Calcium-transporting ATPase

Overview
NameCalcium-transporting ATPase
Smed IDSMED30029216
Length (bp)3781
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Calcium-transporting ATPase (SMED30029216) t-SNE clustered cells

Violin plots show distribution of expression levels for Calcium-transporting ATPase (SMED30029216) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Calcium-transporting ATPase (SMED30029216) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Calcium-transporting ATPase (SMED30029216) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029216

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30029216h1SMcG0020481 dd_Smed_v4_1006_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029216h1SMcG0020481 dd_Smed_v4_1006_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Match: ATP2A2 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 2 [Source:HGNC Symbol;Acc:HGNC:812])

HSP 1 Score: 1321.61 bits (3419), Expect = 0.000e+0
Identity = 676/999 (67.67%), Postives = 810/999 (81.08%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRN 3080
            M+NAH+K+V +VL  F V++  GL+ +Q++  +E +G N LP EEGK L +LV+EQF+DLLV+ILL AA ISF+LAWF+  E++ TAFVEPFVILLIL+ NA+VGVWQE+NAE+AI+ALKEYE E  KV R + K +Q IKA  +VPGDIVE++VGDKVPADIR+  I STTL++DQSILTGES SVIKH+D + D  AVNQDK NMLFSGTN+A+GK  GVV + G+NTEIGKIRD+++ T+Q +TPL +KLD F EQLSKVI++ICI VW+INIGHFNDP+HGGS +RGAIYYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V RMFI+  V  D   + EF I+GS Y+P G++   +K V C     L E+A IC+LCNDS++++NE+KGVYEKVGEATETAL CLVEKMN+ +      SK + +  CNS I+  + KEFTLEFSRDRKSMS + +P  P    +T++        ++ VKGAPEG++DRCT +R    +V MT+ +K +IM  +  +G+G DTLRCLALA  D P+ R  M   ++ NF KYE+N+TFVG VGMLDPPR EV  S+  CR AGIRVI+ITGDNK TA AICRRIGIFG+DE    K++TGREFD+L+   QR+A  NA  FARVEP+HKSKI+E LQ   EI+AMTGDGVNDAPALKKAEIGIAMGSGTAVAK+AS+MVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSN+GEVVCIFLTAALG PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM +PPR+PKE LISGWLFFRY+AIGCYVGAATVG+AAWWF+++  GP VS+YQL+H LQC  +  DF GVDC +F    PMTMALSVLV IEM NALNSLSENQSL++MPPW NIWL+ +I LSMSLHFLIL V  L  +FQI+PL+ ++WL V+K S PV+L+DE+LK ++RN
Sbjct:    1 MENAHTKTVEEVLGHFGVNESTGLSLEQVKKLKERWGSNELPAEEGKTLLELVIEQFEDLLVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALKEYEPEMGKVYRQDRKSVQRIKAKDIVPGDIVEIAVGDKVPADIRLTSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAMGVVVATGVNTEIGKIRDEMVATEQERTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFILDRVEGDTCSLNEFTITGSTYAPIGEVHKDDKPVNCHQYDGLVELATICALCNDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTELKGLSKIERANACNSVIKQLMKKEFTLEFSRDRKSMSVYCTPNKPS---RTSMS-------KMFVKGAPEGVIDRCTHIRVGSTKVPMTSGVKQKIMSVIREWGSGSDTLRCLALATHDNPLRREEMHLEDSANFIKYETNLTFVGCVGMLDPPRIEVASSVKLCRQAGIRVIMITGDNKGTAVAICRRIGIFGQDEDVTSKAFTGREFDELNPSAQRDACLNARCFARVEPSHKSKIVEFLQSFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYVGAATVGAAAWWFIAADGGPRVSFYQLSHFLQCKEDNPDFEGVDCAIFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWENIWLVGSICLSMSLHFLILYVEPLPLIFQITPLNVTQWLMVLKISLPVILMDETLKFVARN 989          
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Match: ATP2A2 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 2 [Source:HGNC Symbol;Acc:HGNC:812])

HSP 1 Score: 1319.29 bits (3413), Expect = 0.000e+0
Identity = 675/999 (67.57%), Postives = 807/999 (80.78%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRN 3080
            M+NAH+K+V +VL  F V++  GL+ +Q++  +E +G N LP EEGK L +LV+EQF+DLLV+ILL AA ISF+LAWF+  E++ TAFVEPFVILLIL+ NA+VGVWQE+NAE+AI+ALKEYE E  KV R + K +Q IKA  +VPGDIVE++VGDKVPADIR+  I STTL++DQSILTGES SVIKH+D + D  AVNQDK NMLFSGTN+A+GK  GVV + G+NTEIGKIRD+++ T+Q +TPL +KLD F EQLSKVI++ICI VW+INIGHFNDP+HGGS +RGAIYYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V RMFI+  V  D   + EF I+GS Y+P G++   +K V C     L E+A IC+LCNDS++++NE+KGVYEKVGEATETAL CLVEKMN+ +      SK + +  CNS I+  + KEFTLEFSRDRKSMS + +P  P             +  ++ VKGAPEG++DRCT +R    +V MT+ +K +IM  +  +G+G DTLRCLALA  D P+ R  M   ++ NF KYE+N+TFVG VGMLDPPR EV  S+  CR AGIRVI+ITGDNK TA AICRRIGIFG+DE    K++TGREFD+L+   QR+A  NA  FARVEP+HKSKI+E LQ   EI+AMTGDGVNDAPALKKAEIGIAMGSGTAVAK+AS+MVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSN+GEVVCIFLTAALG PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM +PPR+PKE LISGWLFFRY+AIGCYVGAATVG+AAWWF+++  GP VS+YQL+H LQC  +  DF GVDC +F    PMTMALSVLV IEM NALNSLSENQSL++MPPW NIWL+ +I LSMSLHFLIL V  L  +FQI+PL+ ++WL V+K S PV+L+DE+LK ++RN
Sbjct:    1 MENAHTKTVEEVLGHFGVNESTGLSLEQVKKLKERWGSNELPAEEGKTLLELVIEQFEDLLVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALKEYEPEMGKVYRQDRKSVQRIKAKDIVPGDIVEIAVGDKVPADIRLTSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAMGVVVATGVNTEIGKIRDEMVATEQERTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFILDRVEGDTCSLNEFTITGSTYAPIGEVHKDDKPVNCHQYDGLVELATICALCNDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTELKGLSKIERANACNSVIKQLMKKEFTLEFSRDRKSMSVYCTPNKPS----------RTSMSKMFVKGAPEGVIDRCTHIRVGSTKVPMTSGVKQKIMSVIREWGSGSDTLRCLALATHDNPLRREEMHLEDSANFIKYETNLTFVGCVGMLDPPRIEVASSVKLCRQAGIRVIMITGDNKGTAVAICRRIGIFGQDEDVTSKAFTGREFDELNPSAQRDACLNARCFARVEPSHKSKIVEFLQSFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYVGAATVGAAAWWFIAADGGPRVSFYQLSHFLQCKEDNPDFEGVDCAIFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWENIWLVGSICLSMSLHFLILYVEPLPLIFQITPLNVTQWLMVLKISLPVILMDETLKFVARN 989          
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Match: ATP2A1 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1 [Source:HGNC Symbol;Acc:HGNC:811])

HSP 1 Score: 1313.13 bits (3397), Expect = 0.000e+0
Identity = 676/999 (67.67%), Postives = 804/999 (80.48%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRN 3080
            M+ AH+K+  + L +F VS+  GLT  Q++ + E YG+N LP EEGK LW+LV+EQF+DLLV+ILL AA ISF+LAWF+  E++ TAFVEPFVILLILI NA+VGVWQE+NAE+AI+ALKEYE E  KV R++ K +Q IKA  +VPGDIVEV+VGDKVPADIRI+ I STTL++DQSILTGES SVIKH++ + D  AVNQDK NMLFSGTN+A+GK  G+V + G+ TEIGKIRDQ+  T+Q KTPL +KLD F EQLSKVI++IC+ VWLINIGHFNDP+HGGS  RGAIYYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V +MFI+  V+ D   + EF I+GS Y+P+G++   +K V+      L E+A IC+LCNDSS++FNE+KGVYEKVGEATETAL  LVEKMN+ N +  + SK + +  CNS I+  + KEFTLEFSRDRKSMS + SP            +    G ++ VKGAPEG++DRC +VR    RV +T  +K++IM  +  +GTG+DTLRCLALA  D P  R  M   ++  F +YE+++TFVG+VGMLDPPR EV  SI  CR+AGIRVI+ITGDNK TA AICRRIGIFGE+E    ++YTGREFD L   EQR A R A  FARVEP+HKSKI+E+LQ   EI+AMTGDGVNDAPALKKAEIGIAMGSGTAVAK+AS+MVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSN+GEVVCIFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM+RPPRSPKE LISGWLFFRYMAIG YVGAATVG+AAWWF+ + +GP V+Y QLTH +QC  +   F G+DC+VF   +PMTMALSVLV IEM NALNSLSENQSL++MPPW NIWL+ +I LSMSLHFLIL V  L  +F++  L  ++WL V+K S PV+ LDE LK ++RN
Sbjct:    1 MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGLNELPAEEGKTLWELVIEQFEDLLVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILIANAIVGVWQERNAENAIEALKEYEPEMGKVYRADRKSVQRIKARDIVPGDIVEVAVGDKVPADIRILAIKSTTLRVDQSILTGESVSVIKHTEPVPDPRAVNQDKKNMLFSGTNIAAGKALGIVATTGVGTEIGKIRDQMAATEQDKTPLQQKLDEFGEQLSKVISLICVAVWLINIGHFNDPVHGGSWFRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCKMFIIDKVDGDICLLNEFSITGSTYAPEGEVLKNDKPVRPGQYDGLVELATICALCNDSSLDFNEAKGVYEKVGEATETALTTLVEKMNVFNTDVRSLSKVERANACNSVIRQLMKKEFTLEFSRDRKSMSVYCSPAK---------SSRAAVGNKMFVKGAPEGVIDRCNYVRVGTTRVPLTGPVKEKIMAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLEYETDLTFVGVVGMLDPPRKEVTGSIQLCRDAGIRVIMITGDNKGTAIAICRRIGIFGENEEVADRAYTGREFDDLPLAEQREACRRACCFARVEPSHKSKIVEYLQSYDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRPPRSPKEPLISGWLFFRYMAIGGYVGAATVGAAAWWFLYAEDGPHVNYSQLTHFMQCTEDNTHFEGIDCEVFEAPEPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWVNIWLLGSICLSMSLHFLILYVDPLPMIFKLRALDLTQWLMVLKISLPVIGLDEILKFVARN 990          
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Match: ATP2A1 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1 [Source:HGNC Symbol;Acc:HGNC:811])

HSP 1 Score: 1312.36 bits (3395), Expect = 0.000e+0
Identity = 676/999 (67.67%), Postives = 804/999 (80.48%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRN 3080
            M+ AH+K+  + L +F VS+  GLT  Q++ + E YG+N LP EEGK LW+LV+EQF+DLLV+ILL AA ISF+LAWF+  E++ TAFVEPFVILLILI NA+VGVWQE+NAE+AI+ALKEYE E  KV R++ K +Q IKA  +VPGDIVEV+VGDKVPADIRI+ I STTL++DQSILTGES SVIKH++ + D  AVNQDK NMLFSGTN+A+GK  G+V + G+ TEIGKIRDQ+  T+Q KTPL +KLD F EQLSKVI++IC+ VWLINIGHFNDP+HGGS  RGAIYYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V +MFI+  V+ D   + EF I+GS Y+P+G++   +K V+      L E+A IC+LCNDSS++FNE+KGVYEKVGEATETAL  LVEKMN+ N +  + SK + +  CNS I+  + KEFTLEFSRDRKSMS + SP            +    G ++ VKGAPEG++DRC +VR    RV +T  +K++IM  +  +GTG+DTLRCLALA  D P  R  M   ++  F +YE+++TFVG+VGMLDPPR EV  SI  CR+AGIRVI+ITGDNK TA AICRRIGIFGE+E    ++YTGREFD L   EQR A R A  FARVEP+HKSKI+E+LQ   EI+AMTGDGVNDAPALKKAEIGIAMGSGTAVAK+AS+MVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSN+GEVVCIFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM+RPPRSPKE LISGWLFFRYMAIG YVGAATVG+AAWWF+ + +GP V+Y QLTH +QC  +   F G+DC+VF   +PMTMALSVLV IEM NALNSLSENQSL++MPPW NIWL+ +I LSMSLHFLIL V  L  +F++  L  ++WL V+K S PV+ LDE LK ++RN
Sbjct:    1 MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGLNELPAEEGKTLWELVIEQFEDLLVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILIANAIVGVWQERNAENAIEALKEYEPEMGKVYRADRKSVQRIKARDIVPGDIVEVAVGDKVPADIRILAIKSTTLRVDQSILTGESVSVIKHTEPVPDPRAVNQDKKNMLFSGTNIAAGKALGIVATTGVGTEIGKIRDQMAATEQDKTPLQQKLDEFGEQLSKVISLICVAVWLINIGHFNDPVHGGSWFRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCKMFIIDKVDGDICLLNEFSITGSTYAPEGEVLKNDKPVRPGQYDGLVELATICALCNDSSLDFNEAKGVYEKVGEATETALTTLVEKMNVFNTDVRSLSKVERANACNSVIRQLMKKEFTLEFSRDRKSMSVYCSPAK---------SSRAAVGNKMFVKGAPEGVIDRCNYVRVGTTRVPLTGPVKEKIMAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLEYETDLTFVGVVGMLDPPRKEVTGSIQLCRDAGIRVIMITGDNKGTAIAICRRIGIFGENEEVADRAYTGREFDDLPLAEQREACRRACCFARVEPSHKSKIVEYLQSYDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRPPRSPKEPLISGWLFFRYMAIGGYVGAATVGAAAWWFLYAEDGPHVNYSQLTHFMQCTEDNTHFEGIDCEVFEAPEPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWVNIWLLGSICLSMSLHFLILYVDPLPMIFKLRALDLTQWLMVLKISLPVIGLDEILKFVARN 990          
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Match: ATP2A3 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 3 [Source:HGNC Symbol;Acc:HGNC:813])

HSP 1 Score: 1280 bits (3311), Expect = 0.000e+0
Identity = 639/1005 (63.58%), Postives = 788/1005 (78.41%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRNQQHRKS 3098
            M+ AH     DVL  F V+ E GL+  Q+  ++E YG N LP EEGK LW+LVLEQF+DLLV+ILL AA++SF+LAWF+  E++TTAFVEP VI+LIL+ NA+VGVWQE+NAESAI+ALKEYE E  KVIRS+ KG+Q I+A  +VPGDIVEV+VGDKVPAD+R+++I STTL++DQSILTGES SV KH++ I D  AVNQDK NMLFSGTN+ SGK  GV  + GL+TE+GKIR Q+   +  +TPL +KLD F  QLS  I+VIC+ VW+INIGHF DP HGGS LRGA+YYFKIAVALAVAAIPEGLPAVITTCL+LGT RMA+KNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V RMF+V   +     + EF ISG+ Y+P+G++   ++ V+C     L E+A IC+LCNDS++++NE+KGVYEKVGEATETAL CLVEKMN+ + +    S+ + +  CN+ I+  + KEFTLEFSRDRKSMS + +P  P    Q         G ++ VKGAPE +++RC+ VR       +T + ++QI+ K+  +G+G DTLRCLALA  D P  +  M+  +   F +YE+++TFVG VGMLDPPR EV   I  C  AGIRV++ITGDNK TA AICRR+GIFG+ E   GK+YTGREFD LS  +QR A R A  FARVEPAHKS+I+E+LQ   EI+AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSA++MVL+DDNF++IVAAVEEGRAIY+NMKQFIRYLISSN+GEVVCIFLTA LG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIME+ PRSP+E+LISGWLFFRY+AIG YVG ATV +A WWF+    GP +++YQL + L+C+ +   F G+DC+VF    P TMALSVLV IEM NALNS+SENQSL++MPPW N WL++A+ +SM+LHFLIL V  L  +FQ++PLS  +W+ V++ S PV+LLDE+LK +SRN  H  S
Sbjct:    1 MEAAHLLPAADVLRHFSVTAEGGLSPAQVTGARERYGPNELPSEEGKSLWELVLEQFEDLLVRILLLAALVSFVLAWFEEGEETTTAFVEPLVIMLILVANAIVGVWQERNAESAIEALKEYEPEMGKVIRSDRKGVQRIRARDIVPGDIVEVAVGDKVPADLRLIEIKSTTLRVDQSILTGESVSVTKHTEAIPDPRAVNQDKKNMLFSGTNITSGKAVGVAVATGLHTELGKIRSQMAAVEPERTPLQRKLDEFGRQLSHAISVICVAVWVINIGHFADPAHGGSWLRGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMARKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFVVAEADAGSCLLHEFTISGTTYTPEGEVRQGDQPVRCGQFDGLVELATICALCNDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTDLQALSRVERAGACNTVIKQLMRKEFTLEFSRDRKSMSVYCTPTRPHPTGQ---------GSKMFVKGAPESVIERCSSVRVGSRTAPLTPTSREQILAKIRDWGSGSDTLRCLALATRDAPPRKEDMELDDCSKFVQYETDLTFVGCVGMLDPPRPEVAACITRCYQAGIRVVMITGDNKGTAVAICRRLGIFGDTEDVAGKAYTGREFDDLSPEQQRQACRTARCFARVEPAHKSRIVENLQSFNEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLSDDNFASIVAAVEEGRAIYSNMKQFIRYLISSNVGEVVCIFLTAILGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKLPRSPREALISGWLFFRYLAIGVYVGLATVAAATWWFVYDAEGPHINFYQLRNFLKCSEDNPLFAGIDCEVFESRFPTTMALSVLVTIEMCNALNSVSENQSLLRMPPWMNPWLLVAVAMSMALHFLILLVPPLPLIFQVTPLSGRQWVVVLQISLPVILLDEALKYLSRNHMHEMS 996          
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Match: sca-1 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:Q9XU13])

HSP 1 Score: 1318.14 bits (3410), Expect = 0.000e+0
Identity = 671/1004 (66.83%), Postives = 800/1004 (79.68%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDST---TAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVK--CSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRN 3080
            M++AH+K  ++V  FF    E GLT +Q+E  +  YG N +P EEGK LW+L+LEQFDDLLVKILL AAIISF+LA F+  ED T   TAFVEPFVILLILI NA VGVWQE+NAESAI+ALKEYE E AKVIRS H GIQ ++A +LVPGD+VEVSVGDK+PAD+R+VKI+STT++IDQSILTGES SVIKH+D + D  AVNQDK N LFSGTNVASGK RG+V   GL TEIGKIR ++  T+  KTPL +KLD F EQLSKVI+VIC+ VW INIGHFNDP HGGS ++GAIYYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+VS+MFI    + D  +  EF ISGS Y P G +    + +     +   L E+A IC++CNDSSV++NE+K +YEKVGEATETAL+ L EKMN+   +K+  S K+L  VCN  IQ    KEFTLEFSRDRKSMSA+  P +              +G ++ VKGAPEG+L RCT VR +  +V +T+++  +I+ +   YGTG+DTLRCLAL  +D PVS S M+  ++  F KYE ++TFVG+VGMLDPPR+EV DSI AC +AGIRVI+ITGDNK TAEAI RRIG+FGE+E T GK+YTGREFD L   +Q  A R A LFARVEP+HKSKI++ LQ  GEI+AMTGDGVNDAPALKKAEIGI+MGSGTAVAKSAS+MVLADDNF++IV+AVEEGRAIYNNMKQFIRYLISSN+GEVV IF+ AALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM+R PRS  + LISGWLFFRY+A+G YVG ATVG++ WWF+    GP ++YYQLTH ++C  EP++F  +DC VF  + P  MALSVLV IEMLNA+NSLSENQSL+ MPPW+NIWL+ AI+LSMSLHF+IL V  ++ +FQI+PL++ EW+ V+K S PVLLLDE LK I+RN
Sbjct:    1 MEDAHAKDANEVCKFFGTGPE-GLTPQQVETLRNKYGENEMPAEEGKSLWELILEQFDDLLVKILLLAAIISFVLALFEEHEDQTEAVTAFVEPFVILLILIANATVGVWQERNAESAIEALKEYEPEMAKVIRSGHHGIQMVRAKELVPGDLVEVSVGDKIPADLRLVKIYSTTIRIDQSILTGESVSVIKHTDSVPDPRAVNQDKKNCLFSGTNVASGKARGIVFGTGLTTEIGKIRTEMAETENEKTPLQQKLDEFGEQLSKVISVICVAVWAINIGHFNDPAHGGSWVKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSKMFIAGQASGDNINFTEFAISGSTYEPVGKVSTNGREINPAAGEFESLTELAMICAMCNDSSVDYNETKKIYEKVGEATETALIVLAEKMNVFGTSKAGLSPKELGGVCNRVIQQKWKKEFTLEFSRDRKSMSAYCFPAS------------GGSGAKMFVKGAPEGVLGRCTHVRVNGQKVPLTSAMTQKIVDQCVQYGTGRDTLRCLALGTIDTPVSVSNMNLEDSTQFVKYEQDITFVGVVGMLDPPRTEVSDSIKACNHAGIRVIMITGDNKNTAEAIGRRIGLFGENEDTTGKAYTGREFDDLPPEQQSEACRRAKLFARVEPSHKSKIVDILQSQGEITAMTGDGVNDAPALKKAEIGISMGSGTAVAKSASEMVLADDNFASIVSAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFMVAALGIPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRHPRSANDGLISGWLFFRYLAVGTYVGVATVGASMWWFLLYEEGPQITYYQLTHWMRCEIEPDNFADLDCAVFEDNHPNAMALSVLVTIEMLNAINSLSENQSLLVMPPWKNIWLMAAISLSMSLHFVILYVDIMATIFQITPLNWVEWIAVLKISLPVLLLDEILKFIARN 991          
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Match: sca-1 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:Q9XU13])

