGTIVI-AIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPPNCTYIKYFKGKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSI-SQAFDSTAGNVESEDKFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKHRHYIRVKREKIIARSQSVN 1046
            G+K  L +LT L A   F  L + V+TD W+   E  +  N T V  + H+GLW++C   +                        NC+YIKYF  + K   + +  EAILY+++ +   P   LL   +G I+ F S+C  K   L FV G LFVL+G+  L+G++ Y+G+I S+A       +  +  F Y YG SF     SF + E SG+ ++YL+I +++   R KRE++ A + SV 
Sbjct:    5 GRKRFLMVLTSLCASTAFAFLSMGVATDYWIYMTEIVTGCNQTEVTKSTHAGLWKKCYSQECMKV------------------KLNCSYIKYFSLEEKD--DSQRTEAILYNIKTSTMMPLISLLLQMTGGIVCFASHCYDKKLYLSFVAGVLFVLAGLSTLIGLIFYIGAIASEAAHVRPPGIGEKPVFTYRYGSSFTMVATSFAIMELSGVLSVYLFIFRYKSENRKKRERLRAINDSVQ 226          
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. TrEMBL
Match: A0A3S1HN31 (Uncharacterized protein (Fragment) OS=Elysia chlorotica OX=188477 GN=EGW08_009510 PE=4 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 5.079e-27
Identity = 76/227 (33.48%), Postives = 115/227 (50.66%), Query Frame = 3
Query:  342 LTILTCLTACLGFIMLCVSVSTDNWLTTFERDSQDNGTIVIAIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPPNCTYIKYFKGKPKGMAEIKPPEAILY----DMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTAGNVESEDKFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKHRHYIRVK 1010
            LT++T + AC  F +LC+SV+TD WL T E   +D                 + Q       K++  S     P        Y++ + G  +     +    ++Y    +++PA+ FP   L  L  G  + F+ +C+   K L FV G LFVL+G+  LVG++LY+ SI+    +       E KF YDYG SFY +V SFVLTE SG+ ++YLYI+K++   R K
Sbjct:    3 LTVMTSVCACAAFGLLCISVATDYWLFTKELLPKDAAN-------------SEEQASNATKGKSVVQSSDSDDPDAKE-TAKYLRVYSGLWRHCTYGELILIVVYISSVNIRPASMFPLVSLFILLIGGTMCFIGHCNNSRKILTFVSGILFVLAGLCTLVGVILYISSITGEVGNKPRASIEEPKFEYDYGSSFYMAVGSFVLTELSGVLSVYLYISKYKQSQRAK 215          
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. TrEMBL
Match: A0A5K3FTF0 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 1.537e-26
Identity = 65/145 (44.83%), Postives = 95/145 (65.52%), Query Frame = 3
Query:  570 HPPNCTYIKYFKGKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKK---LIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTAGNVESEDKFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKHRH 995
            H  NC+YI +F+ + K   E+KP E+ILY M+PAA F   GLL L  G      S    + ++   L+FV GG  ++SGI  L+ IVLYVGS+S AFDS +G +  E ++VY +G +F   V +F+L+EF+G+F+IYL++A+ RH
Sbjct:   22 HYDNCSYIPHFQQRSKEAGELKPTESILYSMRPAAVFLPLGLLVLLVGGGGGLGSAACSRGRRRWLLVFVAGGSCIVSGILTLITIVLYVGSVSLAFDSVSGPLRVETRYVYSFGAAFRLCVGAFILSEFTGVFSIYLFLAEMRH 166          
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. TrEMBL
Match: R7USR0 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_156450 PE=4 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 6.762e-26
Identity = 76/227 (33.48%), Postives = 121/227 (53.30%), Query Frame = 3
Query:  348 ILTCLTACLGFIMLCVSVSTDNWLTTFERDSQDNGTIVIAI-HSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPPNCTYIKYFKGKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTAGNVESEDKFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKHRH-YIRVKREKI 1022
            + T ++AC  F  LC++V+TD WL T ER++  NGT    + ++GLWR CK   F    S+             IH        +   +   ++     +     M+ A  FP   L+ L  G IL FL +C+ K K L FV G LFV+ G+  LVGI++Y+G+I++   +   +   E KF Y YG SF  ++ SF+  E +G+ ++YLYI++H+H Y + +R+ +
Sbjct:    2 LTTSISACASFAFLCIAVATDYWLHTRERNAPVNGTNSYTLTYTGLWRRCK---FDEGESR-------------IH-------NFLINQAPLISHDTSADEFWLSMRRATVFPMVSLIILLIGEILCFLGHCNHKKKILTFVSGILFVVGGLCTLVGIIIYIGAITEEVGNKPTSSMDEPKFQYYYGVSFIMTISSFIACELTGVLSVYLYISRHQHLYKKQQRQHL 205          
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Ensembl Cavefish
Match: cacng7b (calcium channel, voltage-dependent, gamma subunit 7b [Source:ZFIN;Acc:ZDB-GENE-100921-51])