HSP 1 Score: 1318.14 bits (3410), Expect = 0.000e+0
Identity = 671/1004 (66.83%), Postives = 800/1004 (79.68%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDST---TAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVK--CSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRN 3080
            M++AH+K  ++V  FF    E GLT +Q+E  +  YG N +P EEGK LW+L+LEQFDDLLVKILL AAIISF+LA F+  ED T   TAFVEPFVILLILI NA VGVWQE+NAESAI+ALKEYE E AKVIRS H GIQ ++A +LVPGD+VEVSVGDK+PAD+R+VKI+STT++IDQSILTGES SVIKH+D + D  AVNQDK N LFSGTNVASGK RG+V   GL TEIGKIR ++  T+  KTPL +KLD F EQLSKVI+VIC+ VW INIGHFNDP HGGS ++GAIYYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+VS+MFI    + D  +  EF ISGS Y P G +    + +     +   L E+A IC++CNDSSV++NE+K +YEKVGEATETAL+ L EKMN+   +K+  S K+L  VCN  IQ    KEFTLEFSRDRKSMSA+  P +              +G ++ VKGAPEG+L RCT VR +  +V +T+++  +I+ +   YGTG+DTLRCLAL  +D PVS S M+  ++  F KYE ++TFVG+VGMLDPPR+EV DSI AC +AGIRVI+ITGDNK TAEAI RRIG+FGE+E T GK+YTGREFD L   +Q  A R A LFARVEP+HKSKI++ LQ  GEI+AMTGDGVNDAPALKKAEIGI+MGSGTAVAKSAS+MVLADDNF++IV+AVEEGRAIYNNMKQFIRYLISSN+GEVV IF+ AALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM+R PRS  + LISGWLFFRY+A+G YVG ATVG++ WWF+    GP ++YYQLTH ++C  EP++F  +DC VF  + P  MALSVLV IEMLNA+NSLSENQSL+ MPPW+NIWL+ AI+LSMSLHF+IL V  ++ +FQI+PL++ EW+ V+K S PVLLLDE LK I+RN
Sbjct:    1 MEDAHAKDANEVCKFFGTGPE-GLTPQQVETLRNKYGENEMPAEEGKSLWELILEQFDDLLVKILLLAAIISFVLALFEEHEDQTEAVTAFVEPFVILLILIANATVGVWQERNAESAIEALKEYEPEMAKVIRSGHHGIQMVRAKELVPGDLVEVSVGDKIPADLRLVKIYSTTIRIDQSILTGESVSVIKHTDSVPDPRAVNQDKKNCLFSGTNVASGKARGIVFGTGLTTEIGKIRTEMAETENEKTPLQQKLDEFGEQLSKVISVICVAVWAINIGHFNDPAHGGSWVKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSKMFIAGQASGDNINFTEFAISGSTYEPVGKVSTNGREINPAAGEFESLTELAMICAMCNDSSVDYNETKKIYEKVGEATETALIVLAEKMNVFGTSKAGLSPKELGGVCNRVIQQKWKKEFTLEFSRDRKSMSAYCFPAS------------GGSGAKMFVKGAPEGVLGRCTHVRVNGQKVPLTSAMTQKIVDQCVQYGTGRDTLRCLALGTIDTPVSVSNMNLEDSTQFVKYEQDITFVGVVGMLDPPRTEVSDSIKACNHAGIRVIMITGDNKNTAEAIGRRIGLFGENEDTTGKAYTGREFDDLPPEQQSEACRRAKLFARVEPSHKSKIVDILQSQGEITAMTGDGVNDAPALKKAEIGISMGSGTAVAKSASEMVLADDNFASIVSAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFMVAALGIPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRHPRSANDGLISGWLFFRYLAVGTYVGVATVGASMWWFLLYEEGPQITYYQLTHWMRCEIEPDNFADLDCAVFEDNHPNAMALSVLVTIEMLNAINSLSENQSLLVMPPWKNIWLMAAISLSMSLHFVILYVDIMATIFQITPLNWVEWIAVLKISLPVLLLDEILKFIARN 991          
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Match: sca-1 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:Q9XU13])

HSP 1 Score: 1318.14 bits (3410), Expect = 0.000e+0
Identity = 671/1004 (66.83%), Postives = 800/1004 (79.68%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDST---TAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVK--CSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRN 3080
            M++AH+K  ++V  FF    E GLT +Q+E  +  YG N +P EEGK LW+L+LEQFDDLLVKILL AAIISF+LA F+  ED T   TAFVEPFVILLILI NA VGVWQE+NAESAI+ALKEYE E AKVIRS H GIQ ++A +LVPGD+VEVSVGDK+PAD+R+VKI+STT++IDQSILTGES SVIKH+D + D  AVNQDK N LFSGTNVASGK RG+V   GL TEIGKIR ++  T+  KTPL +KLD F EQLSKVI+VIC+ VW INIGHFNDP HGGS ++GAIYYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+VS+MFI    + D  +  EF ISGS Y P G +    + +     +   L E+A IC++CNDSSV++NE+K +YEKVGEATETAL+ L EKMN+   +K+  S K+L  VCN  IQ    KEFTLEFSRDRKSMSA+  P +              +G ++ VKGAPEG+L RCT VR +  +V +T+++  +I+ +   YGTG+DTLRCLAL  +D PVS S M+  ++  F KYE ++TFVG+VGMLDPPR+EV DSI AC +AGIRVI+ITGDNK TAEAI RRIG+FGE+E T GK+YTGREFD L   +Q  A R A LFARVEP+HKSKI++ LQ  GEI+AMTGDGVNDAPALKKAEIGI+MGSGTAVAKSAS+MVLADDNF++IV+AVEEGRAIYNNMKQFIRYLISSN+GEVV IF+ AALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM+R PRS  + LISGWLFFRY+A+G YVG ATVG++ WWF+    GP ++YYQLTH ++C  EP++F  +DC VF  + P  MALSVLV IEMLNA+NSLSENQSL+ MPPW+NIWL+ AI+LSMSLHF+IL V  ++ +FQI+PL++ EW+ V+K S PVLLLDE LK I+RN
Sbjct:    1 MEDAHAKDANEVCKFFGTGPE-GLTPQQVETLRNKYGENEMPAEEGKSLWELILEQFDDLLVKILLLAAIISFVLALFEEHEDQTEAVTAFVEPFVILLILIANATVGVWQERNAESAIEALKEYEPEMAKVIRSGHHGIQMVRAKELVPGDLVEVSVGDKIPADLRLVKIYSTTIRIDQSILTGESVSVIKHTDSVPDPRAVNQDKKNCLFSGTNVASGKARGIVFGTGLTTEIGKIRTEMAETENEKTPLQQKLDEFGEQLSKVISVICVAVWAINIGHFNDPAHGGSWVKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSKMFIAGQASGDNINFTEFAISGSTYEPVGKVSTNGREINPAAGEFESLTELAMICAMCNDSSVDYNETKKIYEKVGEATETALIVLAEKMNVFGTSKAGLSPKELGGVCNRVIQQKWKKEFTLEFSRDRKSMSAYCFPAS------------GGSGAKMFVKGAPEGVLGRCTHVRVNGQKVPLTSAMTQKIVDQCVQYGTGRDTLRCLALGTIDTPVSVSNMNLEDSTQFVKYEQDITFVGVVGMLDPPRTEVSDSIKACNHAGIRVIMITGDNKNTAEAIGRRIGLFGENEDTTGKAYTGREFDDLPPEQQSEACRRAKLFARVEPSHKSKIVDILQSQGEITAMTGDGVNDAPALKKAEIGISMGSGTAVAKSASEMVLADDNFASIVSAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFMVAALGIPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRHPRSANDGLISGWLFFRYLAVGTYVGVATVGASMWWFLLYEEGPQITYYQLTHWMRCEIEPDNFADLDCAVFEDNHPNAMALSVLVTIEMLNAINSLSENQSLLVMPPWKNIWLMAAISLSMSLHFVILYVDIMATIFQITPLNWVEWIAVLKISLPVLLLDEILKFIARN 991          
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Match: sca-1 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:Q9XU13])

HSP 1 Score: 1318.14 bits (3410), Expect = 0.000e+0
Identity = 671/1004 (66.83%), Postives = 800/1004 (79.68%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDST---TAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVK--CSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRN 3080
            M++AH+K  ++V  FF    E GLT +Q+E  +  YG N +P EEGK LW+L+LEQFDDLLVKILL AAIISF+LA F+  ED T   TAFVEPFVILLILI NA VGVWQE+NAESAI+ALKEYE E AKVIRS H GIQ ++A +LVPGD+VEVSVGDK+PAD+R+VKI+STT++IDQSILTGES SVIKH+D + D  AVNQDK N LFSGTNVASGK RG+V   GL TEIGKIR ++  T+  KTPL +KLD F EQLSKVI+VIC+ VW INIGHFNDP HGGS ++GAIYYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+VS+MFI    + D  +  EF ISGS Y P G +    + +     +   L E+A IC++CNDSSV++NE+K +YEKVGEATETAL+ L EKMN+   +K+  S K+L  VCN  IQ    KEFTLEFSRDRKSMSA+  P +              +G ++ VKGAPEG+L RCT VR +  +V +T+++  +I+ +   YGTG+DTLRCLAL  +D PVS S M+  ++  F KYE ++TFVG+VGMLDPPR+EV DSI AC +AGIRVI+ITGDNK TAEAI RRIG+FGE+E T GK+YTGREFD L   +Q  A R A LFARVEP+HKSKI++ LQ  GEI+AMTGDGVNDAPALKKAEIGI+MGSGTAVAKSAS+MVLADDNF++IV+AVEEGRAIYNNMKQFIRYLISSN+GEVV IF+ AALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM+R PRS  + LISGWLFFRY+A+G YVG ATVG++ WWF+    GP ++YYQLTH ++C  EP++F  +DC VF  + P  MALSVLV IEMLNA+NSLSENQSL+ MPPW+NIWL+ AI+LSMSLHF+IL V  ++ +FQI+PL++ EW+ V+K S PVLLLDE LK I+RN
Sbjct:    1 MEDAHAKDANEVCKFFGTGPE-GLTPQQVETLRNKYGENEMPAEEGKSLWELILEQFDDLLVKILLLAAIISFVLALFEEHEDQTEAVTAFVEPFVILLILIANATVGVWQERNAESAIEALKEYEPEMAKVIRSGHHGIQMVRAKELVPGDLVEVSVGDKIPADLRLVKIYSTTIRIDQSILTGESVSVIKHTDSVPDPRAVNQDKKNCLFSGTNVASGKARGIVFGTGLTTEIGKIRTEMAETENEKTPLQQKLDEFGEQLSKVISVICVAVWAINIGHFNDPAHGGSWVKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSKMFIAGQASGDNINFTEFAISGSTYEPVGKVSTNGREINPAAGEFESLTELAMICAMCNDSSVDYNETKKIYEKVGEATETALIVLAEKMNVFGTSKAGLSPKELGGVCNRVIQQKWKKEFTLEFSRDRKSMSAYCFPAS------------GGSGAKMFVKGAPEGVLGRCTHVRVNGQKVPLTSAMTQKIVDQCVQYGTGRDTLRCLALGTIDTPVSVSNMNLEDSTQFVKYEQDITFVGVVGMLDPPRTEVSDSIKACNHAGIRVIMITGDNKNTAEAIGRRIGLFGENEDTTGKAYTGREFDDLPPEQQSEACRRAKLFARVEPSHKSKIVDILQSQGEITAMTGDGVNDAPALKKAEIGISMGSGTAVAKSASEMVLADDNFASIVSAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFMVAALGIPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRHPRSANDGLISGWLFFRYLAVGTYVGVATVGASMWWFLLYEEGPQITYYQLTHWMRCEIEPDNFADLDCAVFEDNHPNAMALSVLVTIEMLNAINSLSENQSLLVMPPWKNIWLMAAISLSMSLHFVILYVDIMATIFQITPLNWVEWIAVLKISLPVLLLDEILKFIARN 991          
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Match: sca-1 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:Q9XU13])

HSP 1 Score: 1194.1 bits (3088), Expect = 0.000e+0
Identity = 587/875 (67.09%), Postives = 701/875 (80.11%), Query Frame = 3
Query:  462 AKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVK--CSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRN 3080
            AKVIRS H GIQ ++A +LVPGD+VEVSVGDK+PAD+R+VKI+STT++IDQSILTGES SVIKH+D + D  AVNQDK N LFSGTNVASGK RG+V   GL TEIGKIR ++  T+  KTPL +KLD F EQLSKVI+VIC+ VW INIGHFNDP HGGS ++GAIYYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+VS+MFI    + D  +  EF ISGS Y P G +    + +     +   L E+A IC++CNDSSV++NE+K +YEKVGEATETAL+ L EKMN+   +K+  S K+L  VCN  IQ    KEFTLEFSRDRKSMSA+  P +              +G ++ VKGAPEG+L RCT VR +  +V +T+++  +I+ +   YGTG+DTLRCLAL  +D PVS S M+  ++  F KYE ++TFVG+VGMLDPPR+EV DSI AC +AGIRVI+ITGDNK TAEAI RRIG+FGE+E T GK+YTGREFD L   +Q  A R A LFARVEP+HKSKI++ LQ  GEI+AMTGDGVNDAPALKKAEIGI+MGSGTAVAKSAS+MVLADDNF++IV+AVEEGRAIYNNMKQFIRYLISSN+GEVV IF+ AALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM+R PRS  + LISGWLFFRY+A+G YVG ATVG++ WWF+    GP ++YYQLTH ++C  EP++F  +DC VF  + P  MALSVLV IEMLNA+NSLSENQSL+ MPPW+NIWL+ AI+LSMSLHF+IL V  ++ +FQI+PL++ EW+ V+K S PVLLLDE LK I+RN
Sbjct:    2 AKVIRSGHHGIQMVRAKELVPGDLVEVSVGDKIPADLRLVKIYSTTIRIDQSILTGESVSVIKHTDSVPDPRAVNQDKKNCLFSGTNVASGKARGIVFGTGLTTEIGKIRTEMAETENEKTPLQQKLDEFGEQLSKVISVICVAVWAINIGHFNDPAHGGSWVKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSKMFIAGQASGDNINFTEFAISGSTYEPVGKVSTNGREINPAAGEFESLTELAMICAMCNDSSVDYNETKKIYEKVGEATETALIVLAEKMNVFGTSKAGLSPKELGGVCNRVIQQKWKKEFTLEFSRDRKSMSAYCFPAS------------GGSGAKMFVKGAPEGVLGRCTHVRVNGQKVPLTSAMTQKIVDQCVQYGTGRDTLRCLALGTIDTPVSVSNMNLEDSTQFVKYEQDITFVGVVGMLDPPRTEVSDSIKACNHAGIRVIMITGDNKNTAEAIGRRIGLFGENEDTTGKAYTGREFDDLPPEQQSEACRRAKLFARVEPSHKSKIVDILQSQGEITAMTGDGVNDAPALKKAEIGISMGSGTAVAKSASEMVLADDNFASIVSAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFMVAALGIPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRHPRSANDGLISGWLFFRYLAVGTYVGVATVGASMWWFLLYEEGPQITYYQLTHWMRCEIEPDNFADLDCAVFEDNHPNAMALSVLVTIEMLNAINSLSENQSLLVMPPWKNIWLMAAISLSMSLHFVILYVDIMATIFQITPLNWVEWIAVLKISLPVLLLDEILKFIARN 864          
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Match: SERCA (gene:FBgn0263006 transcript:FBtr0072216)

HSP 1 Score: 1339.71 bits (3466), Expect = 0.000e+0
Identity = 690/1020 (67.65%), Postives = 815/1020 (79.90%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRNQQHRKSIFTNCHLIVLMWGLF 3143
            M++ HSK+V   L+FF    E GLT  QI+ +Q+ YG N LP EEGK +W+LVLEQFDDLLVKILL AAIISF+LA F+  E++ TAFVEP VILLILI NAVVGVWQE+NAESAI+ALKEYE E  KV+R +  GIQ ++A ++VPGD+VEVSVGDK+PADIRI  I+STTL+IDQSILTGES SVIKH+D I D  AVNQDK N+LFSGTNVA+GK RGVV   GL+T IGKIR ++  T+++KTPL +KLD F EQLSKVI+VIC+ VW INIGHFNDP HGGS ++GAIYYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+VSRMFI   V  + +   EFE++GS Y P G++F   +R+K +D   L E++ IC +CNDS++++NE K  +EKVGEATETAL+ L EK+N  ++NKS   ++  +  C  +I++   KEFTLEFSRDRKSMS++ +P+           +   TGP+L VKGAPEG+L+RCT  R    +V +T+++K +I+     YGTG+DTLRCLALA  D P+    MD  ++  FY+YE N+TFVG+VGMLDPPR EV DSI  CR AGIRVIVITGDNKATAEAICRRIG+F EDE T GKSY+GREFD LS  EQ+ AV  + LF+RVEP HKSKI+E LQ   EISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSA++MVLADDNFS+IV+AVEEGRAIYNNMKQFIRYLISSNIGEVV IFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIME+PPR   E LISGWLFFRYMAIG YVGAATVG+AAWWF+ S  GP +SY+QLTHHL C    ++F GVDCK+F     MTMALSVLV IEMLNA+NSLSENQSL+ MPPW N+WLI ++ LS +LHF+IL V  LS VFQ++PLS  EW+TVMKFS PV+LLDE+LK ++R     +S     H IVLMW +F
Sbjct:    1 MEDGHSKTVEQSLNFFGTDPERGLTLDQIKANQKKYGPNELPTEEGKSIWQLVLEQFDDLLVKILLLAAIISFVLALFEEHEETFTAFVEPLVILLILIANAVVGVWQERNAESAIEALKEYEPEMGKVVRQDKSGIQKVRAKEIVPGDLVEVSVGDKIPADIRITHIYSTTLRIDQSILTGESVSVIKHTDAIPDPRAVNQDKKNILFSGTNVAAGKARGVVIGTGLSTAIGKIRTEMSETEEIKTPLQQKLDEFGEQLSKVISVICVAVWAINIGHFNDPAHGGSWIKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRMFIFDKVEGNDSSFLEFEMTGSTYEPIGEVFLNGQRIKAADYDTLQELSTICIMCNDSAIDYNEFKQAFEKVGEATETALIVLAEKLNSFSVNKSGLDRRSAAIACRGEIETKWKKEFTLEFSRDRKSMSSYCTPLKA---------SRLGTGPKLFVKGAPEGVLERCTHARVGTTKVPLTSALKAKILALTGQYGTGRDTLRCLALAVADSPMKPDEMDLGDSTKFYQYEVNLTFVGVVGMLDPPRKEVFDSIVRCRAAGIRVIVITGDNKATAEAICRRIGVFAEDEDTTGKSYSGREFDDLSPTEQKAAVARSRLFSRVEPQHKSKIVEFLQSMNEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLADDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKPPRKADEGLISGWLFFRYMAIGFYVGAATVGAAAWWFVFSDEGPKLSYWQLTHHLSCLGGGDEFKGVDCKIFSDPHAMTMALSVLVTIEMLNAMNSLSENQSLITMPPWCNLWLIGSMALSFTLHFVILYVDVLSTVFQVTPLSAEEWITVMKFSIPVVLLDETLKFVARKIADGESPIYKMHGIVLMWAVF 1011          
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Match: SERCA (gene:FBgn0263006 transcript:FBtr0072211)

HSP 1 Score: 1339.71 bits (3466), Expect = 0.000e+0
Identity = 690/1020 (67.65%), Postives = 815/1020 (79.90%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRNQQHRKSIFTNCHLIVLMWGLF 3143
            M++ HSK+V   L+FF    E GLT  QI+ +Q+ YG N LP EEGK +W+LVLEQFDDLLVKILL AAIISF+LA F+  E++ TAFVEP VILLILI NAVVGVWQE+NAESAI+ALKEYE E  KV+R +  GIQ ++A ++VPGD+VEVSVGDK+PADIRI  I+STTL+IDQSILTGES SVIKH+D I D  AVNQDK N+LFSGTNVA+GK RGVV   GL+T IGKIR ++  T+++KTPL +KLD F EQLSKVI+VIC+ VW INIGHFNDP HGGS ++GAIYYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+VSRMFI   V  + +   EFE++GS Y P G++F   +R+K +D   L E++ IC +CNDS++++NE K  +EKVGEATETAL+ L EK+N  ++NKS   ++  +  C  +I++   KEFTLEFSRDRKSMS++ +P+           +   TGP+L VKGAPEG+L+RCT  R    +V +T+++K +I+     YGTG+DTLRCLALA  D P+    MD  ++  FY+YE N+TFVG+VGMLDPPR EV DSI  CR AGIRVIVITGDNKATAEAICRRIG+F EDE T GKSY+GREFD LS  EQ+ AV  + LF+RVEP HKSKI+E LQ   EISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSA++MVLADDNFS+IV+AVEEGRAIYNNMKQFIRYLISSNIGEVV IFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIME+PPR   E LISGWLFFRYMAIG YVGAATVG+AAWWF+ S  GP +SY+QLTHHL C    ++F GVDCK+F     MTMALSVLV IEMLNA+NSLSENQSL+ MPPW N+WLI ++ LS +LHF+IL V  LS VFQ++PLS  EW+TVMKFS PV+LLDE+LK ++R     +S     H IVLMW +F
Sbjct:    1 MEDGHSKTVEQSLNFFGTDPERGLTLDQIKANQKKYGPNELPTEEGKSIWQLVLEQFDDLLVKILLLAAIISFVLALFEEHEETFTAFVEPLVILLILIANAVVGVWQERNAESAIEALKEYEPEMGKVVRQDKSGIQKVRAKEIVPGDLVEVSVGDKIPADIRITHIYSTTLRIDQSILTGESVSVIKHTDAIPDPRAVNQDKKNILFSGTNVAAGKARGVVIGTGLSTAIGKIRTEMSETEEIKTPLQQKLDEFGEQLSKVISVICVAVWAINIGHFNDPAHGGSWIKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRMFIFDKVEGNDSSFLEFEMTGSTYEPIGEVFLNGQRIKAADYDTLQELSTICIMCNDSAIDYNEFKQAFEKVGEATETALIVLAEKLNSFSVNKSGLDRRSAAIACRGEIETKWKKEFTLEFSRDRKSMSSYCTPLKA---------SRLGTGPKLFVKGAPEGVLERCTHARVGTTKVPLTSALKAKILALTGQYGTGRDTLRCLALAVADSPMKPDEMDLGDSTKFYQYEVNLTFVGVVGMLDPPRKEVFDSIVRCRAAGIRVIVITGDNKATAEAICRRIGVFAEDEDTTGKSYSGREFDDLSPTEQKAAVARSRLFSRVEPQHKSKIVEFLQSMNEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLADDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKPPRKADEGLISGWLFFRYMAIGFYVGAATVGAAAWWFVFSDEGPKLSYWQLTHHLSCLGGGDEFKGVDCKIFSDPHAMTMALSVLVTIEMLNAMNSLSENQSLITMPPWCNLWLIGSMALSFTLHFVILYVDVLSTVFQVTPLSAEEWITVMKFSIPVVLLDETLKFVARKIADGESPIYKMHGIVLMWAVF 1011          
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Match: SERCA (gene:FBgn0263006 transcript:FBtr0072214)

HSP 1 Score: 1339.71 bits (3466), Expect = 0.000e+0
Identity = 690/1020 (67.65%), Postives = 815/1020 (79.90%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRNQQHRKSIFTNCHLIVLMWGLF 3143
            M++ HSK+V   L+FF    E GLT  QI+ +Q+ YG N LP EEGK +W+LVLEQFDDLLVKILL AAIISF+LA F+  E++ TAFVEP VILLILI NAVVGVWQE+NAESAI+ALKEYE E  KV+R +  GIQ ++A ++VPGD+VEVSVGDK+PADIRI  I+STTL+IDQSILTGES SVIKH+D I D  AVNQDK N+LFSGTNVA+GK RGVV   GL+T IGKIR ++  T+++KTPL +KLD F EQLSKVI+VIC+ VW INIGHFNDP HGGS ++GAIYYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+VSRMFI   V  + +   EFE++GS Y P G++F   +R+K +D   L E++ IC +CNDS++++NE K  +EKVGEATETAL+ L EK+N  ++NKS   ++  +  C  +I++   KEFTLEFSRDRKSMS++ +P+           +   TGP+L VKGAPEG+L+RCT  R    +V +T+++K +I+     YGTG+DTLRCLALA  D P+    MD  ++  FY+YE N+TFVG+VGMLDPPR EV DSI  CR AGIRVIVITGDNKATAEAICRRIG+F EDE T GKSY+GREFD LS  EQ+ AV  + LF+RVEP HKSKI+E LQ   EISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSA++MVLADDNFS+IV+AVEEGRAIYNNMKQFIRYLISSNIGEVV IFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIME+PPR   E LISGWLFFRYMAIG YVGAATVG+AAWWF+ S  GP +SY+QLTHHL C    ++F GVDCK+F     MTMALSVLV IEMLNA+NSLSENQSL+ MPPW N+WLI ++ LS +LHF+IL V  LS VFQ++PLS  EW+TVMKFS PV+LLDE+LK ++R     +S     H IVLMW +F
Sbjct:    1 MEDGHSKTVEQSLNFFGTDPERGLTLDQIKANQKKYGPNELPTEEGKSIWQLVLEQFDDLLVKILLLAAIISFVLALFEEHEETFTAFVEPLVILLILIANAVVGVWQERNAESAIEALKEYEPEMGKVVRQDKSGIQKVRAKEIVPGDLVEVSVGDKIPADIRITHIYSTTLRIDQSILTGESVSVIKHTDAIPDPRAVNQDKKNILFSGTNVAAGKARGVVIGTGLSTAIGKIRTEMSETEEIKTPLQQKLDEFGEQLSKVISVICVAVWAINIGHFNDPAHGGSWIKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRMFIFDKVEGNDSSFLEFEMTGSTYEPIGEVFLNGQRIKAADYDTLQELSTICIMCNDSAIDYNEFKQAFEKVGEATETALIVLAEKLNSFSVNKSGLDRRSAAIACRGEIETKWKKEFTLEFSRDRKSMSSYCTPLKA---------SRLGTGPKLFVKGAPEGVLERCTHARVGTTKVPLTSALKAKILALTGQYGTGRDTLRCLALAVADSPMKPDEMDLGDSTKFYQYEVNLTFVGVVGMLDPPRKEVFDSIVRCRAAGIRVIVITGDNKATAEAICRRIGVFAEDEDTTGKSYSGREFDDLSPTEQKAAVARSRLFSRVEPQHKSKIVEFLQSMNEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLADDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKPPRKADEGLISGWLFFRYMAIGFYVGAATVGAAAWWFVFSDEGPKLSYWQLTHHLSCLGGGDEFKGVDCKIFSDPHAMTMALSVLVTIEMLNAMNSLSENQSLITMPPWCNLWLIGSMALSFTLHFVILYVDVLSTVFQVTPLSAEEWITVMKFSIPVVLLDETLKFVARKIADGESPIYKMHGIVLMWAVF 1011          
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Match: SERCA (gene:FBgn0263006 transcript:FBtr0072212)

HSP 1 Score: 1339.71 bits (3466), Expect = 0.000e+0
Identity = 690/1020 (67.65%), Postives = 815/1020 (79.90%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRNQQHRKSIFTNCHLIVLMWGLF 3143
            M++ HSK+V   L+FF    E GLT  QI+ +Q+ YG N LP EEGK +W+LVLEQFDDLLVKILL AAIISF+LA F+  E++ TAFVEP VILLILI NAVVGVWQE+NAESAI+ALKEYE E  KV+R +  GIQ ++A ++VPGD+VEVSVGDK+PADIRI  I+STTL+IDQSILTGES SVIKH+D I D  AVNQDK N+LFSGTNVA+GK RGVV   GL+T IGKIR ++  T+++KTPL +KLD F EQLSKVI+VIC+ VW INIGHFNDP HGGS ++GAIYYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+VSRMFI   V  + +   EFE++GS Y P G++F   +R+K +D   L E++ IC +CNDS++++NE K  +EKVGEATETAL+ L EK+N  ++NKS   ++  +  C  +I++   KEFTLEFSRDRKSMS++ +P+           +   TGP+L VKGAPEG+L+RCT  R    +V +T+++K +I+     YGTG+DTLRCLALA  D P+    MD  ++  FY+YE N+TFVG+VGMLDPPR EV DSI  CR AGIRVIVITGDNKATAEAICRRIG+F EDE T GKSY+GREFD LS  EQ+ AV  + LF+RVEP HKSKI+E LQ   EISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSA++MVLADDNFS+IV+AVEEGRAIYNNMKQFIRYLISSNIGEVV IFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIME+PPR   E LISGWLFFRYMAIG YVGAATVG+AAWWF+ S  GP +SY+QLTHHL C    ++F GVDCK+F     MTMALSVLV IEMLNA+NSLSENQSL+ MPPW N+WLI ++ LS +LHF+IL V  LS VFQ++PLS  EW+TVMKFS PV+LLDE+LK ++R     +S     H IVLMW +F
Sbjct:    1 MEDGHSKTVEQSLNFFGTDPERGLTLDQIKANQKKYGPNELPTEEGKSIWQLVLEQFDDLLVKILLLAAIISFVLALFEEHEETFTAFVEPLVILLILIANAVVGVWQERNAESAIEALKEYEPEMGKVVRQDKSGIQKVRAKEIVPGDLVEVSVGDKIPADIRITHIYSTTLRIDQSILTGESVSVIKHTDAIPDPRAVNQDKKNILFSGTNVAAGKARGVVIGTGLSTAIGKIRTEMSETEEIKTPLQQKLDEFGEQLSKVISVICVAVWAINIGHFNDPAHGGSWIKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRMFIFDKVEGNDSSFLEFEMTGSTYEPIGEVFLNGQRIKAADYDTLQELSTICIMCNDSAIDYNEFKQAFEKVGEATETALIVLAEKLNSFSVNKSGLDRRSAAIACRGEIETKWKKEFTLEFSRDRKSMSSYCTPLKA---------SRLGTGPKLFVKGAPEGVLERCTHARVGTTKVPLTSALKAKILALTGQYGTGRDTLRCLALAVADSPMKPDEMDLGDSTKFYQYEVNLTFVGVVGMLDPPRKEVFDSIVRCRAAGIRVIVITGDNKATAEAICRRIGVFAEDEDTTGKSYSGREFDDLSPTEQKAAVARSRLFSRVEPQHKSKIVEFLQSMNEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLADDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKPPRKADEGLISGWLFFRYMAIGFYVGAATVGAAAWWFVFSDEGPKLSYWQLTHHLSCLGGGDEFKGVDCKIFSDPHAMTMALSVLVTIEMLNAMNSLSENQSLITMPPWCNLWLIGSMALSFTLHFVILYVDVLSTVFQVTPLSAEEWITVMKFSIPVVLLDETLKFVARKIADGESPIYKMHGIVLMWAVF 1011          
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Match: SERCA (gene:FBgn0263006 transcript:FBtr0072217)

HSP 1 Score: 1339.71 bits (3466), Expect = 0.000e+0
Identity = 690/1020 (67.65%), Postives = 815/1020 (79.90%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRNQQHRKSIFTNCHLIVLMWGLF 3143
            M++ HSK+V   L+FF    E GLT  QI+ +Q+ YG N LP EEGK +W+LVLEQFDDLLVKILL AAIISF+LA F+  E++ TAFVEP VILLILI NAVVGVWQE+NAESAI+ALKEYE E  KV+R +  GIQ ++A ++VPGD+VEVSVGDK+PADIRI  I+STTL+IDQSILTGES SVIKH+D I D  AVNQDK N+LFSGTNVA+GK RGVV   GL+T IGKIR ++  T+++KTPL +KLD F EQLSKVI+VIC+ VW INIGHFNDP HGGS ++GAIYYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+VSRMFI   V  + +   EFE++GS Y P G++F   +R+K +D   L E++ IC +CNDS++++NE K  +EKVGEATETAL+ L EK+N  ++NKS   ++  +  C  +I++   KEFTLEFSRDRKSMS++ +P+           +   TGP+L VKGAPEG+L+RCT  R    +V +T+++K +I+     YGTG+DTLRCLALA  D P+    MD  ++  FY+YE N+TFVG+VGMLDPPR EV DSI  CR AGIRVIVITGDNKATAEAICRRIG+F EDE T GKSY+GREFD LS  EQ+ AV  + LF+RVEP HKSKI+E LQ   EISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSA++MVLADDNFS+IV+AVEEGRAIYNNMKQFIRYLISSNIGEVV IFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIME+PPR   E LISGWLFFRYMAIG YVGAATVG+AAWWF+ S  GP +SY+QLTHHL C    ++F GVDCK+F     MTMALSVLV IEMLNA+NSLSENQSL+ MPPW N+WLI ++ LS +LHF+IL V  LS VFQ++PLS  EW+TVMKFS PV+LLDE+LK ++R     +S     H IVLMW +F
Sbjct:    1 MEDGHSKTVEQSLNFFGTDPERGLTLDQIKANQKKYGPNELPTEEGKSIWQLVLEQFDDLLVKILLLAAIISFVLALFEEHEETFTAFVEPLVILLILIANAVVGVWQERNAESAIEALKEYEPEMGKVVRQDKSGIQKVRAKEIVPGDLVEVSVGDKIPADIRITHIYSTTLRIDQSILTGESVSVIKHTDAIPDPRAVNQDKKNILFSGTNVAAGKARGVVIGTGLSTAIGKIRTEMSETEEIKTPLQQKLDEFGEQLSKVISVICVAVWAINIGHFNDPAHGGSWIKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRMFIFDKVEGNDSSFLEFEMTGSTYEPIGEVFLNGQRIKAADYDTLQELSTICIMCNDSAIDYNEFKQAFEKVGEATETALIVLAEKLNSFSVNKSGLDRRSAAIACRGEIETKWKKEFTLEFSRDRKSMSSYCTPLKA---------SRLGTGPKLFVKGAPEGVLERCTHARVGTTKVPLTSALKAKILALTGQYGTGRDTLRCLALAVADSPMKPDEMDLGDSTKFYQYEVNLTFVGVVGMLDPPRKEVFDSIVRCRAAGIRVIVITGDNKATAEAICRRIGVFAEDEDTTGKSYSGREFDDLSPTEQKAAVARSRLFSRVEPQHKSKIVEFLQSMNEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLADDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKPPRKADEGLISGWLFFRYMAIGFYVGAATVGAAAWWFVFSDEGPKLSYWQLTHHLSCLGGGDEFKGVDCKIFSDPHAMTMALSVLVTIEMLNAMNSLSENQSLITMPPWCNLWLIGSMALSFTLHFVILYVDVLSTVFQVTPLSAEEWITVMKFSIPVVLLDETLKFVARKIADGESPIYKMHGIVLMWAVF 1011          
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Match: atp2a3 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 3 [Source:ZFIN;Acc:ZDB-GENE-060531-103])

HSP 1 Score: 1325.46 bits (3429), Expect = 0.000e+0
Identity = 669/1000 (66.90%), Postives = 798/1000 (79.80%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRNQ 3083
            M+NAH+KS  +VL  F V++  GLT +Q++ + + YG N LP EEGK LW+LV+EQF+DLLV+ILL AA +SF+LA F+  E+STTAFVEP VILLIL+ NAV+GVWQE+NAE+AI+ALKEYE E  KV R N   +Q IKA  +VPGDIVE+SVGDKVPADIRI  I STTL++DQSILTGES SVIKH+D + D  AVNQDK NMLFSGTN+A+G+  GVV S G++TEIGKIR+Q+  T+Q KTPL +KLD F +QLSKVI++ICI VW+INIGHF DP+HGGS +RGAIYYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V RMF+V   +     + EF ISGS Y+P+G++   +K+V+C D   L E+A ICSLCNDSS+++NE+KGVYEKVGEATETAL  LVEKMN+   + S  SK   +  CN  I+  + K+FTLEFSRDRKSMS + +P            N   +  ++ VKGAPEG++DRC FVR  + R  +T ++K+++M  +  +GTG+DTLRCLALA  D P +  +MD  NAG F +YES++TFVG VGMLDPPR EV+ SI  C  AGIRVI+ITGDNK TA AICRRIGIF E+E   G++YTGREFD L+   QR AV+ A  FARVEPAHKSKI+ +LQ   EI+AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAS+MVL+DDNFSTIVAAVEEGRAIYNNMKQFIRYLISSN+GEVVCIFLTA LG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM++PPR+PKE LISGWLFFRY+AIG YVG  TV +A WW++   +GP VS+YQL H +QC  E   F G++C+VF    P TMALSVLV IEM NALNSLSENQSL++MPPW NIWL+ AI LS+SLHFLIL V  L  +FQ++PL FS+W+ V K S PV+LLDE+LK ISR+ 
Sbjct:    1 MENAHTKSASEVLANFGVNENTGLTLEQVKNNFDKYGPNELPAEEGKSLWELVVEQFEDLLVRILLLAACVSFVLALFEEGEESTTAFVEPIVILLILVANAVIGVWQERNAENAIEALKEYEPEMGKVYRMNRTAVQRIKARDIVPGDIVEISVGDKVPADIRITSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGRAIGVVVSTGVSTEIGKIRNQMAATEQEKTPLQQKLDEFGQQLSKVISLICIAVWVINIGHFADPVHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFVVNKADDSSCSLHEFTISGSTYAPEGEVLKADKQVQCGDYDGLVELATICSLCNDSSLDYNEAKGVYEKVGEATETALTTLVEKMNVFKTDLSGLSKVDRAAACNLIIRQLMQKKFTLEFSRDRKSMSVYCTP------------NGTNSQSKMFVKGAPEGVIDRCQFVRVGKERFPLTMAVKEELMSTIRDWGTGRDTLRCLALATRDSPPAVDKMDLENAGKFAEYESSLTFVGCVGMLDPPRKEVIGSIKLCNKAGIRVIMITGDNKGTAVAICRRIGIFSENEDVEGRAYTGREFDDLAPEAQREAVKRARCFARVEPAHKSKIVAYLQSFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLSDDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAILGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDKPPRNPKEPLISGWLFFRYLAIGGYVGLGTVSAATWWYLFDEDGPQVSFYQLRHFMQCTEENPMFEGINCEVFESRYPTTMALSVLVTIEMFNALNSLSENQSLLRMPPWVNIWLLGAIILSLSLHFLILHVEPLPLIFQVTPLHFSQWIIVFKISIPVILLDEALKYISRHH 988          
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Match: atp2a3 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 3 [Source:ZFIN;Acc:ZDB-GENE-060531-103])

HSP 1 Score: 1323.92 bits (3425), Expect = 0.000e+0
Identity = 669/1000 (66.90%), Postives = 798/1000 (79.80%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRNQ 3083
            M+NAH+KS  +VL  F V++  GLT +Q++ + + YG N LP EEGK LW+LV+EQF+DLLV+ILL AA +SF+LA F+  E+STTAFVEP VILLIL+ NAV+GVWQE+NAE+AI+ALKEYE E  KV R N   +Q IKA  +VPGDIVE+SVGDKVPADIRI  I STTL++DQSILTGES SVIKH+D + D  AVNQDK NMLFSGTN+A+G+  GVV S G++TEIGKIR+Q+  T+Q KTPL +KLD F +QLSKVI++ICI VW+INIGHF DP+HGGS +RGAIYYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V RMF+V   +     + EF ISGS Y+P+G++   +K+V+C D   L E+A ICSLCNDSS+++NE+KGVYEKVGEATETAL  LVEKMN+   + S  SK   +  CN  I+  + K+FTLEFSRDRKSMS + +P            N   +  ++ VKGAPEG++DRC FVR  + R  +T ++K+++M  +  +GTG+DTLRCLALA  D P +  +MD  NAG F +YES++TFVG VGMLDPPR EV+ SI  C  AGIRVI+ITGDNK TA AICRRIGIF E+E   G++YTGREFD L+   QR AV+ A  FARVEPAHKSKI+ +LQ   EI+AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAS+MVL+DDNFSTIVAAVEEGRAIYNNMKQFIRYLISSN+GEVVCIFLTA LG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM++PPR+PKE LISGWLFFRY+AIG YVG  TV +A WW++   +GP VS+YQL H +QC  E   F G++C+VF    P TMALSVLV IEM NALNSLSENQSL++MPPW NIWL+ AI LS+SLHFLIL V  L  +FQ++PL FS+W+ V K S PV+LLDE+LK ISR+ 
Sbjct:    1 MENAHTKSASEVLANFGVNENTGLTLEQVKNNFDKYGPNELPAEEGKSLWELVVEQFEDLLVRILLLAACVSFVLALFEEGEESTTAFVEPIVILLILVANAVIGVWQERNAENAIEALKEYEPEMGKVYRMNRTAVQRIKARDIVPGDIVEISVGDKVPADIRITSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGRAIGVVVSTGVSTEIGKIRNQMAATEQEKTPLQQKLDEFGQQLSKVISLICIAVWVINIGHFADPVHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFVVNKADDSSCSLHEFTISGSTYAPEGEVLKADKQVQCGDYDGLVELATICSLCNDSSLDYNEAKGVYEKVGEATETALTTLVEKMNVFKTDLSGLSKVDRAAACNLIIRQLMQKKFTLEFSRDRKSMSVYCTP------------NGTNSQSKMFVKGAPEGVIDRCQFVRVGKERFPLTMAVKEELMSTIRDWGTGRDTLRCLALATRDSPPAVDKMDLENAGKFAEYESSLTFVGCVGMLDPPRKEVIGSIKLCNKAGIRVIMITGDNKGTAVAICRRIGIFSENEDVEGRAYTGREFDDLAPEAQREAVKRARCFARVEPAHKSKIVAYLQSFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLSDDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAILGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDKPPRNPKEPLISGWLFFRYLAIGGYVGLGTVSAATWWYLFDEDGPQVSFYQLRHFMQCTEENPMFEGINCEVFESRYPTTMALSVLVTIEMFNALNSLSENQSLLRMPPWVNIWLLGAIILSLSLHFLILHVEPLPLIFQVTPLHFSQWIIVFKISIPVILLDEALKYISRHH 988          
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Match: atp2a1 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1 [Source:ZFIN;Acc:ZDB-GENE-020905-1])

HSP 1 Score: 1316.21 bits (3405), Expect = 0.000e+0
Identity = 668/999 (66.87%), Postives = 806/999 (80.68%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRN 3080
            M+NAH+K   + L +F VS+  GLT +Q++ +Q  YG N LP EEGK +W+LV+EQF+DLLV+ILL AA ISF+LAWF+  E++ TAFVEPFVILLILI NAVVGVWQE+NAESAI+ALKEYE E  KV RS+ K +Q IKA ++VPGDIVEVSVGDKVPADIRI  I STTL++DQSILTGES SVIKH++ + D  AVNQDK NMLFSGTN+A+GK  GVV + G++TEIGKIRDQ+  T+Q KTPL +KLD F EQLSKVI++IC+ VWLINIGHFNDP+HGGS +RGA+YYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM V++MF++  V  +   + +++ISGSKY+P+G++      VKC     L E+A IC+LCNDSS+++NESKG+YEKVGEATETAL CLVEKMN+ N +    SK + +  C + I+  + K+FTLEFSRDRKSMS + SP            +    G ++ VKGAPEG++DRC +VR    RV +T  +KD+IM  +  +GTG+DTLRCLALA  D P+    M+  ++  F +YE+++TFVG VGMLDPPR EV+ SI  CR AGIRVI+ITGDNK TA AICRRIGIF +DE   G+++TGREFD L   +QR AVR A  +ARVEP+HKSKI+E LQ   EI+AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAS+MVLADDNFS+IVAAVEEGRAIYNNMKQFIRYLISSN+GEVVCIFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM + PRSPKE LISGWLFFRY+AIG YVGAATV +A WWF+    GP VS+YQL+H +QC  +  DF G++C+VF  + PMTMALSVLV IEM NALNSLSENQSL++MPPW N+WL  A+TLSMSLHF+I+ V  L  +F+++ L+F +W+ V+K SFPV+L+DE+LK ++RN
Sbjct:    1 MENAHTKETPECLAYFGVSESTGLTPEQVKKNQAKYGFNELPAEEGKSIWELVVEQFEDLLVRILLLAACISFVLAWFEEGEETVTAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYEPEMGKVYRSDRKSVQRIKAREIVPGDIVEVSVGDKVPADIRITAIRSTTLRVDQSILTGESVSVIKHTESVPDPRAVNQDKKNMLFSGTNIAAGKAIGVVVATGVSTEIGKIRDQMAATEQEKTPLQQKLDEFGEQLSKVISLICVAVWLINIGHFNDPVHGGSWIRGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMCVTKMFVIEKVEGESVTLDQYDISGSKYTPEGEVTKNGLPVKCGQFDGLVELATICALCNDSSLDYNESKGIYEKVGEATETALCCLVEKMNVFNTDVRGLSKVERANTCCAVIKQLMKKDFTLEFSRDRKSMSVYCSPAKA---------SKAPVGNKMFVKGAPEGVIDRCAYVRVGTTRVPLTGPVKDKIMAVIKEWGTGRDTLRCLALATRDNPLRPEEMNLEDSTKFAEYETDLTFVGCVGMLDPPRKEVVGSIELCRAAGIRVIMITGDNKGTAVAICRRIGIFSDDEDVTGRAFTGREFDDLPLPQQREAVRKACCYARVEPSHKSKIVEFLQGFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSSIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMGKAPRSPKEPLISGWLFFRYLAIGGYVGAATVAAAGWWFLYCDEGPMVSFYQLSHFMQCTADNEDFAGIECEVFEAAPPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWSNLWLAGAMTLSMSLHFMIIYVDPLPMIFKLTHLNFDQWIVVLKLSFPVILIDEALKFVARN 990          
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Match: atp2a1 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1 [Source:ZFIN;Acc:ZDB-GENE-020905-1])