HSP 1 Score: 96.6709 bits (239), Expect = 1.482e-21
Identity = 72/221 (32.58%), Postives = 113/221 (51.13%), Query Frame = 3
Query:  336 NSLTILTCLTACLGFIMLCVSVSTDNWLTTFERDS-QDNGTIVI--AIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPPNCTYIKYFKGKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTAGNVESEDKFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKH 989
             +LT+L+ +    G +++ V+V+TD WL   E    Q N TI +  A+HSGLWR C     F   S+K                 C   +YF  +P+     +    IL  ++ A  FP   LL +F+  I+S + +   +   L FV G  F+LSG+ L+VG+VLY+ SI+    +     E E  F Y YG SF F+  SF+L E +G+ ++YL++ ++
Sbjct:    7 RALTLLSTVFGACGLLLVGVAVATDYWLLMEEGIVLQQNQTIDVKMALHSGLWRVC-----FIAGSEKG---------------RCVASEYFT-EPEIEITTENTANILKMVRTATPFPMVSLLFVFTAFIISNVGHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPR--EPEQFFNYHYGWSFAFAASSFLLKEGAGVMSVYLFMKRY 204          
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Ensembl Cavefish
Match: cacng7b (calcium channel, voltage-dependent, gamma subunit 7b [Source:ZFIN;Acc:ZDB-GENE-100921-51])

HSP 1 Score: 95.1301 bits (235), Expect = 2.452e-21
Identity = 72/221 (32.58%), Postives = 113/221 (51.13%), Query Frame = 3
Query:  336 NSLTILTCLTACLGFIMLCVSVSTDNWLTTFERDS-QDNGTIVI--AIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPPNCTYIKYFKGKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTAGNVESEDKFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKH 989
             +LT+L+ +    G +++ V+V+TD WL   E    Q N TI +  A+HSGLWR C     F   S+K                 C   +YF  +P+     +    IL  ++ A  FP   LL +F+  I+S + +   +   L FV G  F+LSG+ L+VG+VLY+ SI+   +      E E  F Y YG SF F+  SF+L E +G+ ++YL++ ++
Sbjct:    7 RALTLLSTVFGACGLLLVGVAVATDYWLLMEEGIVLQQNQTIDVKMALHSGLWRVC-----FIAGSEKG---------------RCVASEYFT-EPEIEITTENTANILKMVRTATPFPMVSLLFVFTAFIISNVGHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSIND--EVMNRPREPEQFFNYHYGWSFAFAASSFLLKEGAGVMSVYLFMKRY 204          
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Ensembl Cavefish
Match: cacng7a (calcium channel, voltage-dependent, gamma subunit 7a [Source:ZFIN;Acc:ZDB-GENE-060503-814])

HSP 1 Score: 95.5153 bits (236), Expect = 4.393e-21
Identity = 70/221 (31.67%), Postives = 111/221 (50.23%), Query Frame = 3
Query:  336 NSLTILTCLTACLGFIMLCVSVSTDNWLTTFERDS-QDNGT--IVIAIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPPNCTYIKYFKGKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTAGNVESEDKFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKH 989
             +LT+L+ +    G +++ V+VSTD WL   E    Q N T  + +A+HSGLWR C    F     K                  C   +YF  +P+     +    IL  ++ A  FP   LL +F+  ++S + +   +   L FV G  F+LSG+ L+VG+VLY+ SI+    +     E E  F Y YG SF F+  SF+L E +G+ ++YL++ ++
Sbjct:    7 RALTLLSSVFGACGLLLVGVAVSTDYWLLMEEGIVLQQNQTMEVKMALHSGLWRVC----FVAGPEKG----------------RCVASEYFT-EPEIEITTENTANILKMVRTATPFPMVSLLFVFTAFVISNIGHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPR--EPEQFFHYHYGWSFAFAASSFLLKEGAGVMSVYLFMKRY 204          
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Ensembl Cavefish
Match: cacng7a (calcium channel, voltage-dependent, gamma subunit 7a [Source:ZFIN;Acc:ZDB-GENE-060503-814])