HSP 1 Score: 1316.21 bits (3405), Expect = 0.000e+0
Identity = 668/999 (66.87%), Postives = 806/999 (80.68%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRN 3080
            M+NAH+K   + L +F VS+  GLT +Q++ +Q  YG N LP EEGK +W+LV+EQF+DLLV+ILL AA ISF+LAWF+  E++ TAFVEPFVILLILI NAVVGVWQE+NAESAI+ALKEYE E  KV RS+ K +Q IKA ++VPGDIVEVSVGDKVPADIRI  I STTL++DQSILTGES SVIKH++ + D  AVNQDK NMLFSGTN+A+GK  GVV + G++TEIGKIRDQ+  T+Q KTPL +KLD F EQLSKVI++IC+ VWLINIGHFNDP+HGGS +RGA+YYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM V++MF++  V  +   + +++ISGSKY+P+G++      VKC     L E+A IC+LCNDSS+++NESKG+YEKVGEATETAL CLVEKMN+ N +    SK + +  C + I+  + K+FTLEFSRDRKSMS + SP            +    G ++ VKGAPEG++DRC +VR    RV +T  +KD+IM  +  +GTG+DTLRCLALA  D P+    M+  ++  F +YE+++TFVG VGMLDPPR EV+ SI  CR AGIRVI+ITGDNK TA AICRRIGIF +DE   G+++TGREFD L   +QR AVR A  +ARVEP+HKSKI+E LQ   EI+AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAS+MVLADDNFS+IVAAVEEGRAIYNNMKQFIRYLISSN+GEVVCIFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM + PRSPKE LISGWLFFRY+AIG YVGAATV +A WWF+    GP VS+YQL+H +QC  +  DF G++C+VF  + PMTMALSVLV IEM NALNSLSENQSL++MPPW N+WL  A+TLSMSLHF+I+ V  L  +F+++ L+F +W+ V+K SFPV+L+DE+LK ++RN
Sbjct:    1 MENAHTKETPECLAYFGVSESTGLTPEQVKKNQAKYGFNELPAEEGKSIWELVVEQFEDLLVRILLLAACISFVLAWFEEGEETVTAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYEPEMGKVYRSDRKSVQRIKAREIVPGDIVEVSVGDKVPADIRITAIRSTTLRVDQSILTGESVSVIKHTESVPDPRAVNQDKKNMLFSGTNIAAGKAIGVVVATGVSTEIGKIRDQMAATEQEKTPLQQKLDEFGEQLSKVISLICVAVWLINIGHFNDPVHGGSWIRGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMCVTKMFVIEKVEGESVTLDQYDISGSKYTPEGEVTKNGLPVKCGQFDGLVELATICALCNDSSLDYNESKGIYEKVGEATETALCCLVEKMNVFNTDVRGLSKVERANTCCAVIKQLMKKDFTLEFSRDRKSMSVYCSPAKA---------SKAPVGNKMFVKGAPEGVIDRCAYVRVGTTRVPLTGPVKDKIMAVIKEWGTGRDTLRCLALATRDNPLRPEEMNLEDSTKFAEYETDLTFVGCVGMLDPPRKEVVGSIELCRAAGIRVIMITGDNKGTAVAICRRIGIFSDDEDVTGRAFTGREFDDLPLPQQREAVRKACCYARVEPSHKSKIVEFLQGFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSSIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMGKAPRSPKEPLISGWLFFRYLAIGGYVGAATVAAAGWWFLYCDEGPMVSFYQLSHFMQCTADNEDFAGIECEVFEAAPPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWSNLWLAGAMTLSMSLHFMIIYVDPLPMIFKLTHLNFDQWIVVLKLSFPVILIDEALKFVARN 990          
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Match: atp2a1 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1 [Source:ZFIN;Acc:ZDB-GENE-020905-1])

HSP 1 Score: 1315.06 bits (3402), Expect = 0.000e+0
Identity = 669/1004 (66.63%), Postives = 807/1004 (80.38%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRNQQHRK 3095
            M+NAH+K   + L +F VS+  GLT +Q++ +Q  YG N LP EEGK +W+LV+EQF+DLLV+ILL AA ISF+LAWF+  E++ TAFVEPFVILLILI NAVVGVWQE+NAESAI+ALKEYE E  KV RS+ K +Q IKA ++VPGDIVEVSVGDKVPADIRI  I STTL++DQSILTGES SVIKH++ + D  AVNQDK NMLFSGTN+A+GK  GVV + G++TEIGKIRDQ+  T+Q KTPL +KLD F EQLSKVI++IC+ VWLINIGHFNDP+HGGS +RGA+YYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM V++MF++  V  +   + +++ISGSKY+P+G++      VKC     L E+A IC+LCNDSS+++NESKG+YEKVGEATETAL CLVEKMN+ N +    SK + +  C + I+  + K+FTLEFSRDRKSMS + SP            +    G ++ VKGAPEG++DRC +VR    RV +T  +KD+IM  +  +GTG+DTLRCLALA  D P+    M+  ++  F +YE+++TFVG VGMLDPPR EV+ SI  CR AGIRVI+ITGDNK TA AICRRIGIF +DE   G+++TGREFD L   +QR AVR A  +ARVEP+HKSKI+E LQ   EI+AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAS+MVLADDNFS+IVAAVEEGRAIYNNMKQFIRYLISSN+GEVVCIFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM + PRSPKE LISGWLFFRY+AIG YVGAATV +A WWF+    GP VS+YQL+H +QC  +  DF G++C+VF  + PMTMALSVLV IEM NALNSLSENQSL++MPPW N+WL  A+TLSMSLHF+I+ V  L  +F+++ L+F +W+ V+K SFPV+L+DE+LK ++RN    K
Sbjct:    1 MENAHTKETPECLAYFGVSESTGLTPEQVKKNQAKYGFNELPAEEGKSIWELVVEQFEDLLVRILLLAACISFVLAWFEEGEETVTAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYEPEMGKVYRSDRKSVQRIKAREIVPGDIVEVSVGDKVPADIRITAIRSTTLRVDQSILTGESVSVIKHTESVPDPRAVNQDKKNMLFSGTNIAAGKAIGVVVATGVSTEIGKIRDQMAATEQEKTPLQQKLDEFGEQLSKVISLICVAVWLINIGHFNDPVHGGSWIRGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMCVTKMFVIEKVEGESVTLDQYDISGSKYTPEGEVTKNGLPVKCGQFDGLVELATICALCNDSSLDYNESKGIYEKVGEATETALCCLVEKMNVFNTDVRGLSKVERANTCCAVIKQLMKKDFTLEFSRDRKSMSVYCSPAKA---------SKAPVGNKMFVKGAPEGVIDRCAYVRVGTTRVPLTGPVKDKIMAVIKEWGTGRDTLRCLALATRDNPLRPEEMNLEDSTKFAEYETDLTFVGCVGMLDPPRKEVVGSIELCRAAGIRVIMITGDNKGTAVAICRRIGIFSDDEDVTGRAFTGREFDDLPLPQQREAVRKACCYARVEPSHKSKIVEFLQGFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSSIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMGKAPRSPKEPLISGWLFFRYLAIGGYVGAATVAAAGWWFLYCDEGPMVSFYQLSHFMQCTADNEDFAGIECEVFEAAPPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWSNLWLAGAMTLSMSLHFMIIYVDPLPMIFKLTHLNFDQWIVVLKLSFPVILIDEALKFVARNYLEEK 995          
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Match: ATP2A2 (ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 [Source:NCBI gene;Acc:100489059])

HSP 1 Score: 1324.3 bits (3426), Expect = 0.000e+0
Identity = 676/999 (67.67%), Postives = 811/999 (81.18%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRN 3080
            M+NAH+K+V +VL  F+V++  GL+ +Q++  +E +G N LP EEGK LW+LV+EQF+DLLV+ILL AA ISF+LAWF+  E++ TAFVEPFVILLIL+ NA+VGVWQE+NAE+AI+ALKEYE E  KV R + K +Q IKA  +VPGDIVEV+VGDKVPADIR+  I STTL++DQSILTGES SVIKH+D + D  AVNQDK NMLFSGTN+A+GK  GVV + G+NTEIGKIRD+++ T+Q +TPL +KLD F EQLSKVI++ICI VW+INIGHFNDP+HGGS +RGAIYYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V RMFIV  V  D   + EF I+GS Y+P G++   +K VKC     L E+A IC+LCNDSS++FNE+KGVYEKVGEATETAL CLVEKMN+ + +    S+ + +  CNS I+  + KEFTLEFSRDRKSMS + +P  P             +  ++ VKGAPEG++DRCT +R    +V +T  IK +IM  +  +GTG+DTLRCLALA  D P  +  M+  ++ NF  YE+N+TFVG VGMLDPPR+EV  S+  CR AGIRVI+ITGDNK TA AICRR+GIF EDE    +++TGREFD+LS   QR+A  NA  FARVEP+HKSKI+E LQ   EI+AMTGDGVNDAPALKKAEIGIAMGSGTAVAK+AS+MVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSN+GEVVCIFLTAALG PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM +PPR+PKE LISGWLFFRY+AIGCYVGAATVG+AAWWF+++ +GP +++YQL+H LQC  E  DF GV+C++F    PMTMALSVLV IEM NALNSLSENQSL++MPPW N+WL+ +I LSMSLHFLIL V  L  +FQI+PL+  +WL V+K S PV+LLDE+LK ++RN
Sbjct:    1 MENAHTKTVEEVLAHFNVNESTGLSLEQVKKQKERWGANELPAEEGKTLWELVIEQFEDLLVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALKEYEPEMGKVYRQDRKSVQRIKARDIVPGDIVEVAVGDKVPADIRLTSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAIGVVVATGVNTEIGKIRDEMVATEQERTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFIVDKVEGDNCFLNEFNITGSTYAPMGEVLKDDKLVKCHQYDGLVELATICALCNDSSLDFNEAKGVYEKVGEATETALTCLVEKMNVFDTDLKGLSRIERANACNSVIKQLMKKEFTLEFSRDRKSMSVYCTPNKP----------SRTSMSKMFVKGAPEGLIDRCTHIRVGSIKVPLTAGIKQKIMSVIREWGTGRDTLRCLALATHDNPPRKEDMNLEDSTNFINYETNLTFVGCVGMLDPPRTEVAASVKMCRQAGIRVIMITGDNKGTAVAICRRVGIFREDEDVSERAFTGREFDELSPAAQRDACLNARCFARVEPSHKSKIVEFLQSFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYVGAATVGAAAWWFIAAEDGPRITFYQLSHFLQCREENPDFDGVECEIFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWENVWLLGSICLSMSLHFLILYVEPLPLIFQITPLNLIQWLMVLKISLPVILLDETLKYVARN 989          
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Match: ATP2A2 (ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 [Source:NCBI gene;Acc:100489059])

HSP 1 Score: 1323.92 bits (3425), Expect = 0.000e+0
Identity = 677/1007 (67.23%), Postives = 814/1007 (80.83%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRNQQHRKSIF 3104
            M+NAH+K+V +VL  F+V++  GL+ +Q++  +E +G N LP EEGK LW+LV+EQF+DLLV+ILL AA ISF+LAWF+  E++ TAFVEPFVILLIL+ NA+VGVWQE+NAE+AI+ALKEYE E  KV R + K +Q IKA  +VPGDIVEV+VGDKVPADIR+  I STTL++DQSILTGES SVIKH+D + D  AVNQDK NMLFSGTN+A+GK  GVV + G+NTEIGKIRD+++ T+Q +TPL +KLD F EQLSKVI++ICI VW+INIGHFNDP+HGGS +RGAIYYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V RMFIV  V  D   + EF I+GS Y+P G++   +K VKC     L E+A IC+LCNDSS++FNE+KGVYEKVGEATETAL CLVEKMN+ + +    S+ + +  CNS I+  + KEFTLEFSRDRKSMS + +P  P             +  ++ VKGAPEG++DRCT +R    +V +T  IK +IM  +  +GTG+DTLRCLALA  D P  +  M+  ++ NF  YE+N+TFVG VGMLDPPR+EV  S+  CR AGIRVI+ITGDNK TA AICRR+GIF EDE    +++TGREFD+LS   QR+A  NA  FARVEP+HKSKI+E LQ   EI+AMTGDGVNDAPALKKAEIGIAMGSGTAVAK+AS+MVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSN+GEVVCIFLTAALG PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM +PPR+PKE LISGWLFFRY+AIGCYVGAATVG+AAWWF+++ +GP +++YQL+H LQC  E  DF GV+C++F    PMTMALSVLV IEM NALNSLSENQSL++MPPW N+WL+ +I LSMSLHFLIL V  L  +FQI+PL+  +WL V+K S PV+LLDE+LK ++RN    + +F
Sbjct:    1 MENAHTKTVEEVLAHFNVNESTGLSLEQVKKQKERWGANELPAEEGKTLWELVIEQFEDLLVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALKEYEPEMGKVYRQDRKSVQRIKARDIVPGDIVEVAVGDKVPADIRLTSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAIGVVVATGVNTEIGKIRDEMVATEQERTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFIVDKVEGDNCFLNEFNITGSTYAPMGEVLKDDKLVKCHQYDGLVELATICALCNDSSLDFNEAKGVYEKVGEATETALTCLVEKMNVFDTDLKGLSRIERANACNSVIKQLMKKEFTLEFSRDRKSMSVYCTPNKP----------SRTSMSKMFVKGAPEGLIDRCTHIRVGSIKVPLTAGIKQKIMSVIREWGTGRDTLRCLALATHDNPPRKEDMNLEDSTNFINYETNLTFVGCVGMLDPPRTEVAASVKMCRQAGIRVIMITGDNKGTAVAICRRVGIFREDEDVSERAFTGREFDELSPAAQRDACLNARCFARVEPSHKSKIVEFLQSFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYVGAATVGAAAWWFIAAEDGPRITFYQLSHFLQCREENPDFDGVECEIFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWENVWLLGSICLSMSLHFLILYVEPLPLIFQITPLNLIQWLMVLKISLPVILLDETLKYVARNYLEPEHVF 997          
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Match: ATP2A2 (ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 [Source:NCBI gene;Acc:100489059])

HSP 1 Score: 1323.15 bits (3423), Expect = 0.000e+0
Identity = 676/999 (67.67%), Postives = 811/999 (81.18%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRN 3080
            M+NAH+K+V +VL  F+V++  GL+ +Q++  +E +G N LP EEGK LW+LV+EQF+DLLV+ILL AA ISF+LAWF+  E++ TAFVEPFVILLIL+ NA+VGVWQE+NAE+AI+ALKEYE E  KV R + K +Q IKA  +VPGDIVEV+VGDKVPADIR+  I STTL++DQSILTGES SVIKH+D + D  AVNQDK NMLFSGTN+A+GK  GVV + G+NTEIGKIRD+++ T+Q +TPL +KLD F EQLSKVI++ICI VW+INIGHFNDP+HGGS +RGAIYYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V RMFIV  V  D   + EF I+GS Y+P G++   +K VKC     L E+A IC+LCNDSS++FNE+KGVYEKVGEATETAL CLVEKMN+ + +    S+ + +  CNS I+  + KEFTLEFSRDRKSMS + +P  P             +  ++ VKGAPEG++DRCT +R    +V +T  IK +IM  +  +GTG+DTLRCLALA  D P  +  M+  ++ NF  YE+N+TFVG VGMLDPPR+EV  S+  CR AGIRVI+ITGDNK TA AICRR+GIF EDE    +++TGREFD+LS   QR+A  NA  FARVEP+HKSKI+E LQ   EI+AMTGDGVNDAPALKKAEIGIAMGSGTAVAK+AS+MVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSN+GEVVCIFLTAALG PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM +PPR+PKE LISGWLFFRY+AIGCYVGAATVG+AAWWF+++ +GP +++YQL+H LQC  E  DF GV+C++F    PMTMALSVLV IEM NALNSLSENQSL++MPPW N+WL+ +I LSMSLHFLIL V  L  +FQI+PL+  +WL V+K S PV+LLDE+LK ++RN
Sbjct:    1 MENAHTKTVEEVLAHFNVNESTGLSLEQVKKQKERWGANELPAEEGKTLWELVIEQFEDLLVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALKEYEPEMGKVYRQDRKSVQRIKARDIVPGDIVEVAVGDKVPADIRLTSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAIGVVVATGVNTEIGKIRDEMVATEQERTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFIVDKVEGDNCFLNEFNITGSTYAPMGEVLKDDKLVKCHQYDGLVELATICALCNDSSLDFNEAKGVYEKVGEATETALTCLVEKMNVFDTDLKGLSRIERANACNSVIKQLMKKEFTLEFSRDRKSMSVYCTPNKP----------SRTSMSKMFVKGAPEGLIDRCTHIRVGSIKVPLTAGIKQKIMSVIREWGTGRDTLRCLALATHDNPPRKEDMNLEDSTNFINYETNLTFVGCVGMLDPPRTEVAASVKMCRQAGIRVIMITGDNKGTAVAICRRVGIFREDEDVSERAFTGREFDELSPAAQRDACLNARCFARVEPSHKSKIVEFLQSFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYVGAATVGAAAWWFIAAEDGPRITFYQLSHFLQCREENPDFDGVECEIFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWENVWLLGSICLSMSLHFLILYVEPLPLIFQITPLNLIQWLMVLKISLPVILLDETLKYVARN 989          
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Match: ATP2A2 (ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 [Source:NCBI gene;Acc:100489059])

HSP 1 Score: 1322.76 bits (3422), Expect = 0.000e+0
Identity = 676/999 (67.67%), Postives = 811/999 (81.18%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRN 3080
            M+NAH+K+V +VL  F+V++  GL+ +Q++  +E +G N LP EEGK LW+LV+EQF+DLLV+ILL AA ISF+LAWF+  E++ TAFVEPFVILLIL+ NA+VGVWQE+NAE+AI+ALKEYE E  KV R + K +Q IKA  +VPGDIVEV+VGDKVPADIR+  I STTL++DQSILTGES SVIKH+D + D  AVNQDK NMLFSGTN+A+GK  GVV + G+NTEIGKIRD+++ T+Q +TPL +KLD F EQLSKVI++ICI VW+INIGHFNDP+HGGS +RGAIYYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V RMFIV  V  D   + EF I+GS Y+P G++   +K VKC     L E+A IC+LCNDSS++FNE+KGVYEKVGEATETAL CLVEKMN+ + +    S+ + +  CNS I+  + KEFTLEFSRDRKSMS + +P  P             +  ++ VKGAPEG++DRCT +R    +V +T  IK +IM  +  +GTG+DTLRCLALA  D P  +  M+  ++ NF  YE+N+TFVG VGMLDPPR+EV  S+  CR AGIRVI+ITGDNK TA AICRR+GIF EDE    +++TGREFD+LS   QR+A  NA  FARVEP+HKSKI+E LQ   EI+AMTGDGVNDAPALKKAEIGIAMGSGTAVAK+AS+MVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSN+GEVVCIFLTAALG PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM +PPR+PKE LISGWLFFRY+AIGCYVGAATVG+AAWWF+++ +GP +++YQL+H LQC  E  DF GV+C++F    PMTMALSVLV IEM NALNSLSENQSL++MPPW N+WL+ +I LSMSLHFLIL V  L  +FQI+PL+  +WL V+K S PV+LLDE+LK ++RN
Sbjct:    1 MENAHTKTVEEVLAHFNVNESTGLSLEQVKKQKERWGANELPAEEGKTLWELVIEQFEDLLVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALKEYEPEMGKVYRQDRKSVQRIKARDIVPGDIVEVAVGDKVPADIRLTSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAIGVVVATGVNTEIGKIRDEMVATEQERTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFIVDKVEGDNCFLNEFNITGSTYAPMGEVLKDDKLVKCHQYDGLVELATICALCNDSSLDFNEAKGVYEKVGEATETALTCLVEKMNVFDTDLKGLSRIERANACNSVIKQLMKKEFTLEFSRDRKSMSVYCTPNKP----------SRTSMSKMFVKGAPEGLIDRCTHIRVGSIKVPLTAGIKQKIMSVIREWGTGRDTLRCLALATHDNPPRKEDMNLEDSTNFINYETNLTFVGCVGMLDPPRTEVAASVKMCRQAGIRVIMITGDNKGTAVAICRRVGIFREDEDVSERAFTGREFDELSPAAQRDACLNARCFARVEPSHKSKIVEFLQSFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYVGAATVGAAAWWFIAAEDGPRITFYQLSHFLQCREENPDFDGVECEIFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWENVWLLGSICLSMSLHFLILYVEPLPLIFQITPLNLIQWLMVLKISLPVILLDETLKYVARN 989          
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Match: atp2a3 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 3 [Source:NCBI gene;Acc:779786])

HSP 1 Score: 1319.68 bits (3414), Expect = 0.000e+0
Identity = 666/1027 (64.85%), Postives = 807/1027 (78.58%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRNQQHRKSIFTNCHLIVLMWGLFAAAVLYC 3164
            MD+AH+K+V +VL  F+V++  GL+ +Q+  S+E YG+N LP EEGK LW+LVLEQF+DLLV+ILL AA +SFILAWF+  E++TTAFVEP VI++IL++NA VGVWQE+NAESAI+ALKEYE E  KVIR +  G+Q I+A  +VPGDIVEV+VGDKVPADIRI +I STTL++DQSILTGES SVIKH+D I D  AVNQDK NMLFSGTN+A+GK  G+V + G+ TEIGKIR+Q++ T+  KTPL +KLD F +QLSKVI++IC+ VW+INIGHFNDP+HGGS  RGAIYYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+VSRMF++  +        EF I+GS Y+P G +   E+ V C     L E+A IC+LCNDSS++FNESKGVYEKVGEATETAL CLVEKMN+ N + ST SK + +  CNS I+  + KE TLEFSRDRKSMS + + + P         N   +  ++ VKGAPE +++RC +VR    ++ +T S +++IM K+  +GTG DTLRCLALA  D P     M   ++  F  YE+N+TFVG VGMLDPPR EV  SI  C+ AGI+VI+ITGDNK TA AICR+IGIF + E    K+YTGREFD L    QR A R+A  FARVEPAHKSKI+E+LQ   EI+AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSA++MVLADDNFS+IV+AVEEGRAIYNNMKQFIRYLISSN+GEVVCIFLTA LG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIME+ PR+P+E LISGWLFFRY+AIG YVG ATVG+A WWF+   +GP V++YQL H ++C ++   F G+DC VF    P TMALSVLV IEM NALNSLSENQSL++MPPW NIWL+ AI +SM+LHFLIL +  +  VFQ++PL++S+W+ V+K S PV+LLDE LK ISR+  H   +  NC  ++L         +YC
Sbjct:    1 MDSAHAKTVSEVLRHFEVNENCGLSSEQVRRSREKYGLNELPAEEGKSLWELVLEQFEDLLVRILLLAAFVSFILAWFEEGEETTTAFVEPIVIIMILVINAFVGVWQERNAESAIEALKEYEPEMGKVIRGDRSGVQRIRARDIVPGDIVEVAVGDKVPADIRITEIRSTTLRVDQSILTGESVSVIKHTDPIPDPRAVNQDKKNMLFSGTNIAAGKAVGIVIATGIYTEIGKIRNQMVATEPEKTPLQQKLDEFGQQLSKVISLICVAVWVINIGHFNDPVHGGSWFRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRMFVIEKIEGVNCSFHEFSITGSTYAPVGQVLKDEQPVNCGQYDGLVELATICALCNDSSLDFNESKGVYEKVGEATETALTCLVEKMNVFNTDLSTLSKVERANACNSVIKKLMKKECTLEFSRDRKSMSVYCNSVAP---------NSGQSASKMFVKGAPESVIERCNYVRVGSTKLPLTPSAREKIMSKIRDWGTGMDTLRCLALATRDVPPKLEDMQLDDSTKFINYETNLTFVGCVGMLDPPRKEVSISIELCKRAGIKVIMITGDNKGTAVAICRKIGIFSDYEDITDKAYTGREFDDLPPERQREACRSARCFARVEPAHKSKIVEYLQSYSEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLADDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAILGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKLPRNPREPLISGWLFFRYLAIGVYVGLATVGAATWWFLYDEDGPQVTFYQLRHFMKCTSDNPLFSGIDCDVFESRYPTTMALSVLVTIEMCNALNSLSENQSLLRMPPWLNIWLLGAIIMSMALHFLILYIKPMPLVFQVTPLNWSQWVVVLKISLPVILLDEGLKYISRH--HLDGMSFNCRYVILSAVFSYFPFVYC 1016          
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Match: Atp2a2 (ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 [Source:MGI Symbol;Acc:MGI:88110])