HSP 1 Score: 94.7449 bits (234), Expect = 1.054e-20
Identity = 70/221 (31.67%), Postives = 112/221 (50.68%), Query Frame = 3
Query:  336 NSLTILTCLTACLGFIMLCVSVSTDNWLTTFERDS-QDNGT--IVIAIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPPNCTYIKYFKGKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTAGNVESEDKFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKH 989
             +LT+L+ +    G +++ V+VSTD WL   E    Q N T  + +A+HSGLWR C     F    +K                 C   +YF  +P+     +    IL  ++ A  FP   LL +F+  ++S + +   +   L FV G  F+LSG+ L+VG+VLY+ SI+    +     E E  F Y YG SF F+  SF+L E +G+ ++YL++ ++
Sbjct:    7 RALTLLSSVFGACGLLLVGVAVSTDYWLLMEEGIVLQQNQTMEVKMALHSGLWRVC-----FVAGPEKG---------------RCVASEYFT-EPEIEITTENTANILKMVRTATPFPMVSLLFVFTAFVISNIGHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPR--EPEQFFHYHYGWSFAFAASSFLLKEGAGVMSVYLFMKRY 204          
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Ensembl Cavefish
Match: cacng5b (calcium channel, voltage-dependent, gamma subunit 5b [Source:ZFIN;Acc:ZDB-GENE-120104-3])

HSP 1 Score: 86.6557 bits (213), Expect = 1.922e-18
Identity = 68/229 (29.69%), Postives = 111/229 (48.47%), Query Frame = 3
Query:  333 KNSLTILTCLTACLGFIMLCVSVSTDNWLTTFERDSQDNGTIV---------IAIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPPNCTYIKYFKGKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSIS-QAFDSTAGNVESEDKFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKH 989
            + +LT+L+ + A  G  +L ++VSTD WL        + G I+          ++HSGLWR C             L   +M          C  I+Y       +   +   ++L  ++ A  FP   L  +F G +L+ + +       L FV G  F+LSG+ L+VG+VLY+ SI+ +  + T  N   E  F Y YG SF F+  SF+LTE +G+ ++YL++ ++
Sbjct:    6 RKALTLLSSVFAVCGLGLLGIAVSTDYWLYL------EEGVILPLNQTTHTHTSLHSGLWRVC------------FLAGEEM--------GRCFTIEYVMPMSVQLTS-ESTVSVLKMIRSATPFPLVSLFFMFIGFVLNNIGHVRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVLNRTKNN---EAYFSYKYGWSFAFAAISFLLTESAGVMSVYLFMKRY 204          
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Ensembl Medaka
Match: cacng7b (voltage-dependent calcium channel gamma-7 subunit [Source:NCBI gene;Acc:101164920])

HSP 1 Score: 96.6709 bits (239), Expect = 2.383e-21
Identity = 68/220 (30.91%), Postives = 110/220 (50.00%), Query Frame = 3
Query:  339 SLTILTCLTACLGFIMLCVSVSTDNWLTTFE---RDSQDNGTIVIAIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPPNCTYIKYFKGKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTAGNVESEDKFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKH 989
            +LTIL+ +    G +++ V+VSTD WL   E        +  + +A+HSGLWR C     F   S+                  C   +YF  +P+     +    IL  ++ A  FP   LL +F+  ++S + +   +   L FV G  F+LSG+ L+VG+VLY+ SI+    +     E E  F Y YG SF F+  SF+L E +G+ ++YL++ ++
Sbjct:    8 ALTILSTVFGACGLLLVGVAVSTDYWLIVVEGIILQQNQSMEVKMALHSGLWRVC-----FVAGSENG---------------RCVASEYFT-EPEIEITTENTANILKMVRTATPFPMVSLLFVFTAFVISNIGHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPR--EPEQFFNYHYGWSFAFAASSFLLKEGAGVLSVYLFMKRY 204          
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Ensembl Medaka
Match: cacng7b (voltage-dependent calcium channel gamma-7 subunit [Source:NCBI gene;Acc:101164920])

HSP 1 Score: 95.5153 bits (236), Expect = 2.902e-21
Identity = 68/220 (30.91%), Postives = 110/220 (50.00%), Query Frame = 3
Query:  339 SLTILTCLTACLGFIMLCVSVSTDNWLTTFE---RDSQDNGTIVIAIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPPNCTYIKYFKGKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTAGNVESEDKFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKH 989
            +LTIL+ +    G +++ V+VSTD WL   E        +  + +A+HSGLWR C     F   S+                  C   +YF  +P+     +    IL  ++ A  FP   LL +F+  ++S + +   +   L FV G  F+LSG+ L+VG+VLY+ SI+    +     E E  F Y YG SF F+  SF+L E +G+ ++YL++ ++
Sbjct:    8 ALTILSTVFGACGLLLVGVAVSTDYWLIVVEGIILQQNQSMEVKMALHSGLWRVC-----FVAGSENG---------------RCVASEYFT-EPEIEITTENTANILKMVRTATPFPMVSLLFVFTAFVISNIGHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPR--EPEQFFNYHYGWSFAFAASSFLLKEGAGVLSVYLFMKRY 204          
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Ensembl Medaka
Match: ENSORLT00000044236.1 (voltage-dependent calcium channel gamma-7 subunit [Source:NCBI gene;Acc:101173155])

HSP 1 Score: 93.9745 bits (232), Expect = 6.508e-21
Identity = 78/268 (29.10%), Postives = 130/268 (48.51%), Query Frame = 3
Query:  339 SLTILTCLTACLGFIMLCVSVSTDNWLTTFERD-SQDNGT--IVIAIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPPNCTYIKYFKGKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTAGNVESEDKFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKHRHYIRVKREKIIARSQSVNSCAGLVPSSSRFSFEAPPERLINSTDLST 1133
            +LT+L+ +    G +++ V+VSTD WL   E    Q N T  + +A+HSGLWR C     F    +K                 C   +YF  +P+     +    IL  ++ A  FP   LL +F+  ++S + +   +   L FV G  F+LSG+ L+VG+VLY+ SI+   +      E E  F Y YG SF F+  SF+L E +G+ ++YL++ ++     + R         ++ C+            APP+R  +++D+S+
Sbjct:    8 ALTLLSSVFGACGLLLVGVAVSTDYWLLMEEGIILQQNQTTEVKMALHSGLWRVC-----FVAGPEKG---------------RCVASEYFT-EPEIEITTENTANILKMVRTATPFPMVSLLFVFTAFVISNIGHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSIND--EVMNRPREPEQFFHYRYGWSFAFAASSFLLKEGAGVMSVYLFMKRYAEE-ELYRPHPALYHPRMSDCSDYSGQFLHPDSWAPPQRGRSASDVSS 251          
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Ensembl Medaka
Match: ENSORLT00000027195.1 (voltage-dependent calcium channel gamma-7 subunit [Source:NCBI gene;Acc:101173155])

HSP 1 Score: 94.7449 bits (234), Expect = 1.089e-20
Identity = 78/269 (29.00%), Postives = 130/269 (48.33%), Query Frame = 3
Query:  336 NSLTILTCLTACLGFIMLCVSVSTDNWLTTFERD-SQDNGT--IVIAIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPPNCTYIKYFKGKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTAGNVESEDKFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKHRHYIRVKREKIIARSQSVNSCAGLVPSSSRFSFEAPPERLINSTDLST 1133
             +LT+L+ +    G +++ V+VSTD WL   E    Q N T  + +A+HSGLWR C     F    +K                 C   +YF  +P+     +    IL  ++ A  FP   LL +F+  ++S + +   +   L FV G  F+LSG+ L+VG+VLY+ SI+   +      E E  F Y YG SF F+  SF+L E +G+ ++YL++ ++     + R         ++ C+            APP+R  +++D+S+
Sbjct:    7 RALTLLSSVFGACGLLLVGVAVSTDYWLLMEEGIILQQNQTTEVKMALHSGLWRVC-----FVAGPEKG---------------RCVASEYFT-EPEIEITTENTANILKMVRTATPFPMVSLLFVFTAFVISNIGHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSIND--EVMNRPREPEQFFHYRYGWSFAFAASSFLLKEGAGVMSVYLFMKRYAEE-ELYRPHPALYHPRMSDCSDYSGQFLHPDSWAPPQRGRSASDVSS 251          
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Ensembl Medaka
Match: cacng5b (voltage-dependent calcium channel gamma-5 subunit [Source:NCBI gene;Acc:101159506])

HSP 1 Score: 88.1965 bits (217), Expect = 6.049e-19
Identity = 66/223 (29.60%), Postives = 105/223 (47.09%), Query Frame = 3
Query:  330 KKNSLTILTCLTACLGFIMLCVSVSTDNWLTTFE---RDSQDNGTIVIAIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPPNCTYIKYFKGKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTAGNVESEDKFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKH 989
             + +LT+L+ + A  G  +L V+VSTD WL   E        +  I  ++HSGLWR C                             C  I+Y       +   +    +L  ++ A  FP   L  +F G +L+ + +       L FV G  F+LSG+ L+VG+VLY+ SI+    +   +  SE  F Y YG SF F+  SF+LTE +G+ ++YL++ ++
Sbjct:    9 SRKALTLLSSVFAISGLGLLGVAVSTDYWLYLEEGVIMPLNQSTDIKTSLHSGLWRVC--------------------FLAGEESGRCFTIEYVMPMSVQLTS-ESTVNVLKMIRSATPFPVVSLFFMFIGFVLNNIGHIRPHRSLLAFVSGIFFILSGLALVVGLVLYISSINDEMLNRTKS--SEAHFSYKYGWSFAFAALSFLLTESAGVMSVYLFMKRY 208          
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Planmine SMEST
Match: SMESG000005361.1 (SMESG000005361.1)