HSP 1 Score: 1323.53 bits (3424), Expect = 0.000e+0
Identity = 677/1007 (67.23%), Postives = 810/1007 (80.44%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRNQQHRKSIF 3104
            M+NAH+K+V +VL  F V++  GL+ +Q++  +E +G N LP EEGK L +LV+EQF+DLLV+ILL AA ISF+LAWF+  E++ TAFVEPFVILLIL+ NA+VGVWQE+NAE+AI+ALKEYE E  KV R + K +Q IKA  +VPGDIVE++VGDKVPADIR+  I STTL++DQSILTGES SVIKH+D + D  AVNQDK NMLFSGTN+A+GK  GVV + G+NTEIGKIRD+++ T+Q +TPL +KLD F EQLSKVI++ICI VW+INIGHFNDP+HGGS +RGAIYYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V RMFI+  V  D   + EF I+GS Y+P G++   +K VKC     L E+A IC+LCNDS++++NE+KGVYEKVGEATETAL CLVEKMN+ +      SK + +  CNS I+  + KEFTLEFSRDRKSMS + +P  P             +  ++ VKGAPEG++DRCT +R    +V MT  +K +IM  +  +G+G DTLRCLALA  D P+ R  M   ++ NF KYE+N+TFVG VGMLDPPR EV  S+  CR AGIRVI+ITGDNK TA AICRRIGIFG+DE    K++TGREFD+LS   QR+A  NA  FARVEP+HKSKI+E LQ   EI+AMTGDGVNDAPALKK+EIGIAMGSGTAVAK+AS+MVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSN+GEVVCIFLTAALG PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM +PPR+PKE LISGWLFFRY+AIGCYVGAATVG+AAWWF+++  GP VS+YQL+H LQC  +  DF GVDC +F    PMTMALSVLV IEM NALNSLSENQSL++MPPW NIWL+ +I LSMSLHFLIL V  L  +FQI+PL+ ++WL V+K S PV+L+DE+LK ++RN   + +I 
Sbjct:    1 MENAHTKTVEEVLGHFGVNESTGLSLEQVKKLKERWGSNELPAEEGKTLLELVIEQFEDLLVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALKEYEPEMGKVYRQDRKSVQRIKAKDIVPGDIVEIAVGDKVPADIRLTSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAMGVVVATGVNTEIGKIRDEMVATEQERTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFILDKVEGDTCSLNEFSITGSTYAPIGEVQKDDKPVKCHQYDGLVELATICALCNDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTELKGLSKIERANACNSVIKQLMKKEFTLEFSRDRKSMSVYCTPNKP----------SRTSMSKMFVKGAPEGVIDRCTHIRVGSTKVPMTPGVKQKIMSVIREWGSGSDTLRCLALATHDNPLKREEMHLEDSANFIKYETNLTFVGCVGMLDPPRIEVASSVKLCRQAGIRVIMITGDNKGTAVAICRRIGIFGQDEDVTSKAFTGREFDELSPSAQRDACLNARCFARVEPSHKSKIVEFLQSFDEITAMTGDGVNDAPALKKSEIGIAMGSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYVGAATVGAAAWWFIAADGGPRVSFYQLSHFLQCKEDNPDFDGVDCAIFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWENIWLVGSICLSMSLHFLILYVEPLPLIFQITPLNLTQWLMVLKISLPVILMDETLKFVARNYLEQPAIL 997          
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Match: Atp2a2 (ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 [Source:MGI Symbol;Acc:MGI:88110])

HSP 1 Score: 1320.84 bits (3417), Expect = 0.000e+0
Identity = 677/999 (67.77%), Postives = 810/999 (81.08%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRN 3080
            M+NAH+K+V +VL  F V++  GL+ +Q++  +E +G N LP EEGK L +LV+EQF+DLLV+ILL AA ISF+LAWF+  E++ TAFVEPFVILLIL+ NA+VGVWQE+NAE+AI+ALKEYE E  KV R + K +Q IKA  +VPGDIVE++VGDKVPADIR+  I STTL++DQSILTGES SVIKH+D + D  AVNQDK NMLFSGTN+A+GK  GVV + G+NTEIGKIRD+++ T+Q +TPL +KLD F EQLSKVI++ICI VW+INIGHFNDP+HGGS +RGAIYYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V RMFI+  V  D   + EF I+GS Y+P G++   +K VKC     L E+A IC+LCNDS++++NE+KGVYEKVGEATETAL CLVEKMN+ +      SK + +  CNS I+  + KEFTLEFSRDRKSMS + +P  P    +T++        ++ VKGAPEG++DRCT +R    +V MT  +K +IM  +  +G+G DTLRCLALA  D P+ R  M   ++ NF KYE+N+TFVG VGMLDPPR EV  S+  CR AGIRVI+ITGDNK TA AICRRIGIFG+DE    K++TGREFD+LS   QR+A  NA  FARVEP+HKSKI+E LQ   EI+AMTGDGVNDAPALKK+EIGIAMGSGTAVAK+AS+MVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSN+GEVVCIFLTAALG PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM +PPR+PKE LISGWLFFRY+AIGCYVGAATVG+AAWWF+++  GP VS+YQL+H LQC  +  DF GVDC +F    PMTMALSVLV IEM NALNSLSENQSL++MPPW NIWL+ +I LSMSLHFLIL V  L  +FQI+PL+ ++WL V+K S PV+L+DE+LK ++RN
Sbjct:    1 MENAHTKTVEEVLGHFGVNESTGLSLEQVKKLKERWGSNELPAEEGKTLLELVIEQFEDLLVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALKEYEPEMGKVYRQDRKSVQRIKAKDIVPGDIVEIAVGDKVPADIRLTSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAMGVVVATGVNTEIGKIRDEMVATEQERTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFILDKVEGDTCSLNEFSITGSTYAPIGEVQKDDKPVKCHQYDGLVELATICALCNDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTELKGLSKIERANACNSVIKQLMKKEFTLEFSRDRKSMSVYCTPNKPS---RTSMS-------KMFVKGAPEGVIDRCTHIRVGSTKVPMTPGVKQKIMSVIREWGSGSDTLRCLALATHDNPLKREEMHLEDSANFIKYETNLTFVGCVGMLDPPRIEVASSVKLCRQAGIRVIMITGDNKGTAVAICRRIGIFGQDEDVTSKAFTGREFDELSPSAQRDACLNARCFARVEPSHKSKIVEFLQSFDEITAMTGDGVNDAPALKKSEIGIAMGSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYVGAATVGAAAWWFIAADGGPRVSFYQLSHFLQCKEDNPDFDGVDCAIFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWENIWLVGSICLSMSLHFLILYVEPLPLIFQITPLNLTQWLMVLKISLPVILMDETLKFVARN 989          
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Match: Atp2a2 (ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 [Source:MGI Symbol;Acc:MGI:88110])

HSP 1 Score: 1320.84 bits (3417), Expect = 0.000e+0
Identity = 677/999 (67.77%), Postives = 810/999 (81.08%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRN 3080
            M+NAH+K+V +VL  F V++  GL+ +Q++  +E +G N LP EEGK L +LV+EQF+DLLV+ILL AA ISF+LAWF+  E++ TAFVEPFVILLIL+ NA+VGVWQE+NAE+AI+ALKEYE E  KV R + K +Q IKA  +VPGDIVE++VGDKVPADIR+  I STTL++DQSILTGES SVIKH+D + D  AVNQDK NMLFSGTN+A+GK  GVV + G+NTEIGKIRD+++ T+Q +TPL +KLD F EQLSKVI++ICI VW+INIGHFNDP+HGGS +RGAIYYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V RMFI+  V  D   + EF I+GS Y+P G++   +K VKC     L E+A IC+LCNDS++++NE+KGVYEKVGEATETAL CLVEKMN+ +      SK + +  CNS I+  + KEFTLEFSRDRKSMS + +P  P    +T++        ++ VKGAPEG++DRCT +R    +V MT  +K +IM  +  +G+G DTLRCLALA  D P+ R  M   ++ NF KYE+N+TFVG VGMLDPPR EV  S+  CR AGIRVI+ITGDNK TA AICRRIGIFG+DE    K++TGREFD+LS   QR+A  NA  FARVEP+HKSKI+E LQ   EI+AMTGDGVNDAPALKK+EIGIAMGSGTAVAK+AS+MVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSN+GEVVCIFLTAALG PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM +PPR+PKE LISGWLFFRY+AIGCYVGAATVG+AAWWF+++  GP VS+YQL+H LQC  +  DF GVDC +F    PMTMALSVLV IEM NALNSLSENQSL++MPPW NIWL+ +I LSMSLHFLIL V  L  +FQI+PL+ ++WL V+K S PV+L+DE+LK ++RN
Sbjct:    1 MENAHTKTVEEVLGHFGVNESTGLSLEQVKKLKERWGSNELPAEEGKTLLELVIEQFEDLLVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALKEYEPEMGKVYRQDRKSVQRIKAKDIVPGDIVEIAVGDKVPADIRLTSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAMGVVVATGVNTEIGKIRDEMVATEQERTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFILDKVEGDTCSLNEFSITGSTYAPIGEVQKDDKPVKCHQYDGLVELATICALCNDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTELKGLSKIERANACNSVIKQLMKKEFTLEFSRDRKSMSVYCTPNKPS---RTSMS-------KMFVKGAPEGVIDRCTHIRVGSTKVPMTPGVKQKIMSVIREWGSGSDTLRCLALATHDNPLKREEMHLEDSANFIKYETNLTFVGCVGMLDPPRIEVASSVKLCRQAGIRVIMITGDNKGTAVAICRRIGIFGQDEDVTSKAFTGREFDELSPSAQRDACLNARCFARVEPSHKSKIVEFLQSFDEITAMTGDGVNDAPALKKSEIGIAMGSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYVGAATVGAAAWWFIAADGGPRVSFYQLSHFLQCKEDNPDFDGVDCAIFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWENIWLVGSICLSMSLHFLILYVEPLPLIFQITPLNLTQWLMVLKISLPVILMDETLKFVARN 989          
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Match: Atp2a1 (ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 [Source:MGI Symbol;Acc:MGI:105058])

HSP 1 Score: 1317.75 bits (3409), Expect = 0.000e+0
Identity = 681/999 (68.17%), Postives = 802/999 (80.28%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRN 3080
            M+ AHSKS  + L +F VS+  GLT  Q++   E YG N LP EEGK LW+LV+EQF+DLLV+ILL AA ISF+LAWF+  E++ TAFVEPFVILLILI NA+VGVWQE+NAE+AI+ALKEYE E  KV R++ K +Q IKA  +VPGDIVEV+VGDKVPADIRI+ I STTL++DQSILTGES SVIKH+D + D  AVNQDK NMLFSGTN+A+GK  G+V + G++TEIGKIRDQ+  T+Q KTPL +KLD F EQLSKVI++IC+ VWLINIGHFNDP+HGGS  RGAIYYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V +MFI+  V+ D   + EF I+GS Y+P+G++   +K V+      L E+A IC+LCNDSS++FNE+KGVYEKVGEATETAL  LVEKMN+ N    + SK + +  CNS I+  + KEFTLEFSRDRKSMS + SP            +    G ++ VKGAPEG++DRC +VR    RV +T  +K++IM  +  +GTG+DTLRCLALA  D P  R  M   ++  F +YE ++TFVG+VGMLDPPR EV  SI  CR+AGIRVI+ITGDNK TA AICRRIGIF E+E    ++YTGREFD L   EQR A R A  FARVEP+HKSKI+E+LQ   EI+AMTGDGVNDAPALKKAEIGIAMGSGTAVAK+AS+MVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSN+GEVVCIFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM+RPPRSPKE LISGWLFFRYMAIG YVGAATVG+AAWWF+ + +GP VSY+QLTH +QC     +F G+DC+VF   +PMTMALSVLV IEM NALNSLSENQSL++MPPW NIWL+ +I LSMSLHFLIL V  L  +F++  L F++WL V+K S PV+ LDE LK I+RN
Sbjct:    1 MEAAHSKSTEECLSYFGVSETTGLTPDQVKRHLEKYGPNELPAEEGKSLWELVVEQFEDLLVRILLLAACISFVLAWFEEGEETVTAFVEPFVILLILIANAIVGVWQERNAENAIEALKEYEPEMGKVYRADRKSVQRIKARDIVPGDIVEVAVGDKVPADIRILSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAVGIVATTGVSTEIGKIRDQMAATEQDKTPLQQKLDEFGEQLSKVISLICVAVWLINIGHFNDPVHGGSWFRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCKMFIIDKVDGDVCSLNEFSITGSTYAPEGEVLKNDKPVRAGQYDGLVELATICALCNDSSLDFNETKGVYEKVGEATETALTTLVEKMNVFNTEVRSLSKVERANACNSVIRQLMKKEFTLEFSRDRKSMSVYCSPAK---------SSRAAVGNKMFVKGAPEGVIDRCNYVRVGTTRVPLTGPVKEKIMSVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSAKFMEYEMDLTFVGVVGMLDPPRKEVTGSIQLCRDAGIRVIMITGDNKGTAIAICRRIGIFSENEEVTDRAYTGREFDDLPLAEQREACRRACCFARVEPSHKSKIVEYLQSYDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRPPRSPKEPLISGWLFFRYMAIGGYVGAATVGAAAWWFLYAEDGPHVSYHQLTHFMQCTEHNPEFDGLDCEVFEAPEPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWVNIWLLGSICLSMSLHFLILYVDPLPMIFKLRALDFTQWLMVLKISLPVIGLDELLKFIARN 990          
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Match: Atp2a3 (ATPase, Ca++ transporting, ubiquitous [Source:MGI Symbol;Acc:MGI:1194503])

HSP 1 Score: 1281.54 bits (3315), Expect = 0.000e+0
Identity = 642/1000 (64.20%), Postives = 786/1000 (78.60%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRNQ 3083
            M+ AH  S  DVL  F V+ E GL+ +Q+  ++E YG N LP EEGK LW+LV+EQF+DLLV+ILL AA++SF+LAWF+  E++TTAFVEP VI+LIL+ NA+VGVWQE+NAESAI+ALKEYE E  KVIRS+ KG+Q I+A  +VPGDIVEV+VGDKVPAD+R+++I STTL++DQSILTGES SV KH+D I D  AVNQDK NMLFSGTN+ASGK  GV  + GL TE+GKIR Q+   +  +TPL +KLD F  QLS  I+VIC+ VW+INIGHF DP HGGS LRGA+YYFKIAVALAVAAIPEGLPAVITTCL+LGT RMA+KNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V RMF+V         + EF ISG+ Y+P+G++   E+ V+C     L E+A IC+LCNDS++++NE+KGVYEKVGEATETAL CLVEKMN+ + +    S+ + +  CNS I+  + KEFTLEFSRDRKSMS + +P   +  VQ         G ++ VKGAPE +++RC+ VR       ++ + ++ I+ K+  +G+G DTLRCLALA  D P  +  M   +   F +YE+++TFVG VGMLDPPR EV   I  C  AGIRV++ITGDNK TA AICRR+GIFG+ E  +GK+YTGREFD LS  +QR A R A  FARVEPAHKS+I+E+LQ   EI+AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSA++MVL+DDNF++IVAAVEEGRAIYNNMKQFIRYLISSN+GEVVCIFLTA LG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIME+PPR+P+E+LISGWLFFRY+AIG YVG ATV +A WWF+    GP V++YQL + L+C+ +   F G+DCKVF    P TMALSVLV IEM NALNS+SENQSL++MPPW N WL+ A+ +SM+LHFLIL V  L  +FQ++PLS  +W  V++ S PV+LLDE+LK +SRN 
Sbjct:    1 MEEAHLLSAADVLRRFSVTAEGGLSLEQVTDARERYGPNELPTEEGKSLWELVVEQFEDLLVRILLLAALVSFVLAWFEEGEETTTAFVEPLVIMLILVANAIVGVWQERNAESAIEALKEYEPEMGKVIRSDRKGVQRIRARDIVPGDIVEVAVGDKVPADLRLIEIKSTTLRVDQSILTGESVSVTKHTDAIPDPRAVNQDKKNMLFSGTNIASGKALGVAVATGLQTELGKIRSQMAAVEPERTPLQRKLDEFGRQLSHAISVICVAVWVINIGHFADPAHGGSWLRGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMARKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFVVAEAEAGTCRLHEFTISGTTYTPEGEVRQGEQPVRCGQFDGLVELATICALCNDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTDLKGLSRVERAGACNSVIKQLMRKEFTLEFSRDRKSMSVYCTPTRADPKVQ---------GSKMFVKGAPESVIERCSSVRVGSRTAPLSTTSREHILAKIRDWGSGSDTLRCLALATRDTPPRKEDMHLDDCSRFVQYETDLTFVGCVGMLDPPRPEVAACITRCSRAGIRVVMITGDNKGTAVAICRRLGIFGDTEDVLGKAYTGREFDDLSPEQQRQACRTARCFARVEPAHKSRIVENLQSFNEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLSDDNFASIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAILGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKPPRNPREALISGWLFFRYLAIGVYVGLATVAAATWWFLYDTEGPQVTFYQLRNFLKCSEDNPLFAGIDCKVFESRFPTTMALSVLVTIEMCNALNSVSENQSLLRMPPWLNPWLLGAVVMSMALHFLILLVPPLPLIFQVTPLSGRQWGVVLQMSLPVILLDEALKYLSRNH 991          
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Match: sp|Q7PPA5|ATC1_ANOGA (Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Anopheles gambiae OX=7165 GN=SERCA PE=3 SV=5)

HSP 1 Score: 1360.51 bits (3520), Expect = 0.000e+0
Identity = 692/1028 (67.32%), Postives = 814/1028 (79.18%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRNQQHRKSIFTNCHLIVLMWGLFAAAVLYCP 3167
            M++ HSK+V +VL  F V  E GL+  Q++  Q+ YG N LP EEGK LW+LVLEQFDDLLVKILL AAIISF+LA F+  E    AFVEPFVILLILI NAVVGVWQE+NAESAI+ALKEYE E  KVIR +  G+Q I+A ++VPGD+VEVSVGDK+PADIR++KI+STT++IDQSILTGES SVIKH+D + D  AVNQDK N+LFSGTNVA+GK RGVV   GLNT IGKIR ++  T+++KTPL +KLD F EQLSKVI++IC+ VW INIGHFNDP HGGS ++GA+YYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+VSRMFI   +  + +   EFEISGS Y P G++    +R+K +D   L+E+  IC +CNDS+++FNE+K V+EKVGEATETAL+ L EK+N  N+ K    ++  +     +I++   KEFTLEFSRDRKSMS++ +P+       + + N    GP+L  KGAPEG+L+RCT  R    +V +T ++K +I+     YGTG+DTLRCLALA  D P+    MD  ++  FY YE N+TFVG+VGMLDPPR EV DSI  CR AGIRVIVITGDNKATAEAICRRIG+FGEDE T GKSY+GREFD LS  EQR A   A LF+RVEPAHKSKI+E LQ   EISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSA++MVLADDNFS+IVAAVEEGRAIYNNMKQFIRYLISSNIGEVV IFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM +PPR   E LISGWLFFRYMAIG YVG ATVG AAWWFM S  GP +SY+QLTHHL C     +F G+DCK+F    PMTMALSVLV IEMLNA+NSLSENQSLV+MPPW NIWLI ++ LS +LHF+IL V  LS VFQ++PL  +EW+TVMKFS PV+LLDE LK ++R     +S   N H +VL W +F A +++ P
Sbjct:    1 MEDGHSKTVDEVLSHFRVDPERGLSLDQVKEYQKKYGPNELPAEEGKTLWQLVLEQFDDLLVKILLLAAIISFVLALFEEHE-GVEAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYEPEMGKVIRGDKSGVQKIRAKEIVPGDVVEVSVGDKIPADIRLIKIYSTTIRIDQSILTGESVSVIKHTDAVPDPRAVNQDKKNILFSGTNVAAGKARGVVIGTGLNTAIGKIRTEMSETEEIKTPLQQKLDEFGEQLSKVISLICVAVWAINIGHFNDPAHGGSWIKGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRMFIFEKIEGNDSSFTEFEISGSTYEPIGEVTLNGQRIKAADYETLHELGTICIMCNDSAIDFNETKKVFEKVGEATETALIVLAEKLNPFNVAKQGLDRRSSAICVRQEIETKWKKEFTLEFSRDRKSMSSYCTPLK-----ASKLGN----GPKLFCKGAPEGVLERCTHARVGSTKVPLTQTLKQRILDLTRTYGTGRDTLRCLALATADSPMKPDDMDLNDSTKFYTYEVNLTFVGVVGMLDPPRKEVQDSIVRCRAAGIRVIVITGDNKATAEAICRRIGVFGEDEDTTGKSYSGREFDDLSVSEQREACSRARLFSRVEPAHKSKIVEFLQSMNEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLADDNFSSIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMTKPPRKADEGLISGWLFFRYMAIGGYVGCATVGGAAWWFMFSETGPQLSYWQLTHHLSCLGGGEEFKGIDCKIFNDPHPMTMALSVLVTIEMLNAMNSLSENQSLVQMPPWCNIWLIASMCLSFALHFVILYVDVLSTVFQVTPLDGNEWMTVMKFSLPVVLLDEILKFVARRISDGESYIKNMHGLVLAWAVFFAYIIWGP 1018          
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Match: sp|P70083|AT2A1_MAKNI (Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Makaira nigricans OX=13604 GN=atp2a1 PE=2 SV=2)

HSP 1 Score: 1342.02 bits (3472), Expect = 0.000e+0
Identity = 673/999 (67.37%), Postives = 802/999 (80.28%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRN 3080
            M+NAH+KS  + L +F V++  GL+  Q + + + +G N LP EEGK +W L++EQF+DLLV+ILL AA ISF+LAWF+  E++ TAFVEPFVILLILI NA+VGVWQE+NAE AI+ALKEYE E  KV RS+ K +Q IKA ++VPGDIVEVSVGDKVPADIRIV I STTL++DQSILTGES SVIKH++ + D  AVNQDK NMLFSGTN+A+GK  GV  + G++TEIGKIRDQ+  T+Q KTPL  KLD F EQLSKVI++IC+ VW INIGHFNDP+HGGS +RGA+YYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM V++MFIV++V+ D  D+  F+ISGSKY+P+G++     +  CS    L E+A IC+LCNDSS+++NESK +YEKVGEATETAL CLVEKMN+ N N    S+ + +  C + I+  + K FTLEFSRDRKSMS + +P   +G            G ++ VKGAPEG++DRC +VR    RV +T++IK++IM  +  +GTG+DTLRCLALA  D P+    M+  ++  F  YE++MTFVG VGMLDPPR EV  SI  CR+AGIRVI+ITGDNK TA AICRRIGIF EDE    K+YTGREFD L   +Q  AVR A  FARVEP+HKSKI+E LQ + +I+AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAS+MVLADDNFS+IVAAVEEGRAIYNNMKQFIRYLISSN+GEVVCIFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM +PPRSPKE LISGWLFFRYMAIG YVGAATVG AAWWF+    GP+V+YYQL+H +QC     DF GVDC +F  S PMTMALSVLV IEM NALNSLSENQSL++MPPW N+WL+ A+TLSMSLHF+I+ V  L  +F+++ L+F +WL V K SFPV+L+DE LK  +RN
Sbjct:    1 MENAHTKSPAECLSYFGVNEHTGLSPDQFKKNLDKFGYNELPAEEGKSIWDLIVEQFEDLLVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILIANAIVGVWQERNAEDAIEALKEYEPEMGKVYRSDRKSVQRIKAREIVPGDIVEVSVGDKVPADIRIVSIKSTTLRVDQSILTGESVSVIKHTESVPDPRAVNQDKKNMLFSGTNIAAGKAIGVAIATGVSTEIGKIRDQMAATEQEKTPLQAKLDEFGEQLSKVISLICVAVWAINIGHFNDPVHGGSWIRGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMCVTKMFIVKSVDGDHVDLNAFDISGSKYTPEGEVSHGGSKTNCSAYDGLVELATICALCNDSSLDYNESKKIYEKVGEATETALCCLVEKMNVFNSNVKNLSRIERANACCTVIKQLMKKNFTLEFSRDRKSMSVYCTPAKGDG------------GAKMFVKGAPEGVIDRCAYVRVGTTRVPLTSAIKEKIMAVIRDWGTGRDTLRCLALATRDTPLKVEEMNLEDSTKFADYETDMTFVGCVGMLDPPRKEVTGSIELCRDAGIRVIMITGDNKGTAIAICRRIGIFKEDEDVSNKAYTGREFDDLPSQDQAEAVRRACCFARVEPSHKSKIVEFLQGNDDITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSSIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMGKPPRSPKEPLISGWLFFRYMAIGGYVGAATVGGAAWWFLYDSTGPAVTYYQLSHFMQCHNHNEDFTGVDCDIFEASPPMTMALSVLVTIEMCNALNSLSENQSLIRMPPWSNLWLMAAMTLSMSLHFMIIYVDPLPMIFKLTHLTFDQWLMVFKLSFPVILIDEVLKFFARN 987          
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Match: sp|P22700|ATC1_DROME (Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Drosophila melanogaster OX=7227 GN=SERCA PE=1 SV=2)