HSP 1 Score: 957.977 bits (2475), Expect = 0.000e+0
Identity = 492/492 (100.00%), Postives = 492/492 (100.00%), Query Frame = 3
Query:  384 MLCVSVSTDNWLTTFERDSQDNGTIVIAIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPPNCTYIKYFKGKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTAGNVESEDKFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKHRHYIRVKREKIIARSQSVNSCAGLVPSSSRFSFEAPPERLINSTDLSTIRKKRDRNISTSASAEWGEVXXXXXXXXXXXWLLTNSHSKGTVVTEINPSQSRERLFRVTPNGPNRPVFISKTEPHVVNINPAPVSMFFQEEVGETSFGYHPRLEFNTVDQRIFYDNNIKAYYVDSQHLFNGKQNMMISPEHSIISTVLSPRHSKCQSNNQHQIVQSSIGHLKDIHLLNSLDSEDILSNGRQDNQCNCAQIEINDHIXXXXXXXXXXXXXXXXXLPQKTLLSSTSSRKITSV 1859
            MLCVSVSTDNWLTTFERDSQDNGTIVIAIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPPNCTYIKYFKGKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTAGNVESEDKFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKHRHYIRVKREKIIARSQSVNSCAGLVPSSSRFSFEAPPERLINSTDLSTIRKKRDRNISTSASAEWGEVSSQNNQTSQSQWLLTNSHSKGTVVTEINPSQSRERLFRVTPNGPNRPVFISKTEPHVVNINPAPVSMFFQEEVGETSFGYHPRLEFNTVDQRIFYDNNIKAYYVDSQHLFNGKQNMMISPEHSIISTVLSPRHSKCQSNNQHQIVQSSIGHLKDIHLLNSLDSEDILSNGRQDNQCNCAQIEINDHINFSVNSVVANNATSNNALPQKTLLSSTSSRKITSV
Sbjct:    1 MLCVSVSTDNWLTTFERDSQDNGTIVIAIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPPNCTYIKYFKGKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTAGNVESEDKFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKHRHYIRVKREKIIARSQSVNSCAGLVPSSSRFSFEAPPERLINSTDLSTIRKKRDRNISTSASAEWGEVSSQNNQTSQSQWLLTNSHSKGTVVTEINPSQSRERLFRVTPNGPNRPVFISKTEPHVVNINPAPVSMFFQEEVGETSFGYHPRLEFNTVDQRIFYDNNIKAYYVDSQHLFNGKQNMMISPEHSIISTVLSPRHSKCQSNNQHQIVQSSIGHLKDIHLLNSLDSEDILSNGRQDNQCNCAQIEINDHINFSVNSVVANNATSNNALPQKTLLSSTSSRKITSV 492          
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Planmine SMEST
Match: SMESG000076137.1 (SMESG000076137.1)

HSP 1 Score: 236.113 bits (601), Expect = 4.019e-70
Identity = 110/208 (52.88%), Postives = 151/208 (72.60%), Query Frame = 3
Query:  384 MLCVSVSTDNWLTTFERDSQDNGTIVIAIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPPNCTYIKYFKGKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTAGNVESEDKFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKHRHYIRV 1007
            ML +S++TD W+TTFER +  N T +I+ +SGLWR+C Q      V+K T+W+  M+  P     NC++I YFKGKPK   E+K PEAILY+M+ +A F    L+ L +G +LS LS+CD+K+KK  FV  GL+VLSGIFLL+GIVLYVG ISQAFDS + N +SE+ ++Y+YG SFYFSV +F+ +EF+G+F IYLYIAK +   ++
Sbjct:    1 MLFISLTTDYWITTFERMTNFNITNIISQNSGLWRKCWQSYQVFGVTKTTIWSDSMKILPSGLTKNCSFISYFKGKPKNAGEMKAPEAILYEMRTSAIFSVISLVVLLTGSVLSMLSFCDEKLKKSTFVASGLYVLSGIFLLIGIVLYVGCISQAFDSKSDNKDSENVYLYEYGISFYFSVAAFIFSEFAGVFCIYLYIAKQKQLHKI 208          
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Planmine SMEST
Match: SMESG000040150.1 (SMESG000040150.1)

HSP 1 Score: 194.512 bits (493), Expect = 9.546e-56
Identity = 99/229 (43.23%), Postives = 150/229 (65.50%), Query Frame = 3
Query:  324 FGKKNSLTILTCLTACLGFIMLCVSVSTDNWLTTFERDSQDNGTIVIAIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPPNCTYIKYFKGKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTAGNVESEDKFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKHRHYIRVK 1010
            FGKK  L   T + + +G ++L  S+STD WLTT ER +  NGT +    SGLWR+C + +        T W  +MR FPK  P NCTY+KYF+ + K  +++KP E +L++MQP+A FP   L+ L   C  + L+    +++K+I + G  FV+SG+ LL+GIVLYVGS+SQ+FDS++ ++ +E K++Y Y  SF+ +V SF+L + SGI ++Y YIA  +H IR++
Sbjct:    5 FGKKRFLNTCTAICSGIGLLLLLASISTDYWLTTHERRNMQNGTEITENSSGLWRKCTRTKIMLFPKSVTHWTDEMRHFPKNIPLNCTYLKYFQKRSKAFSDLKPTEIVLFEMQPSAIFPIISLVFLSIACSCALLNQTCFQIEKMIMIAGANFVISGLALLIGIVLYVGSVSQSFDSSSNSINTESKYLYAYDVSFHLTVISFILMKLSGIVSLYHYIAISKHNIRIQ 233          
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Planmine SMEST
Match: SMESG000040150.1 (SMESG000040150.1)