HSP 1 Score: 1339.71 bits (3466), Expect = 0.000e+0
Identity = 690/1020 (67.65%), Postives = 815/1020 (79.90%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRNQQHRKSIFTNCHLIVLMWGLF 3143
            M++ HSK+V   L+FF    E GLT  QI+ +Q+ YG N LP EEGK +W+LVLEQFDDLLVKILL AAIISF+LA F+  E++ TAFVEP VILLILI NAVVGVWQE+NAESAI+ALKEYE E  KV+R +  GIQ ++A ++VPGD+VEVSVGDK+PADIRI  I+STTL+IDQSILTGES SVIKH+D I D  AVNQDK N+LFSGTNVA+GK RGVV   GL+T IGKIR ++  T+++KTPL +KLD F EQLSKVI+VIC+ VW INIGHFNDP HGGS ++GAIYYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+VSRMFI   V  + +   EFE++GS Y P G++F   +R+K +D   L E++ IC +CNDS++++NE K  +EKVGEATETAL+ L EK+N  ++NKS   ++  +  C  +I++   KEFTLEFSRDRKSMS++ +P+           +   TGP+L VKGAPEG+L+RCT  R    +V +T+++K +I+     YGTG+DTLRCLALA  D P+    MD  ++  FY+YE N+TFVG+VGMLDPPR EV DSI  CR AGIRVIVITGDNKATAEAICRRIG+F EDE T GKSY+GREFD LS  EQ+ AV  + LF+RVEP HKSKI+E LQ   EISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSA++MVLADDNFS+IV+AVEEGRAIYNNMKQFIRYLISSNIGEVV IFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIME+PPR   E LISGWLFFRYMAIG YVGAATVG+AAWWF+ S  GP +SY+QLTHHL C    ++F GVDCK+F     MTMALSVLV IEMLNA+NSLSENQSL+ MPPW N+WLI ++ LS +LHF+IL V  LS VFQ++PLS  EW+TVMKFS PV+LLDE+LK ++R     +S     H IVLMW +F
Sbjct:    1 MEDGHSKTVEQSLNFFGTDPERGLTLDQIKANQKKYGPNELPTEEGKSIWQLVLEQFDDLLVKILLLAAIISFVLALFEEHEETFTAFVEPLVILLILIANAVVGVWQERNAESAIEALKEYEPEMGKVVRQDKSGIQKVRAKEIVPGDLVEVSVGDKIPADIRITHIYSTTLRIDQSILTGESVSVIKHTDAIPDPRAVNQDKKNILFSGTNVAAGKARGVVIGTGLSTAIGKIRTEMSETEEIKTPLQQKLDEFGEQLSKVISVICVAVWAINIGHFNDPAHGGSWIKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRMFIFDKVEGNDSSFLEFEMTGSTYEPIGEVFLNGQRIKAADYDTLQELSTICIMCNDSAIDYNEFKQAFEKVGEATETALIVLAEKLNSFSVNKSGLDRRSAAIACRGEIETKWKKEFTLEFSRDRKSMSSYCTPLKA---------SRLGTGPKLFVKGAPEGVLERCTHARVGTTKVPLTSALKAKILALTGQYGTGRDTLRCLALAVADSPMKPDEMDLGDSTKFYQYEVNLTFVGVVGMLDPPRKEVFDSIVRCRAAGIRVIVITGDNKATAEAICRRIGVFAEDEDTTGKSYSGREFDDLSPTEQKAAVARSRLFSRVEPQHKSKIVEFLQSMNEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLADDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKPPRKADEGLISGWLFFRYMAIGFYVGAATVGAAAWWFVFSDEGPKLSYWQLTHHLSCLGGGDEFKGVDCKIFSDPHAMTMALSVLVTIEMLNAMNSLSENQSLITMPPWCNLWLIGSMALSFTLHFVILYVDVLSTVFQVTPLSAEEWITVMKFSIPVVLLDETLKFVARKIADGESPIYKMHGIVLMWAVF 1011          
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Match: sp|Q9YGL9|AT2A3_CHICK (Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Gallus gallus OX=9031 GN=ATP2A3 PE=2 SV=1)

HSP 1 Score: 1335.47 bits (3455), Expect = 0.000e+0
Identity = 660/1000 (66.00%), Postives = 792/1000 (79.20%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRNQ 3083
            M+ AHS  V DVL  F V++  GL+ +Q+  ++E YG N LP EE K LW+LVLEQF+DLLV+ILL AA +SFILAWF+  E+STTAFVEP VI++ILI NAVVGVWQE+NAESAI+ALKEYE E  KVIR++  G+Q I+A  +VPGDIVEV+VGDKVPADIRI++I STTL++DQSILTGES SVIKH+D I D  AVNQDK NMLFSGTN+A+GK  G+V + G+ TEIGKIR+Q++ T+  KTPL +KLD F++QLSKVI ++CI VW+INI HF+DP+HGGS  RGAIYYFK +VALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V RMFI+  V      + EF I+GS Y+P+G I   EK V+C     L E+A IC+LCNDSS+++NESK VYEKVGEATETAL CLVEKMN+ + + S  SK + +  CNS I+  + KE TLEFSRDRKSMS + +P  P          HN  G ++ VKGAPE +++RCT VR    +V +T  ++++I+ ++  +G G DTLRCLALA  D PV R  M   ++  F  YE+N+TFVG VGMLDPPR EV  SI  CR AGIRVI+ITGDNK TA AICRRIGIF E E   GK+YTGREFD+LS   QR A R A  FARVEPAHKS+I+E+LQ   EI+AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSA++MVL+DDNFSTIV+AVEEGRAIYNNMKQFIRYLISSN+GEVVCIFLTA LG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM++ PR+PKE LISGWLFFRY+AIG YVG ATVG+A WWF+    GP VS++QL + ++C  +   F GV+C++F    P TMALSVLV IEM NALNS+SENQSL++MPPW NIWL+ AI +SM+LHF IL V  +  +FQ++PLS+ +W+ V+K S PV+LLDE LK +SRN 
Sbjct:    1 MEAAHSVPVQDVLSRFGVAESCGLSPEQVRRNREKYGPNELPAEERKSLWELVLEQFEDLLVRILLMAAFLSFILAWFEEGEESTTAFVEPIVIIMILIANAVVGVWQERNAESAIEALKEYEPEMGKVIRADRSGVQRIRARDIVPGDIVEVAVGDKVPADIRIIEIRSTTLRVDQSILTGESMSVIKHADPIPDPRAVNQDKKNMLFSGTNIAAGKAVGIVIATGVYTEIGKIRNQMVETEPEKTPLQQKLDEFSQQLSKVIFLVCIAVWVINISHFSDPVHGGSWFRGAIYYFKTSVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFIMEKVEGTQCSLHEFSITGSTYAPEGQILKDEKPVRCGQYDGLVELATICALCNDSSLDYNESKKVYEKVGEATETALTCLVEKMNVFDTDTSKLSKVERANACNSVIKHLMRKECTLEFSRDRKSMSVYCTPTGP---------GHNSAGSKMFVKGAPESVIERCTHVRVGTAKVPLTPPVREKILSQIRDWGMGTDTLRCLALATHDAPVQRETMQLHDSTTFTHYETNLTFVGCVGMLDPPRKEVTSSIEMCRKAGIRVIMITGDNKGTAVAICRRIGIFTESEDVAGKAYTGREFDELSPEAQRQACREARCFARVEPAHKSRIVEYLQSFNEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLSDDNFSTIVSAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAILGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDKLPRNPKEPLISGWLFFRYLAIGVYVGLATVGAATWWFLYDAEGPQVSFHQLRNFMRCTEDNPIFEGVNCEIFESRYPTTMALSVLVTIEMCNALNSVSENQSLLRMPPWLNIWLLGAIVMSMALHFFILYVKPMPLIFQVTPLSWPQWVVVLKISLPVILLDEGLKYLSRNH 991          
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Match: sp|Q292Q0|ATC1_DROPS (Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=SERCA PE=3 SV=2)

HSP 1 Score: 1324.3 bits (3426), Expect = 0.000e+0
Identity = 679/999 (67.97%), Postives = 805/999 (80.58%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRN 3080
            M++ HSK+V   L+FF    E GLT  QI+ +Q  YG N LP EEGK +W+LVLEQFDDLLVKILL AAIISF+LA F+  E++ TAFVEP VILLILI NAVVGVWQE+NAESAI+ALKEYE E  KVIR +  GIQ ++A ++VPGD+VEVSVGDK+PADIR+  I+STT++IDQSILTGES SVIKH+D I D  AVNQDK N+LFSGTNVA+GK RGVV   GL+T IGKIR ++  T+++KTPL +KLD F EQLSKVI+VIC+ VW INIGHFNDP HGGS ++GAIYYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+VSRM I   V  + +   EFE++GS Y P G++F   +RVK SD   L E+A +C +CNDS++++NE K  +EKVGEATETAL+ L EK+N  ++NKS   ++  +     +I++   KEFTLEFSRDRKSMS++ +P+           +   TGP+L VKGAPEG+LDRCT  R    +V +T+++K +I+     YGTG+DTLRCLALA  D P+    MD  ++  FY+YE N+TFVG+VGMLDPPR EV D+I  CR AGIRVIVITGDNKATAEAICRRIG+F E+E T GKSY+GREFD LS  EQ+ AV  + LF+RVEP HKSKI+E+LQ   EISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSA++MVLADDNFS+IV+AVEEGRAIYNNMKQFIRYLISSNIGEVV IFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM++PPR   E LISGWLFFRYMAIG YVGAATVG+AAWWF++S  GP ++Y+QLTHHL C    ++F GVDCK+F   K MTMALSVLV IEMLNA+NSLSENQSL+ MPPW N+WLI ++ LS +LHF+IL V  LS VFQ++PLS  EW+TVMKFS PV+LLDE+LK ++R 
Sbjct:    1 MEDGHSKTVEQSLNFFGTDGERGLTLDQIKTNQAKYGPNELPTEEGKSIWQLVLEQFDDLLVKILLLAAIISFVLALFEEHEETFTAFVEPLVILLILIANAVVGVWQERNAESAIEALKEYEPEMGKVIRQDKSGIQKVRAKEIVPGDLVEVSVGDKIPADIRLTHIYSTTIRIDQSILTGESVSVIKHTDAIPDPRAVNQDKKNILFSGTNVAAGKARGVVIGTGLSTAIGKIRTEMSETEEIKTPLQQKLDEFGEQLSKVISVICVAVWAINIGHFNDPAHGGSWIKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRMLIFEKVEGNDSSFLEFELTGSTYEPIGELFLGGQRVKASDYEALQELATVCIMCNDSAIDYNEFKAAFEKVGEATETALIVLAEKLNAFSVNKSGLDRRSNAIAARGEIETKWKKEFTLEFSRDRKSMSSYCTPLKA---------SRLGTGPKLFVKGAPEGVLDRCTHARVGTSKVPLTSALKAKILALTGQYGTGRDTLRCLALAVADSPIRPEDMDLGDSTKFYQYEVNLTFVGVVGMLDPPRKEVFDAIVRCRAAGIRVIVITGDNKATAEAICRRIGVFTEEEDTTGKSYSGREFDDLSIAEQKAAVARSRLFSRVEPQHKSKIVEYLQGMNEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLADDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDKPPRKADEGLISGWLFFRYMAIGFYVGAATVGAAAWWFIASSEGPGLTYWQLTHHLSCLGGGDEFKGVDCKIFSDPKAMTMALSVLVTIEMLNAMNSLSENQSLISMPPWCNLWLIGSMALSFTLHFVILYVDVLSTVFQVTPLSAEEWITVMKFSIPVVLLDETLKFVARK 990          
BLAST of Calcium-transporting ATPase vs. TrEMBL
Match: A0A0U1ZY67 (Calcium-transporting ATPase OS=Hyriopsis cumingii OX=165450 PE=2 SV=1)

HSP 1 Score: 1443.71 bits (3736), Expect = 0.000e+0
Identity = 716/1025 (69.85%), Postives = 845/1025 (82.44%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRNQQHRKSIFTNCHLIVLMWGLFAAAVL 3158
            M+ AH+KSV +VL+ F+V +  GLTD Q++ ++E YG N LP EEGKPLW+L+LEQFDDLLVKILL AA+ISF+LAWF+ SE+  TAFVEPFVIL ILI NA+VGVWQE+NAESAI+ALKEYE E AKV+R NH+G+Q I+A+ LVPGD+VE+SVGDK PADIR+  +HSTTL++DQSILTGES SV+KH+D I D  AVNQDK N+LFSGTN+A+GKCRG+V   GLNTEIGKIR+++M T+  KTPL +KLD F  QLSKVITVICI VW INIGHFNDP HGGS ++GAIYYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+VS+MF    +     +IQ+F+I+GS Y+P+GD++   K+VK +D   L E+  IC +CNDSSV++NE+K ++EKVGEATETAL  LVEK+N  N +KS+ SKK+ STVCN  IQ    KEFTLEFSRDRKSMS +  P  P        R  N  GP++  KGAPEG+LDRCT VR    +V M+ +I+++IMK V AYGTG+DTLRCLALA +D P +R  MD  ++  F +YE+NMTFVG+VGMLDPPR EVL SI  CR+AGIRVIVITGDNKATAEAICRRIGIFGE+EST G S+TGREFD+LS  +QR AV  A LFARVEP HKSKI+EHLQ +GEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNF+TIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALG+PEALIPVQLLWVNLVTDG PATALGFNPPD+DIM+RPPRSPKESLI+GWLFFRYMAIG YVG ATVG+AAWWFM   +GP ++YYQLTHH+QC  EP +F G++C +F H  PMTMALSVLV IEMLNALNSLSENQSL+ MPPW N WL+ AI LSM LHF IL V F++ +FQI+PL+  +W  V+K SFPV+++DE+LK I+R     K+I     L++L+W ++   ++
Sbjct:    1 MELAHTKSVEEVLEHFNVDENVGLTDDQVKKAREKYGPNELPAEEGKPLWELILEQFDDLLVKILLLAAVISFVLAWFEESEEQVTAFVEPFVILTILICNAIVGVWQERNAESAIEALKEYEPEIAKVVRQNHRGVQRIRASLLVPGDVVEISVGDKNPADIRVTTVHSTTLRVDQSILTGESVSVMKHTDPIPDPRAVNQDKKNILFSGTNIAAGKCRGIVIGTGLNTEIGKIRNEMMDTEAEKTPLQQKLDEFGNQLSKVITVICIAVWAINIGHFNDPAHGGSWVKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSKMFYFSKIEGSEINIQQFDITGSTYAPEGDLYTNGKKVKGNDYGGLEELMLICGICNDSSVDYNEAKDIFEKVGEATETALTVLVEKVNFYNTDKSSLSKKERSTVCNQIIQQMWKKEFTLEFSRDRKSMSVYCVPNKP-------TRTPN--GPKMFCKGAPEGLLDRCTHVRVGGNKVPMSPAIRNEIMKHVKAYGTGRDTLRCLALATIDNPPAREGMDLEDSRKFIQYETNMTFVGVVGMLDPPREEVLQSIKDCRDAGIRVIVITGDNKATAEAICRRIGIFGENESTEGISFTGREFDELSPEDQRQAVMRARLFARVEPTHKSKIVEHLQAEGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFATIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGIPEALIPVQLLWVNLVTDGFPATALGFNPPDMDIMKRPPRSPKESLITGWLFFRYMAIGVYVGCATVGAAAWWFMVYEDGPKLNYYQLTHHMQCPAEPKNFQGIECSIFNHPTPMTMALSVLVTIEMLNALNSLSENQSLIVMPPWINKWLLGAIVLSMGLHFFILYVDFMATIFQITPLNLVQWAAVLKLSFPVIIIDETLKFIARKFADGKNILYEFSLLILVWSVYLGMMI 1016          
BLAST of Calcium-transporting ATPase vs. TrEMBL
Match: R7UQP2 (Calcium-transporting ATPase OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_165811 PE=3 SV=1)

HSP 1 Score: 1434.47 bits (3712), Expect = 0.000e+0
Identity = 726/1032 (70.35%), Postives = 846/1032 (81.98%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDST---TAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRNQQHRKSIFTNCHLIVLMWGLFAAAVLYCPL 3170
            MD++H+KSV +V+++F      GL+D+Q+  +QE YG N LP EEGK LW+L+LEQFDDLLVKILL AAIISFILAWF+ SE+     TAFVEPFVILLILI NAVVGVWQE+NAESAI+ALKEYE E AKVIR NHKG+Q IKA +LVPGDIV+VSVGDKVP+D+RIV+I STTL++DQ+ILTGES SV+KH D I D  AVNQDK N+LFSGTN+A+GK RG+V   GLNTEIGKIR ++  T+  KTPL +KLD F +QLSKVI+++C+ VW INIGHFNDP HGGS ++GAIYYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V RMF+   +     ++Q+FEI+G+ Y+P+G+IF   K VK SD   L E++ IC+LCNDSSV+FNE+KGVYEKVGEATETAL  L EK+N+TN++KS++ KK+L T+CN  +QS   K+FTLEFSRDRKSMS++  P     + QT +      GP++ VKGAPEG+LDRC+F R    RV MT +IK +IMK V  YGTG+DTLRCLALA +D PV +  M+  +   F KYE+N TFVG+VGMLDPPR+EV+DSI  CR AGIRVIVITGDNKATAEAICRRIG+F E E+T GKS+TGREFD LS  EQ  AVR A LFARVEPAHKSKIIE LQ DGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAS+M+LADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM +PPR+PKE LISGWLFFRYMAIG YVG ATVGSAAWWF     GP ++YYQLTHH+QC  EP  F  +DC +F    PMTMALSVLV+IEMLNALNS+SENQSL  MPPW N WL+ A+ LSMSLHFLILEV FLS VFQI+PL   EW+ V+K SFPV+LLDE+LK ++R     K+ F+  + +V +W ++   VL+ P+
Sbjct:    1 MDDSHTKSVDEVVNYFKTDIASGLSDEQVARAQEKYGPNELPAEEGKTLWELILEQFDDLLVKILLLAAIISFILAWFEESEEQMEQITAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYEPEIAKVIRKNHKGVQKIKARELVPGDIVDVSVGDKVPSDLRIVQIFSTTLRVDQAILTGESVSVLKHYDAIPDPRAVNQDKKNVLFSGTNIAAGKARGLVVGTGLNTEIGKIRTEMTETETEKTPLQQKLDEFGQQLSKVISIVCVAVWAINIGHFNDPAHGGSWMKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFMFEKIEAGNMNVQQFEITGTTYAPEGEIFSNGKPVKASDYDSLQELSTICALCNDSSVDFNEAKGVYEKVGEATETALTVLCEKLNVTNVDKSSFKKKELGTICNQALQSQWTKDFTLEFSRDRKSMSSYCIP-----NKQTKLG----PGPKMFVKGAPEGLLDRCSFCRVGSQRVPMTPAIKAEIMKHVGHYGTGRDTLRCLALATIDTPVKKEDMNLEDYTKFIKYETNCTFVGVVGMLDPPRTEVMDSIKECRKAGIRVIVITGDNKATAEAICRRIGVFSETETTDGKSFTGREFDDLSPEEQAKAVRCARLFARVEPAHKSKIIEFLQADGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMILADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYMAIGIYVGCATVGSAAWWFTMYEKGPQLNYYQLTHHMQCPAEPRMFPSIDCNIFTDPHPMTMALSVLVVIEMLNALNSISENQSLTLMPPWYNYWLLGAMVLSMSLHFLILEVDFLSAVFQITPLGMEEWMAVLKISFPVILLDETLKFVARKFTDGKNPFSQIYWMVGVWAVYIGLVLHSPI 1023          
BLAST of Calcium-transporting ATPase vs. TrEMBL
Match: A0A4S2M491 (Calcium-transporting ATPase OS=Opisthorchis felineus OX=147828 GN=CRM22_002807 PE=3 SV=1)

HSP 1 Score: 1429.46 bits (3699), Expect = 0.000e+0
Identity = 728/1037 (70.20%), Postives = 840/1037 (81.00%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTD--------IQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRNQQHRKSIFTNCHLIVLMWGLFAAAVLYCPL 3170
            M++A+  +   VL+FF  ++E GL++KQ+ ++ E  G N LP EE KPLW+LVLEQFDDLLVKILLSAA ISFILAWF+ SED+TTAFVEP VI+LILILNA+VGVWQE+NAESAI+ALKEYES+ AKVIR  H+G QT+KA +LVPGDIVEVSVGD+VPADIR+  I STTL++DQSILTGES SV+KHSD I    AVNQDK NMLFSGTNVASG+CRGVV   G+NTEIGKIRDQIMH++  +TPL +K+D F  QLSKVIT+ICI VW INIGHFNDP+HGGS LRGAIYYFKIAVALAVAAIPEGLPAVITTCL+LGT RMA+KNAIVRSLPSVETLGCT+VICSDKTGTLTTNQMTV RMF   +    G            EFEI+GSKY+P+G I  + ++V CS+ P L E+A IC+LCNDS VE+NESKG YEKVGEATETAL+CLVEKMN++ + K+  + +QL+  C+  +Q   +KEFTLEFSRDRKSMS FV P N  GD      +H     +L VKGAPE ILDRCT VRT  GRV +T  +KD+I++K+A Y TG++TLRCLALA  D+P + S  +  +  NF +YE+ +T VG+VGMLDPPR EV DSI AC NAGIRVIVITGDNKATAEAICRRIG+FGE E T GK++TGREFD LS  E+R AVR A LFARVEPAHKS+I+++LQ DGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVV IFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM++PPR+ KE LISGWLF RYMAIGCYVG ATVGSAAWWFM    GP ++YYQLTHHLQC  EP+ F+GV C VF   KPMTMALSVLVLIEM NALNSLSENQSLV MPPWRN+WL++AI+ SM LHF IL +   +K+FQIS L+ +EW  V+K S PVLLLDE+ K I+R    RK+  +    +  MW  +A  +   PL
Sbjct:    1 MEDAYCHTTSQVLEFFHTTEETGLSEKQVAIALEENGFNELPPEETKPLWRLVLEQFDDLLVKILLSAATISFILAWFEDSEDATTAFVEPLVIMLILILNAIVGVWQERNAESAIEALKEYESDTAKVIRQGHRGPQTVKARELVPGDIVEVSVGDRVPADIRLTSIMSTTLRVDQSILTGESVSVLKHSDPISSSRAVNQDKKNMLFSGTNVASGRCRGVVVGTGMNTEIGKIRDQIMHSETDRTPLGQKIDEFGTQLSKVITLICIAVWCINIGHFNDPVHGGSWLRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMARKNAIVRSLPSVETLGCTTVICSDKTGTLTTNQMTVVRMFSFASGAPGGAQSGDGRPLAFDEFEITGSKYAPEGSIIRKGQKVNCSEHPCLVELAHICALCNDSGVEYNESKGHYEKVGEATETALICLVEKMNVSGVCKTGLTNRQLAMACSHDLQHLYHKEFTLEFSRDRKSMSTFVIP-NSRGD-----GSHG----KLFVKGAPESILDRCTQVRTPNGRVLLTPELKDEILRKLATYATGRETLRCLALASRDDPPASSLFNLTDPTNFKEYETGLTLVGVVGMLDPPRCEVADSIRACANAGIRVIVITGDNKATAEAICRRIGLFGEKEDTRGKAFTGREFDMLSLTEKREAVRRAKLFARVEPAHKSEIVQYLQEDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMQKPPRNSKEPLISGWLFLRYMAIGCYVGVATVGSAAWWFMKYSGGPRITYYQLTHHLQCTLEPSAFVGVPCSVFSSPKPMTMALSVLVLIEMFNALNSLSENQSLVSMPPWRNVWLVIAISFSMFLHFAILYIDVFAKIFQISALNLAEWSAVVKISLPVLLLDETQKAIARCVSERKNPLSQLPALSAMWLGYALLLYRFPL 1027          
BLAST of Calcium-transporting ATPase vs. TrEMBL
Match: A0A4E0RER1 (Calcium-transporting ATPase OS=Fasciola hepatica OX=6192 GN=D915_001840 PE=3 SV=1)

HSP 1 Score: 1427.54 bits (3694), Expect = 0.000e+0
Identity = 711/999 (71.17%), Postives = 827/999 (82.78%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRN 3080
            M+NA++K V++VL  FDV  E GL+D+Q++     YG N LP EE KPLW+LVLEQFDDLLVKILL AAIISF+LA F+ SE++ +AFVEPFVILLIL+ NAV+GVWQE+NAESAI+ALKEYE E AKV R +H GIQ IKA +LVPGD+VEVSVGDKVPAD+RI+KI STTL++DQSILTGES SVIK ++ + D  AVNQDK N+LFSGTN+A+GK RGVVT  GL TEIGKIR+Q+M T+Q +TPL +KLD F +QLSKVI++IC+ VW INIGHFNDP HGGS L+GAIYYFKIAVALAVAAIPEGLPAVITTCL+LGT RMA KNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V RMF+    ++   ++  FEI+GSKY+P+G++F   +RV+  D   L E+A IC++CNDS++++NE+K VYEKVGEATETAL CLVEKMN+   +K+  SKK LS VCN +IQS   KEFTLEFSRDRKSMS ++ P  P    +         GPR+ VKGAPEG+LDRCTFVR    +V M   +K +I K VAAYGTG+DTLRCLALA  D P ++++MD  +A  F KYE N+TFVG+VGMLDPPR EV+DSI  CR +GIRVI+ITGDNKATAEAICRRIGIFGEDE T GKS+TGREFD L   EQR A R A LFARVEP HKSKI+E LQ DGE+SAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSA+DMVLADDNF +IV AVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALG+PEALIPVQLLWVNLVTDG PATALGFNPPDLDIM RPPR+ K+ LISGWLFFRYMA+G YVG ATVG+AAWWF   P GP ++YYQLTH  QC  + + F GVDC +F+H KPMTMALS LVLIEMLNA+NSLSENQSLV MPPW N+WL+LA+ +S++LHFLILEV FLSKVFQI+PLS  EW TV+K SFPV+L+DE LK+I+R 
Sbjct:    1 MENAYAKEVNEVLAHFDVDAETGLSDEQVKRQAAKYGPNELPAEETKPLWRLVLEQFDDLLVKILLLAAIISFVLALFEESEETISAFVEPFVILLILVANAVIGVWQERNAESAIEALKEYEPEIAKVYRKSHYGIQRIKARELVPGDVVEVSVGDKVPADMRIIKILSTTLRVDQSILTGESVSVIKFTEAVPDPRAVNQDKKNLLFSGTNIAAGKARGVVTCTGLMTEIGKIRNQMMDTEQDRTPLQQKLDEFGQQLSKVISIICVAVWAINIGHFNDPAHGGSWLKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAAKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFVFSKADERSAEVCHFEITGSKYAPEGEVFLNGQRVEAGDHEGLLEIAHICAMCNDSAIDYNETKHVYEKVGEATETALSCLVEKMNIYKTSKAGLSKKDLSMVCNHQIQSLWTKEFTLEFSRDRKSMSVYLLP-KPNAGTKIPSAGSAEAGPRMFVKGAPEGVLDRCTFVRVGGKKVPMNPILKAEIAKNVAAYGTGRDTLRCLALASCDTPSNKNQMDLQDAKKFVKYEQNLTFVGVVGMLDPPRMEVMDSIIKCRKSGIRVIMITGDNKATAEAICRRIGIFGEDEPTTGKSFTGREFDALPIEEQREACRRARLFARVEPMHKSKIVEFLQEDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAADMVLADDNFRSIVLAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGLPEALIPVQLLWVNLVTDGFPATALGFNPPDLDIMTRPPRNIKDPLISGWLFFRYMAVGIYVGCATVGAAAWWFTLYPKGPQLNYYQLTHQSQCLAQESRFEGVDCAIFIHPKPMTMALSTLVLIEMLNAMNSLSENQSLVVMPPWVNMWLVLAMVVSLALHFLILEVDFLSKVFQITPLSLEEWFTVLKISFPVILIDEVLKLIARK 998          
BLAST of Calcium-transporting ATPase vs. TrEMBL
Match: B2KKR1 (Calcium-transporting ATPase OS=Pinctada fucata OX=50426 GN=SERCA PE=2 SV=1)

HSP 1 Score: 1425.61 bits (3689), Expect = 0.000e+0
Identity = 717/1033 (69.41%), Postives = 834/1033 (80.74%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRN----QQHRKSIFTNCHLIVLMWGLFAAAVLYCPL 3170
            M+NAH+KS  +V + F+V +E GLTD Q++ + + YG N LP EEGKPLW+L+LEQFDDLLVKILL AAIISF+LAWF+ SE+  TAFVEPFVIL ILI NAVVGVWQE+NAESAI+ALKEYE E AKVIR NH+G+Q I+A+ LVPGDIVEVSVGDKVPADIRI KIHSTTL+IDQSILTGES SVIKH+D I D  AVNQDK N+LFSGTN+++GKCRG+V   GLNTEIGKIRD++M T+  KTPL +KLD F +QLSKVITVIC+ VW INIGHFNDP HGGS ++GAIYYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTS+ICSDKTGTLTTNQM+V RMF    +  +     +FEI+GS Y+PDGDI+   K++K SD   L E+A IC +CNDSSV++NE+K +YEKVGEATETAL  LVEKMN  N +KS  SK++  T  N  I     KEFTLEFSRDRKSMS + SP  P     T V      G ++  KGAPEG+LDRCT VR    +V M  +IK +IMK   +YGTG+DTLRCLALA +D P SR  MD  ++  F +YE+NMTFVG+VGMLDPPR+EV  SI  CR AGIRVIVITGDNKATAEAICRRIG+FGE+EST G ++TGREFD LS  EQR+AV  A LFARVEP HKS+I+E+LQ +GEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAK+AS+MVLADDNF++IVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM++PPR+PKE LI+GWLFFRYMAIG YVG ATVG+AAWWFM   +GP ++YYQLTHH+QC  EP  F GVDC +F    PMTMALSVLV IEMLNALNSLSENQSL+ MPPW N WL+ AI LSMSLHF IL V  +S +FQI+PL+ +EW+ V+K S PV++LDE+LK I+R          ++     ++ L+W ++      CP+
Sbjct:    1 MENAHTKSTEEVTEHFNVDEESGLTDDQVKKALDKYGPNELPAEEGKPLWELILEQFDDLLVKILLLAAIISFVLAWFEESEEQVTAFVEPFVILTILICNAVVGVWQERNAESAIEALKEYEPEVAKVIRKNHRGVQRIRASNLVPGDIVEVSVGDKVPADIRISKIHSTTLRIDQSILTGESVSVIKHTDPIPDPRAVNQDKKNILFSGTNISAGKCRGIVIGTGLNTEIGKIRDEMMDTETEKTPLQQKLDEFGQQLSKVITVICVAVWAINIGHFNDPAHGGSWIKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSIICSDKTGTLTTNQMSVCRMFTFSKIEGNDILTDQFEITGSTYAPDGDIYHNGKKIKTSDYAGLEEMATICVMCNDSSVDYNEAKDIYEKVGEATETALTVLVEKMNFYNTDKSNLSKREKGTAANHVISQMWKKEFTLEFSRDRKSMSVYCSPNKP-----TRVPG----GAKMFCKGAPEGLLDRCTHVRVQGNKVPMLPAIKTEIMKHAKSYGTGRDTLRCLALATIDSPPSREDMDLEDSRKFIQYETNMTFVGVVGMLDPPRTEVFHSIKECRGAGIRVIVITGDNKATAEAICRRIGVFGENESTEGLAFTGREFDDLSTEEQRSAVMRARLFARVEPTHKSRIVEYLQGEGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKTASEMVLADDNFTSIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGIPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMKKPPRNPKEGLITGWLFFRYMAIGIYVGCATVGAAAWWFMIYDHGPKLNYYQLTHHMQCPAEPKMFKGVDCNIFNDPHPMTMALSVLVTIEMLNALNSLSENQSLISMPPWSNKWLLGAIALSMSLHFFILYVDVMSTIFQITPLNVAEWIAVLKISIPVIILDETLKFIARKFTDGNTSSSTLILESPVMALVWAVYIGLAYVCPV 1024          
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Match: atp2a1 (sarcoplasmic/endoplasmic reticulum calcium ATPase 1-like [Source:NCBI gene;Acc:103045170])

HSP 1 Score: 1331.24 bits (3444), Expect = 0.000e+0
Identity = 670/1004 (66.73%), Postives = 811/1004 (80.78%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRNQQHRK 3095
            M+NAH++   + L +F V++  GL+ +Q + +   +G N LP EEGK +W+LV+EQF+DLLV+ILL AA ISF+LAWF+  E++ TAFVEPFVILLILI NAVVGVWQE+NAESAI+ALKEYE E  KV R++ K +Q IKA ++VPGDIVEVSVGDKVPADIRI  I STTL++DQSILTGES SVIKH++ + D  AVNQDK NMLFSGTN+A+GK  GV  + G++TEIGKIRDQ+  T+Q KTPL +KLD F EQLSKVI++IC+ VW+INIGHFNDP+HGGS +RGA+YYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM V++MFI+  V  D   + +++ISGSKY+P+G++  +   VKC  +  L E+A IC+LCNDSS+++NESKG+YEKVGEATETAL CLVEKMN+ N      SK + +  C S I+  + KEFTLEFSRDRKSMS + SP  P         +    G ++ VKGAPEG++DRC +VR    RV +T  +KD+IM  +  +GTG+DTLRCLALA  D  + +  M+  ++  F  YE+++TFVG VGMLDPPR EV+ SI  CR AGIRVI+ITGDNK TA AICRRIGIFGEDE   G+++TGREFD L   +QR+AVR A  +ARVEP+HKSKI+E LQ   EI+AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAS+MVLADDNFS+IVAAVEEGRAIYNNMKQFIRYLISSN+GEVVCIFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM + PRSPKE LISGWLFFRY+AIG YVGAATV +AAWWF+ S +GP VS+YQL+H +QC+ E  DF G++C+VF  + PMTMALSVLV IEM NALNSLSENQSLV+MPPW N+WL+ A++LSMSLHF+I+ V  L  +F+++ L+  +WL V+K SFPV+L+DE LK ++RN   +K
Sbjct:    1 MENAHTQESAECLAYFSVNEGTGLSPEQFKKNLTKFGYNELPAEEGKTIWELVVEQFEDLLVRILLLAACISFVLAWFEEGEETVTAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYEPEMGKVYRADRKSVQRIKAREIVPGDIVEVSVGDKVPADIRITSIKSTTLRVDQSILTGESVSVIKHTESVPDPRAVNQDKKNMLFSGTNIAAGKAIGVAVATGVSTEIGKIRDQMAATEQEKTPLQQKLDEFGEQLSKVISLICVAVWMINIGHFNDPVHGGSWIRGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMCVTKMFIIDKVEGDSVSLDQYDISGSKYTPEGEVTKRGLPVKCGQLDGLIELATICALCNDSSLDYNESKGIYEKVGEATETALCCLVEKMNVFNTEVRGLSKVERANACCSVIKQLMKKEFTLEFSRDRKSMSVYCSPGKP---------SKAPMGNKMFVKGAPEGVIDRCAYVRVGTNRVPLTGPVKDKIMAVIKEWGTGRDTLRCLALATRDSLLRKEEMNLEDSTKFADYETDLTFVGCVGMLDPPRKEVMGSIQLCRAAGIRVIMITGDNKGTAVAICRRIGIFGEDEDVTGRAFTGREFDDLPLTQQRDAVRKACCYARVEPSHKSKIVEFLQGFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSSIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMGKAPRSPKEPLISGWLFFRYLAIGSYVGAATVAAAAWWFIYSDDGPMVSFYQLSHFMQCSAENEDFEGIECEVFESAPPMTMALSVLVTIEMCNALNSLSENQSLVRMPPWSNLWLVAAMSLSMSLHFMIIYVDPLPMIFKLTHLTLEQWLVVLKLSFPVILIDELLKFVARNYLEQK 995          
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Match: atp2a1 (sarcoplasmic/endoplasmic reticulum calcium ATPase 1-like [Source:NCBI gene;Acc:103045170])

HSP 1 Score: 1330.85 bits (3443), Expect = 0.000e+0
Identity = 669/999 (66.97%), Postives = 809/999 (80.98%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRN 3080
            M+NAH++   + L +F V++  GL+ +Q + +   +G N LP EEGK +W+LV+EQF+DLLV+ILL AA ISF+LAWF+  E++ TAFVEPFVILLILI NAVVGVWQE+NAESAI+ALKEYE E  KV R++ K +Q IKA ++VPGDIVEVSVGDKVPADIRI  I STTL++DQSILTGES SVIKH++ + D  AVNQDK NMLFSGTN+A+GK  GV  + G++TEIGKIRDQ+  T+Q KTPL +KLD F EQLSKVI++IC+ VW+INIGHFNDP+HGGS +RGA+YYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM V++MFI+  V  D   + +++ISGSKY+P+G++  +   VKC  +  L E+A IC+LCNDSS+++NESKG+YEKVGEATETAL CLVEKMN+ N      SK + +  C S I+  + KEFTLEFSRDRKSMS + SP  P         +    G ++ VKGAPEG++DRC +VR    RV +T  +KD+IM  +  +GTG+DTLRCLALA  D  + +  M+  ++  F  YE+++TFVG VGMLDPPR EV+ SI  CR AGIRVI+ITGDNK TA AICRRIGIFGEDE   G+++TGREFD L   +QR+AVR A  +ARVEP+HKSKI+E LQ   EI+AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAS+MVLADDNFS+IVAAVEEGRAIYNNMKQFIRYLISSN+GEVVCIFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM + PRSPKE LISGWLFFRY+AIG YVGAATV +AAWWF+ S +GP VS+YQL+H +QC+ E  DF G++C+VF  + PMTMALSVLV IEM NALNSLSENQSLV+MPPW N+WL+ A++LSMSLHF+I+ V  L  +F+++ L+  +WL V+K SFPV+L+DE LK ++RN
Sbjct:    1 MENAHTQESAECLAYFSVNEGTGLSPEQFKKNLTKFGYNELPAEEGKTIWELVVEQFEDLLVRILLLAACISFVLAWFEEGEETVTAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYEPEMGKVYRADRKSVQRIKAREIVPGDIVEVSVGDKVPADIRITSIKSTTLRVDQSILTGESVSVIKHTESVPDPRAVNQDKKNMLFSGTNIAAGKAIGVAVATGVSTEIGKIRDQMAATEQEKTPLQQKLDEFGEQLSKVISLICVAVWMINIGHFNDPVHGGSWIRGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMCVTKMFIIDKVEGDSVSLDQYDISGSKYTPEGEVTKRGLPVKCGQLDGLIELATICALCNDSSLDYNESKGIYEKVGEATETALCCLVEKMNVFNTEVRGLSKVERANACCSVIKQLMKKEFTLEFSRDRKSMSVYCSPGKP---------SKAPMGNKMFVKGAPEGVIDRCAYVRVGTNRVPLTGPVKDKIMAVIKEWGTGRDTLRCLALATRDSLLRKEEMNLEDSTKFADYETDLTFVGCVGMLDPPRKEVMGSIQLCRAAGIRVIMITGDNKGTAVAICRRIGIFGEDEDVTGRAFTGREFDDLPLTQQRDAVRKACCYARVEPSHKSKIVEFLQGFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSSIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMGKAPRSPKEPLISGWLFFRYLAIGSYVGAATVAAAAWWFIYSDDGPMVSFYQLSHFMQCSAENEDFEGIECEVFESAPPMTMALSVLVTIEMCNALNSLSENQSLVRMPPWSNLWLVAAMSLSMSLHFMIIYVDPLPMIFKLTHLTLEQWLVVLKLSFPVILIDELLKFVARN 990          
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Match: atp2a3 (sarcoplasmic/endoplasmic reticulum calcium ATPase 1 [Source:NCBI gene;Acc:103024029])

HSP 1 Score: 1322.76 bits (3422), Expect = 0.000e+0
Identity = 670/1000 (67.00%), Postives = 795/1000 (79.50%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRNQ 3083
            M+NAH+KS  +VL  FDV++  GLT +Q++ +QE YG N LP EEGK LW+LV+EQF+DLLV+ILL AA +SF+LA F+  E+STTAFVEP VILLILI NAV+GVWQE+NAE+AI+ALKEYE E  KV R N K +Q IKA ++VPGDIVEV+VGDKVPADIRIV I STTL++DQSILTGES SVIKH+D + D  AVNQDK NMLFSGTN+A+G+  GVV   G++TEIGKIR+Q+  T+Q KTPL +KLD F +QLSKVI++IC+ VW+INIGHF DP+HGGS +RGAIYYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V RMF+V   +     + EF I+GS Y+P+G +    K V+C D   L E+A ICS+CNDSS+++NE+KGVYEKVGEATETAL  LVEKMN+   + S  SK + +  CNS I+  + KEFTLEFSRDRKSMS + +P              + +  ++ VKGAPE ++DRCT VR   G+ E+T + K+++M  +  +GTGKDTLRCLALA  D P  +  MD  NA  F  YES++TFVG VGMLDPPR EV+ S+  C  AGIRVI+ITGDNK TA AICRRIGIF E E   GK+YTGREFD L+   QR AV+ A  FARVEPAHKSKI+ +LQ   EI+AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAS+MVL+DDNFSTIVAAVEEGRAIYNNMKQFIRYLISSN+GEVVCIFLTA LG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM++PPR+PKE LISGWLFFRY+AIG YVG  TVG+A WW++    GP VS+ QL H +QC  +   F G+DC+VF    P TMALSVLV IEM NALNSLSENQSL++MPPW NIWL+ AI LS+SLHFLIL V  L  +FQ++PL  S+W+ V+K S PV+LLDE+LK +SR+ 
Sbjct:    1 MENAHTKSASEVLRNFDVNENTGLTLEQVKTNQERYGPNELPAEEGKSLWELVVEQFEDLLVRILLLAACVSFVLALFEEGEESTTAFVEPLVILLILIANAVIGVWQERNAENAIEALKEYEPEMGKVYRMNRKAVQRIKAREIVPGDIVEVAVGDKVPADIRIVSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGRAIGVVVCTGVSTEIGKIRNQMACTEQEKTPLQQKLDEFGQQLSKVISLICVAVWVINIGHFGDPVHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFVVDKADSSSCSLHEFNITGSTYAPEGQVLKGVKPVQCGDFDGLLELATICSMCNDSSLDYNEAKGVYEKVGEATETALTTLVEKMNVFKTDLSGLSKVERAGACNSVIRQLMKKEFTLEFSRDRKSMSVYCTP------------TKSGSQSKMFVKGAPESVIDRCTHVRIGSGKAELTIAAKEELMSTIRDWGTGKDTLRCLALATRDTPPRKQDMDLENATKFAAYESDLTFVGCVGMLDPPRKEVIGSVKLCSEAGIRVIMITGDNKGTAVAICRRIGIFTEHEDVEGKAYTGREFDDLAPEAQREAVKRARCFARVEPAHKSKIVGYLQSFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLSDDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAILGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDKPPRNPKEPLISGWLFFRYLAIGGYVGLGTVGAATWWYLFDEQGPQVSFNQLRHFMQCTEDNPMFKGIDCEVFESRYPTTMALSVLVTIEMFNALNSLSENQSLLRMPPWVNIWLLGAIILSLSLHFLILYVEPLPLIFQVTPLHCSQWIVVLKISIPVILLDEALKYVSRHH 988          
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Match: atp2a3 (sarcoplasmic/endoplasmic reticulum calcium ATPase 1 [Source:NCBI gene;Acc:103024029])