HSP 1 Score: 159.844 bits (403), Expect = 1.828e-43
Identity = 81/189 (42.86%), Postives = 125/189 (66.14%), Query Frame = 3
Query:  444 DNGTIVIAIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPPNCTYIKYFKGKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTAGNVESEDKFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKHRHYIRVK 1010
             NGT +    SGLWR+C + +        T W  +MR FPK  P NCTY+KYF+ + K  +++KP E +L++MQP+A FP   L+ L   C  + L+    +++K+I + G  FV+SG+ LL+GIVLYVGS+SQ+FDS++ ++ +E K++Y Y  SF+ +V SF+L + SGI ++Y YIA  +H IR++
Sbjct:    2 QNGTEITENSSGLWRKCTRTKIMLFPKSVTHWTDEMRHFPKNIPLNCTYLKYFQKRSKAFSDLKPTEIVLFEMQPSAIFPIISLVFLSIACSCALLNQTCFQIEKMIMIAGANFVISGLALLIGIVLYVGSVSQSFDSSSNSINTESKYLYAYDVSFHLTVISFILMKLSGIVSLYHYIAISKHNIRIQ 190          
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Planmine SMEST
Match: SMESG000040150.1 (SMESG000040150.1)

HSP 1 Score: 96.6709 bits (239), Expect = 8.224e-22
Identity = 52/118 (44.07%), Postives = 83/118 (70.34%), Query Frame = 3
Query:  657 DMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVKKLIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTAGNVESEDKFVYDYGESFYFSVFSFVLTEFSGIFAIYLYIAKHRHYIRVK 1010
            +MQP+A FP   L+ L   C  + L+    +++K+I + G  FV+SG+ LL+GIVLYVGS+SQ+FDS++ ++ +E K++Y Y  SF+ +V SF+L + SGI ++Y YIA  +H IR++
Sbjct:   14 EMQPSAIFPIISLVFLSIACSCALLNQTCFQIEKMIMIAGANFVISGLALLIGIVLYVGSVSQSFDSSSNSINTESKYLYAYDVSFHLTVISFILMKLSGIVSLYHYIAISKHNIRIQ 131          
The following BLAST results are available for this feature:
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CACNG71.585e-2031.36calcium voltage-gated channel auxiliary subunit ga... [more]
CACNG71.585e-2031.36calcium voltage-gated channel auxiliary subunit ga... [more]
CACNG57.672e-1931.28calcium voltage-gated channel auxiliary subunit ga... [more]
CACNG57.672e-1931.28calcium voltage-gated channel auxiliary subunit ga... [more]
CACNG72.414e-1730.99calcium voltage-gated channel auxiliary subunit ga... [more]
back to top
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
stg12.523e-823.64gene:FBgn0064123 transcript:FBtr0091649[more]
back to top
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cacng7a8.197e-2131.67calcium channel, voltage-dependent, gamma subunit ... [more]
cacng7b1.126e-2031.82calcium channel, voltage-dependent, gamma subunit ... [more]
cacng7a1.872e-2031.67calcium channel, voltage-dependent, gamma subunit ... [more]
cacng7b2.223e-2031.67calcium channel, voltage-dependent, gamma subunit ... [more]
cacng5b2.340e-1931.14calcium channel, voltage-dependent, gamma subunit ... [more]
back to top
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kifap32.609e-1929.09kinesin-associated protein 3 [Source:Xenbase;Acc:X... [more]
ehd43.851e-1527.71EH domain containing 4 [Source:Xenbase;Acc:XB-GENE... [more]
cacng22.316e-1424.38calcium channel, voltage-dependent, gamma subunit ... [more]
ddr22.307e-1324.71discoidin domain receptor tyrosine kinase 2 [Sourc... [more]
cacng25.301e-923.17calcium channel, voltage-dependent, gamma subunit ... [more]
back to top
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cacng71.088e-2031.36calcium channel, voltage-dependent, gamma subunit ... [more]
Cacng71.088e-2031.36calcium channel, voltage-dependent, gamma subunit ... [more]
Cacng51.091e-1932.16calcium channel, voltage-dependent, gamma subunit ... [more]
Cacng51.091e-1932.16calcium channel, voltage-dependent, gamma subunit ... [more]
Cacng35.017e-1626.89calcium channel, voltage-dependent, gamma subunit ... [more]
back to top
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P62957|CCG7_RAT7.610e-2031.36Voltage-dependent calcium channel gamma-7 subunit ... [more]
sp|P62956|CCG7_MOUSE7.610e-2031.36Voltage-dependent calcium channel gamma-7 subunit ... [more]
sp|P62955|CCG7_HUMAN7.610e-2031.36Voltage-dependent calcium channel gamma-7 subunit ... [more]
sp|Q8VHW8|CCG5_RAT7.628e-1932.16Voltage-dependent calcium channel gamma-5 subunit ... [more]
sp|Q8VHW4|CCG5_MOUSE7.628e-1932.16Voltage-dependent calcium channel gamma-5 subunit ... [more]
back to top
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210QZQ15.027e-3638.59Voltage-dependent calcium channel gamma-5 subunit ... [more]
A0A1S3JYB37.705e-2933.47voltage-dependent calcium channel gamma-5 subunit-... [more]
A0A3S1HN315.079e-2733.48Uncharacterized protein (Fragment) OS=Elysia chlor... [more]
A0A5K3FTF01.537e-2644.83Uncharacterized protein OS=Mesocestoides corti OX=... [more]
R7USR06.762e-2633.48Uncharacterized protein OS=Capitella teleta OX=283... [more]
back to top
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cacng7b1.482e-2132.58calcium channel, voltage-dependent, gamma subunit ... [more]
cacng7b2.452e-2132.58calcium channel, voltage-dependent, gamma subunit ... [more]
cacng7a4.393e-2131.67calcium channel, voltage-dependent, gamma subunit ... [more]
cacng7a1.054e-2031.67calcium channel, voltage-dependent, gamma subunit ... [more]
cacng5b1.922e-1829.69calcium channel, voltage-dependent, gamma subunit ... [more]
back to top
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cacng7b2.383e-2130.91voltage-dependent calcium channel gamma-7 subunit ... [more]
cacng7b2.902e-2130.91voltage-dependent calcium channel gamma-7 subunit ... [more]
ENSORLT00000044236.16.508e-2129.10voltage-dependent calcium channel gamma-7 subunit ... [more]
ENSORLT00000027195.11.089e-2029.00voltage-dependent calcium channel gamma-7 subunit ... [more]
cacng5b6.049e-1929.60voltage-dependent calcium channel gamma-5 subunit ... [more]
back to top
BLAST of Voltage-dependent calcium channel gamma-5 subunit vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005361.10.000e+0100.00SMESG000005361.1[more]
SMESG000076137.14.019e-7052.88SMESG000076137.1[more]
SMESG000040150.19.546e-5643.23SMESG000040150.1[more]
SMESG000040150.11.828e-4342.86SMESG000040150.1[more]
SMESG000040150.18.224e-2244.07SMESG000040150.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029222 ID=SMED30029222|Name=Voltage-dependent calcium channel gamma-5 subunit|organism=Schmidtea mediterranea sexual|type=transcript|length=1882bp
CAGATGGTGAAAGGAAATTTACAGATCAGTCAATTTTCGTTTTTGACTAA
TAACAGCAAGGAATTACGTTCTGATTTTGGTTTCAATTGCTCAGTTGATG
GAATATTTAAATATGCTGGAAAATGAGATAAAAAATTTAATAAACGCAGT
TAGCATTGTGTAAGATTTTTTGAAAAAAAATATTTCAATTCGACAAAATG
GATAAATGCAATCAAATCAATATCCAATCCGTTCTTTCTTAATAATTTTT
CCTTTGAATTTTGTTTAATATATCATTTTCTGGGAATAACAAGTAACAGA
AAATTATGAAAAATCATTCAAAATTTGGAAAAAAAAATTCCTTAACCATT
TTAACTTGTCTCACTGCTTGTCTTGGTTTTATAATGCTGTGCGTTTCGGT
TTCAACTGACAACTGGTTGACGACATTCGAAAGAGACAGCCAAGACAACG
GAACAATTGTCATTGCGATTCATTCGGGTCTTTGGAGAGAATGCAAACAG
TTGCAATTTTTCCCGACAGTGTCTAAAAAAACTCTCTGGAATTCCAAAAT
GAGAACTTTTCCAAAGATTCATCCACCAAATTGCACATATATAAAGTATT
TCAAAGGGAAACCAAAAGGAATGGCTGAAATCAAACCTCCTGAAGCTATT
CTCTATGATATGCAGCCAGCAGCATTTTTTCCCACCACCGGTTTATTGGG
ATTATTCAGTGGTTGCATTCTCTCATTTCTCAGTTATTGCGATCAGAAAG
TCAAAAAACTCATTTTCGTCGGTGGAGGACTTTTTGTTCTTAGTGGAATA
TTTCTTTTAGTCGGAATAGTACTGTATGTTGGAAGTATAAGTCAAGCCTT
TGATAGTACGGCAGGCAATGTTGAATCGGAAGATAAATTTGTATATGATT
ATGGGGAATCATTTTATTTTTCAGTGTTTTCATTTGTTTTAACTGAATTC
TCTGGAATATTTGCAATATATCTCTACATTGCCAAACATAGGCATTATAT
TAGAGTTAAGCGAGAAAAGATTATTGCTCGTAGTCAAAGCGTCAATTCCT
GTGCGGGTTTGGTGCCGAGTTCTTCGCGGTTTTCTTTTGAAGCTCCTCCA
GAACGGTTAATTAATTCCACAGATTTATCGACAATTCGAAAGAAACGAGA
TCGAAATATTTCCACTTCAGCAAGCGCTGAATGGGGTGAGGTTTCTAGTC
AAAACAATCAAACGTCTCAGTCGCAATGGTTGTTAACTAATAGTCATTCA
AAGGGAACTGTTGTAACAGAAATAAATCCAAGTCAAAGCCGAGAAAGATT
ATTCAGAGTAACGCCAAACGGACCGAATAGGCCAGTCTTCATATCTAAAA
CAGAACCTCACGTGGTAAACATAAATCCAGCGCCAGTTTCAATGTTTTTT
CAAGAAGAAGTCGGTGAAACGTCATTTGGATACCATCCTCGATTGGAATT
TAATACAGTAGATCAAAGAATATTTTATGATAATAATATTAAAGCTTATT
ATGTTGATTCTCAGCATTTATTCAATGGGAAACAAAATATGATGATATCA
CCTGAACATAGTATCATATCAACCGTTTTGTCTCCACGCCACAGCAAATG
CCAGTCAAACAATCAACATCAAATAGTTCAGTCTTCAATAGGCCATTTGA
AAGATATTCATTTGTTAAATTCTCTTGACAGTGAAGATATTCTTTCGAAT
GGTAGACAAGATAATCAATGTAATTGTGCTCAAATTGAAATCAACGACCA
TATAAATTTTTCTGTCAATTCTGTCGTCGCAAACAATGCCACCTCAAATA
ATGCACTTCCTCAGAAAACGTTATTATCAAGTACAAGCTCACGAAAGATA
ACTTCTGTATAAAGTTTGTTATAATATTTGAC
back to top

protein sequence of SMED30029222-orf-1

>SMED30029222-orf-1 ID=SMED30029222-orf-1|Name=SMED30029222-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=519bp
MKNHSKFGKKNSLTILTCLTACLGFIMLCVSVSTDNWLTTFERDSQDNGT
IVIAIHSGLWRECKQLQFFPTVSKKTLWNSKMRTFPKIHPPNCTYIKYFK
GKPKGMAEIKPPEAILYDMQPAAFFPTTGLLGLFSGCILSFLSYCDQKVK
KLIFVGGGLFVLSGIFLLVGIVLYVGSISQAFDSTAGNVESEDKFVYDYG
ESFYFSVFSFVLTEFSGIFAIYLYIAKHRHYIRVKREKIIARSQSVNSCA
GLVPSSSRFSFEAPPERLINSTDLSTIRKKRDRNISTSASAEWGEVSSQN
NQTSQSQWLLTNSHSKGTVVTEINPSQSRERLFRVTPNGPNRPVFISKTE
PHVVNINPAPVSMFFQEEVGETSFGYHPRLEFNTVDQRIFYDNNIKAYYV
DSQHLFNGKQNMMISPEHSIISTVLSPRHSKCQSNNQHQIVQSSIGHLKD
IHLLNSLDSEDILSNGRQDNQCNCAQIEINDHINFSVNSVVANNATSNNA
LPQKTLLSSTSSRKITSV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR008368VDCC_gsu
IPR004031PMP22/EMP/MP20/Claudin
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006816calcium ion transport
GO:0006810transport
GO:0006811ion transport
GO:0034765regulation of ion transmembrane transport
GO:0070588calcium ion transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0005244voltage-gated ion channel activity
GO:0005262calcium channel activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008368Voltage-dependent calcium channel, gamma subunitPRINTSPR01792VDCCGAMMAcoord: 197..218
score: 44.97
coord: 21..39
score: 34.96
coord: 163..182
score: 27.32
NoneNo IPR availableGENE3DG3DSA:1.20.140.150coord: 8..237
e-value: 4.0E-43
score: 149.3
NoneNo IPR availablePANTHERPTHR12107VOLTAGE-DEPENDENT CALCIUM CHANNEL GAMMA SUBUNITcoord: 10..411
NoneNo IPR availableTMHMMTMhelixcoord: 204..226
NoneNo IPR availableTMHMMTMhelixcoord: 152..174
NoneNo IPR availableTMHMMTMhelixcoord: 12..34
NoneNo IPR availableTMHMMTMhelixcoord: 123..145
IPR004031PMP-22/EMP/MP20/Claudin superfamilyPFAMPF13903Claudin_2coord: 22..218
e-value: 1.4E-17
score: 64.1