HSP 1 Score: 1321.61 bits (3419), Expect = 0.000e+0
Identity = 670/1000 (67.00%), Postives = 795/1000 (79.50%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRNQ 3083
            M+NAH+KS  +VL  FDV++  GLT +Q++ +QE YG N LP EEGK LW+LV+EQF+DLLV+ILL AA +SF+LA F+  E+STTAFVEP VILLILI NAV+GVWQE+NAE+AI+ALKEYE E  KV R N K +Q IKA ++VPGDIVEV+VGDKVPADIRIV I STTL++DQSILTGES SVIKH+D + D  AVNQDK NMLFSGTN+A+G+  GVV   G++TEIGKIR+Q+  T+Q KTPL +KLD F +QLSKVI++IC+ VW+INIGHF DP+HGGS +RGAIYYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V RMF+V   +     + EF I+GS Y+P+G +    K V+C D   L E+A ICS+CNDSS+++NE+KGVYEKVGEATETAL  LVEKMN+   + S  SK + +  CNS I+  + KEFTLEFSRDRKSMS + +P              + +  ++ VKGAPE ++DRCT VR   G+ E+T + K+++M  +  +GTGKDTLRCLALA  D P  +  MD  NA  F  YES++TFVG VGMLDPPR EV+ S+  C  AGIRVI+ITGDNK TA AICRRIGIF E E   GK+YTGREFD L+   QR AV+ A  FARVEPAHKSKI+ +LQ   EI+AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAS+MVL+DDNFSTIVAAVEEGRAIYNNMKQFIRYLISSN+GEVVCIFLTA LG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM++PPR+PKE LISGWLFFRY+AIG YVG  TVG+A WW++    GP VS+ QL H +QC  +   F G+DC+VF    P TMALSVLV IEM NALNSLSENQSL++MPPW NIWL+ AI LS+SLHFLIL V  L  +FQ++PL  S+W+ V+K S PV+LLDE+LK +SR+ 
Sbjct:    1 MENAHTKSASEVLRNFDVNENTGLTLEQVKTNQERYGPNELPAEEGKSLWELVVEQFEDLLVRILLLAACVSFVLALFEEGEESTTAFVEPLVILLILIANAVIGVWQERNAENAIEALKEYEPEMGKVYRMNRKAVQRIKAREIVPGDIVEVAVGDKVPADIRIVSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGRAIGVVVCTGVSTEIGKIRNQMACTEQEKTPLQQKLDEFGQQLSKVISLICVAVWVINIGHFGDPVHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFVVDKADSSSCSLHEFNITGSTYAPEGQVLKGVKPVQCGDFDGLLELATICSMCNDSSLDYNEAKGVYEKVGEATETALTTLVEKMNVFKTDLSGLSKVERAGACNSVIRQLMKKEFTLEFSRDRKSMSVYCTP------------TKSGSQSKMFVKGAPESVIDRCTHVRIGSGKAELTIAAKEELMSTIRDWGTGKDTLRCLALATRDTPPRKQDMDLENATKFAAYESDLTFVGCVGMLDPPRKEVIGSVKLCSEAGIRVIMITGDNKGTAVAICRRIGIFTEHEDVEGKAYTGREFDDLAPEAQREAVKRARCFARVEPAHKSKIVGYLQSFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLSDDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAILGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDKPPRNPKEPLISGWLFFRYLAIGGYVGLGTVGAATWWYLFDEQGPQVSFNQLRHFMQCTEDNPMFKGIDCEVFESRYPTTMALSVLVTIEMFNALNSLSENQSLLRMPPWVNIWLLGAIILSLSLHFLILYVEPLPLIFQVTPLHCSQWIVVLKISIPVILLDEALKYVSRHH 988          
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Match: atp2a1l (sarcoplasmic/endoplasmic reticulum calcium ATPase 1 [Source:NCBI gene;Acc:103039228])

HSP 1 Score: 1316.98 bits (3407), Expect = 0.000e+0
Identity = 674/1004 (67.13%), Postives = 803/1004 (79.98%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRNQQHRK 3095
            M +AH+K+  +VL FF VS+  GL+  Q++ +Q  +G N LP EEGK +W+LV+EQF+DLLV+ILL AA ISF+LAWF+  E++ TAFVEPFVILLILI NAVVGVWQE+NAESAI+ALKEYE E  KV RS+ K +Q IKA ++VPGDIVEVSVGDKVPADIRI  I STTL++DQSILTGES SVIKH++ + DL AVNQDK NMLFSGTN+A+GK  GV  + G++TEIGKIRDQ+  T+Q KTPL +KLD F EQLSKVI++IC+ VW+INIGHFNDP+HGGS +RGA+YYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM V++MFI+  V+ D  +++ F+ISGSKY+P+G++   + +V CS    L E+A IC+LCNDSS+++NESK +YEKVGEATETAL CLVEKMN+   N       + +  C + I+  + K FTLEFSRDRKSMS + +P   +GD          +G ++ VKGAPEG++DRC +VR    RV +T  +KD+IM  +  +GTG+DTLRCLALA  D P+    M   ++  F  YE+++TFVG VGMLDPPR EV  SI  CR AGIRVI+ITGDNK TA AICRRIGIF EDE   G++YTGREFD L   EQ  AV  A  FARVEP+HKSKI+E LQ   EI+AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAS+MVLADDNFS+IVAAVEEGRAIYNNMKQFIRYLISSN+GEVVCIFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM + PRSPKE LISGWLFFRY+AIG YVGAATVG+AA WF+    GP V+YYQL+H +QC  E  DF GVDC+VF  + PMTMALSVLV IEM NALNSLSENQSL++MPPW N WL+ A+TLSMSLHFLI+ V  L  +F+++ L+  +W+ V+K SFPV+L+DE LK ++RN    K
Sbjct:    1 MQDAHTKNPEEVLAFFGVSETTGLSPDQVKKNQAKFGFNELPAEEGKSIWELVIEQFEDLLVRILLLAACISFVLAWFEEGEETVTAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYEPEMGKVYRSDRKSVQRIKAREIVPGDIVEVSVGDKVPADIRITAIRSTTLRVDQSILTGESVSVIKHTEAVPDLRAVNQDKKNMLFSGTNIAAGKAIGVCIATGVSTEIGKIRDQMAATEQEKTPLQQKLDEFGEQLSKVISLICVAVWMINIGHFNDPVHGGSWIRGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMCVTKMFIIDKVDGDHVNLETFDISGSKYTPEGEVTKGDSKVDCSQYDGLVELATICALCNDSSLDYNESKKIYEKVGEATETALCCLVEKMNVFKSNVRNLGPVERANACCTVIKQLMKKNFTLEFSRDRKSMSVYCTPT--KGD----------SGSKMFVKGAPEGVIDRCAYVRVGATRVPLTAPVKDKIMTIIKEWGTGRDTLRCLALATRDTPLKVEEMKLDDSTKFADYETDLTFVGCVGMLDPPRKEVTGSIELCRAAGIRVIMITGDNKGTAVAICRRIGIFNEDEDVTGRAYTGREFDDLPRTEQSEAVTRACCFARVEPSHKSKIVEFLQGYDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSSIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMGKAPRSPKEPLISGWLFFRYLAIGGYVGAATVGAAAHWFLYDEEGPGVTYYQLSHFMQCCPENEDFTGVDCEVFEAAPPMTMALSVLVTIEMCNALNSLSENQSLIRMPPWSNFWLLSAMTLSMSLHFLIIYVDPLPMIFKLTHLNVEQWMVVLKLSFPVILIDEVLKFVARNYLEGK 992          
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010373.1 (pep scaffold:Pmarinus_7.0:GL481096:3909:20014:1 gene:ENSPMAG00000009373.1 transcript:ENSPMAT00000010373.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1137.48 bits (2941), Expect = 0.000e+0
Identity = 586/856 (68.46%), Postives = 688/856 (80.37%), Query Frame = 3
Query:  540 VSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVG--MLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRNQQHRKSI 3101
            ++VGDKVPADIR+  I STTL++DQSILTGES SVIKH+D + D  AVNQDK NMLFSGTN+A+GK  GVV + G+NTEIGKIRD++  T+Q KTPL +KLD F EQLSKVI++ICI VW+INIGHFNDP+HGGS +RGAIYYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V RMFI+   + +   + EF I+GS Y+P+G+++  +K V+C +   L E+A IC+LCNDSS++FNE+KGVYEKVGEATETAL C VEKMN+ + +    SK + +  CN+ I+  + KEFTLEFSRDRKSMS + +P+ P         + +  G ++ VKGAPEG++DRC+ VR    ++ MT  +K++I+  +  YGTG+DTLRCLALA  D P  R  M+  ++  F  YE ++TFVG VG  MLDPPR EV  SI  CR AGIRVI   GDNK TA AICRRIGIFGEDE    K+YTGREFD L   EQR A + A  FARVEP+HKSKI+E LQ   EI+AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAS+MVLADDNFS+IVAAVEEGRAIYNNMKQFIRYLISSN+GEVVCIFLTAALG PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPR+PKE LISGWLFFRY+AIGCYVGAATVG+AAWWFM++ +GP V++YQL+H +QC  E  DF G+DC VF    PMTMALSVLV IEM NALNSLSENQSL++MPPW NIWL+ AI LSMSLHFLIL V  L  +FQI+PL+  +WL V+K S PV+LLDE+LK I+RN    K +
Sbjct:    1 LAVGDKVPADIRLTSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAVGVVVATGVNTEIGKIRDEMAATEQDKTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWMRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFIIDRADGENCSLNEFTITGSTYAPEGEVYKNDKLVRCGEYDGLIELATICALCNDSSLDFNEAKGVYEKVGEATETALTCQVEKMNVFDTHLVGLSKVERANACNNVIKQLMKKEFTLEFSRDRKSMSVYCTPVKP---------SRSSVGNKMFVKGAPEGVIDRCSHVRVGTTKLPMTAGMKEKILATIREYGTGRDTLRCLALATRDMPPRREDMNLIDSTKFASYEVDLTFVGCVGVGMLDPPRKEVSSSIILCREAGIRVI---GDNKGTAVAICRRIGIFGEDEDVKDKAYTGREFDDLPLEEQRLACQRARCFARVEPSHKSKIVEFLQSCDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSSIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRNPKEPLISGWLFFRYLAIGCYVGAATVGAAAWWFMAADDGPGVTFYQLSHFMQCTPEHPDFEGLDCHVFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWDNIWLLGAICLSMSLHFLILYVEPLPIIFQITPLNLEQWLVVLKISLPVILLDETLKFIARNYLEGKEL 844          
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Match: atp2c1 (ATPase secretory pathway Ca2+ transporting 1 [Source:ZFIN;Acc:ZDB-GENE-060503-615])

HSP 1 Score: 235.343 bits (599), Expect = 5.257e-68
Identity = 156/491 (31.77%), Postives = 252/491 (51.32%), Query Frame = 3
Query: 1647 LVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRNQQHRKSIFTNCH 3116
             VKGA E ++D C   R  QG     ++ +  + K+   Y  G   LR LA+A   E                     +TF+GLVG++DPPR  V  S+    ++G+ V ++TGD+  TA AI  R+G+     S  G +    E D +   +    +R  S+F R  P HK KI++ LQ++GE+  MTGDGVNDA AL+ A+IG+AMG SGT V K A+DM+L DD+F TI++A+EEG+ I+ N+K F+R+ +S++I  +  I L   +  P  L  +Q+LW+N++ DG PA +LG  P D D++ +PPR+ K+S+++  L  + +     + A  + S   +         V + +L  ++     P D               TM  +  V  +M NAL+S S+ +S+ +   + N     A+  S+     ++    L +VFQ   LS  + L ++  +  V +  E +K +      R+ +F+  H
Sbjct:   15 FVKGAFERVIDMCCSFR-GQGHTLPLSAQQLVLYKQEETY-MGASGLRVLAMASGPE------------------LGQLTFLGLVGIIDPPRPGVRKSVAILVSSGVSVKMVTGDSMETAVAIANRLGL----SSNGGGAAISGEEDLMETTQLSQIIRKVSVFYRASPRHKLKIVKALQKNGEVVGMTGDGVNDAVALRAADIGVAMGRSGTDVCKEAADMILVDDDFYTIMSAIEEGKGIFYNIKNFVRFQLSTSIAALTLITLATLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRQPPRNVKDSILTRSLISKIL-----ISAIIIVSGTLF---------VFWRELQDNM---ITPRD--------------TTMTFTCFVFFDMFNALSSRSQTKSVFESGFFSNRMFCYAVGGSIMGQMAVIYFPPLQQVFQTENLSAVDLLFLLGLTSTVWIASEVMKAV-----ERRRLFSRKH 445          
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Match: atp2c1 (ATPase secretory pathway Ca2+ transporting 1 [Source:ZFIN;Acc:ZDB-GENE-060503-615])

HSP 1 Score: 221.476 bits (563), Expect = 2.299e-63
Identity = 151/487 (31.01%), Postives = 246/487 (50.51%), Query Frame = 3
Query: 1659 APEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRNQQHRKSIFTNCH 3116
            A E ++D C   R  QG     ++ +  + K+   Y  G   LR LA+A   E                     +TF+GLVG++DPPR  V  S+    ++G+ V ++TGD+  TA AI  R+G+     +  G + +G E            V   S+F R  P HK KI++ LQ++GE+  MTGDGVNDA AL+ A+IG+AMG SGT V K A+DM+L DD+F TI++A+EEG+ I+ N+K F+R+ +S++I  +  I L   +  P  L  +Q+LW+N++ DG PA +LG  P D D++ +PPR+ K+S+++  L  + +     + + T+               V + +L  ++     P D               TM  +  V  +M NAL+S S+ +S+ +   + N     A+  S+     ++    L +VFQ   LS  + L ++  +  V +  E +K +      R+ +F+  H
Sbjct:    1 AFERVIDMCCSFR-GQGHTLPLSAQQLVLYKQEETY-MGASGLRVLAMASGPE------------------LGQLTFLGLVGIIDPPRPGVRKSVAILVSSGVSVKMVTGDSMETAVAIANRLGL---SSNGGGAAISGEEAWGGRHPAAAFVVLQVSVFYRASPRHKLKIVKALQKNGEVVGMTGDGVNDAVALRAADIGVAMGRSGTDVCKEAADMILVDDDFYTIMSAIEEGKGIFYNIKNFVRFQLSTSIAALTLITLATLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRQPPRNVKDSILTRSLISKILISAIIIVSGTL--------------FVFWRELQDNM---ITPRD--------------TTMTFTCFVFFDMFNALSSRSQTKSVFESGFFSNRMFCYAVGGSIMGQMAVIYFPPLQQVFQTENLSAVDLLFLLGLTSTVWIASEVMKAV-----ERRRLFSRKH 428          
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002888.1 (pep scaffold:Pmarinus_7.0:GL478641:194938:205936:1 gene:ENSPMAG00000002641.1 transcript:ENSPMAT00000002888.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 212.231 bits (539), Expect = 1.094e-58
Identity = 170/559 (30.41%), Postives = 270/559 (48.30%), Query Frame = 3
Query: 1548 RDRKSMSAFVSPINPEGDVQTTVRNHNITGPR-----LLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFA-NAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGK--------------------SYTGREFDQLSDFEQRNAVRNAS--LFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPK------ESLIS------GWL-----FFRY---MAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISR 3077
            RD +S +  V+ I  +  ++  +  H    P      L++KGAPE ILDRC+ +   +G+ E  +   ++  +  A    G    R L L  +  PV +    +A +  N      ++  VGL+ M+DPPR+ V D++G CR+AGI+VI+ TGD+  TA+AI + +GI  E   TV                         G +   +++ +  + ++N +  +FAR  P  K  I+E  QR G I A+TGDGVND+ ALKKA+IGIAMG  G+ V+K A+DM+L DDNF++IV  VEEGR I++N+K+ I Y ++SNI E+          +P  L  V +L ++L TD +PA +L +   + DIM+R PR+ +      E LIS      G +     FF Y   MA   ++ +  +G    W   S N    SY Q     +   E    +   C         T     +V+++  + +   +   S+ +    +N  LI  +    +L   +     +    ++ PL  S W     +S  + + DE  K+I R
Sbjct:   25 RDMRSRNQKVAEIPFDSTIKYQLSIHESDEPNDPRYLLVMKGAPERILDRCSSI-IIEGQEESLDEELEEAFQN-AYLELGGLGERVLGLCQLRLPVDQFPRGYAFDTENINFPMEDLCLVGLMSMIDPPRATVPDAVGKCRSAGIKVIMATGDHPITAKAIAKSVGIISEGNETVEDIAARLNIPVNQVDPRDAKACVVHGSDLKNMTETQLDDILKNYTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSLALKKADIGIAMGIVGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLFFILCNIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNVRVDKLVNERLISIAYGQIGMIQALGGFFTYFVIMAENGFLPSKLMGLRIEWNTRSQNELEDSYGQ-----EWTYEQRKIVEYTCH--------TSFFVSIVVVQWADLIICKTRRNSVFQQ-GMKNKVLIFGLFEETALAAFLSYCPGMDVALRMYPLKLSWWFCAFPYSILIFVYDEVRKLIIR 567          
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002145.1 (pep scaffold:Pmarinus_7.0:GL482157:124:4919:1 gene:ENSPMAG00000001949.1 transcript:ENSPMAT00000002145.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 161.384 bits (407), Expect = 6.222e-43
Identity = 125/415 (30.12%), Postives = 196/415 (47.23%), Query Frame = 3
Query: 1968 RVIVITGDNKATAEAICRRIGIFGEDESTVGK--------------------SYTGREFDQLSDFEQRNAVRNAS--LFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPK------ESLIS------GWL-----FFRYMAI---GCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRNQ 3083
            +VI++TGD+  TA+AI + +GI  E   TV                         G +   +++ +  + ++N +  +FAR  P  K  I+E  QR G I A+TGDGVND+PALKKA+IGIAMG +G+ V+K A+DM+L DDNF++IV  VEEGR I++N+K+ I Y ++SNI E+          +P  L  V +L ++L TD +PA +L +   + DIM+R PR+ +      E LIS      G +     FF Y  I     ++    +G    W   S N    SY Q     +   E    +   C         T     +V+++  + +   +   S+ +    +N  LI  +    +L   +     +    ++ PL  S W     +S  + + DE  K I R  
Sbjct:    1 QVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVVHGSDLKDMTEIQLDDILKNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLFFILCNIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNARVDKLVNERLISIAYGQIGMIQALGGFFSYFVILAENGFLPWNLIGIRINWDDKSLNDLEDSYGQ-----EWTYEQRKIVEYTCH--------TSFFVSIVVVQWADLIICKTRRNSVFQQ-GMKNKVLIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSLLIFVYDEVRKFILRRH 401          
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Match: PMR1 (High affinity Ca2+/Mn2+ P-type ATPase; required for Ca2+ and Mn2+ transport into Golgi; involved in Ca2+ dependent protein sorting, processing; D53A mutant (Mn2+ transporting) is rapamycin sensitive, Q783A mutant (Ca2+ transporting) is rapamycin resistant; Mn2+ transport into Golgi lumen required for rapamycin sensitivity; mutations in human homolog ATP2C1 cause acantholytic skin condition Hailey-Hailey disease; human ATP2C1 can complement yeast null mutant [Source:SGD;Acc:S000003135])

HSP 1 Score: 408.683 bits (1049), Expect = 3.107e-125
Identity = 308/1016 (30.31%), Postives = 516/1016 (50.79%), Query Frame = 3
Query:  105 SVHDVLDFFDVSDEFGL-TDKQIELSQETYGVNGLPDEEGKPLWKLVLEQF-DDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQ--------DKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGR-----VEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGS-GTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRNQQHRKSIF 3104
            SV + L+  D     GL +  +    +  YG N +  E+ + L+K  L  F +D ++   L     + +  +  + +D+ +  +  F++         VG  QE  +E +++AL +       ++R   +    + A+ LVPGD+V   +GD++PADIRI  I +  L ID+S LTGE+  V K S  I+     +Q        ++  + + GT V  G  +G+V   G NT  G + + + + ++ KTPL   +D   + LS V  ++  ++ L+ I      I G    R  +  F+I+V+LAVAAIPEGLP ++T  L+LG  RMAK+ AIVR LPSVETLG  +VICSDKTGTLT+N MTVS+++ + +++ +  ++   + +    + +G++    K     D+    E   I +LCN++S  F++   ++  +G  T+ AL+                  +QL+      I++TV K   L F+  RK M+  +  +NP  D + TV           VKGA E IL+  T    S+G+      E   +  ++    +A+ G        L L+    P++   +             ++TF GL+GM DPPR  V  +I      G+ +I+ITGD++ TA  I ++IGI   D        +G + D++SD +  N + + ++FAR  P HK  I+  L++ G++ AMTGDGVNDAPALK ++IG++MG  GT VAK ASDMVL DD+FSTI+ A+EEG+ I+NN++ F+ + +S+++  +  + L+ A  +P  L  +Q+LW+N++ DG PA +LG  P D ++M++PPR   + +++  +  R +     +   TV    + F+                          +  D KV   ++  TM  +  V  +M NAL      +S+ ++  + N     A+ LS+      + + F   +F+   L  S+ L ++  S  V ++DE  K+ +R +    S +
Sbjct:   42 SVDEALEKLDTDKNGGLRSSNEANNRRSLYGPNEITVEDDESLFKKFLSNFIEDRMI---LLLIGSAVVSLFMGNIDDAVSITLAIFIV-------VTVGFVQEYRSEKSLEALNKLVPAECHLMRCGQE--SHVLASTLVPGDLVHFRIGDRIPADIRI--IEAIDLSIDESNLTGENEPVHKTSQTIEKSSFNDQPNSIVPISERSCIAYMGTLVKEGHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSLVSFIVIGMICLVGI------IQG----RSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMS-NKLNVLSLDKNKKTKNSNGNL----KNYLTEDV---RETLTIGNLCNNAS--FSQEHAIF--LGNPTDVALL------------------EQLANFEMPDIRNTVQKVQELPFNSKRKLMATKI--LNPV-DNKCTV----------YVKGAFERILEYSTSYLKSKGKKTEKLTEAQKATINECANSMASEGLRVFGFAKLTLSDSSTPLTEDLI------------KDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIGIPVIDPKL--SVLSGDKLDEMSDDQLANVIDHVNIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVALSTAFKLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTHDVMKRLLTTAACIIVGTV----YIFVKE------------------------MAEDGKV--TARDTTMTFTCFVFFDMFNALACRHNTKSIFEIGFFTNKMFNYAVGLSLLGQMCAIYIPFFQSIFKTEKLGISDILLLLLISSSVFIVDELRKLWTRKKNEEDSTY 946          
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Match: ENA1 (P-type ATPase sodium pump; involved in Na+ and Li+ efflux to allow salt tolerance [Source:SGD;Acc:S000002447])

HSP 1 Score: 320.857 bits (821), Expect = 1.740e-92
Identity = 303/1082 (28.00%), Postives = 501/1082 (46.30%), Query Frame = 3
Query:   96 HSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVI---DDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTD-----------------------------QVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVR-------------NVNKDGTD-IQEFEISGSKYSPDGDIFCQEK---RVKCSDIPQ------LYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTV--RNHNITGPRLLVKGAPEGILDRCTFVRTSQGR--VEMTNSIKDQIMKKVAAYGTGKDTLRCLALAC---VDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGED------ESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEA-----LIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPP-------------WRNIWLILAITLSMSLHFLILEVGFLS-KVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISR 3077
            H+ +  +  +F   S   GLT  +     +T G N L D+       +VL Q  + ++ +LL + IISF +       D  T  V  FVI +    N ++G+ QE  A   +++LK   S NA VIR+     +TI +  +VPGDI  V VGD +PAD+R+  I +     D+S+LTGES  V K ++++   ++  +V  D++N+ FS + V  G+ +G+V    LN+EIGKI   +                                  V TPL +KL   A  L  +  +  I+V        +         R AIY    A+ +A++ IP  L  V+T  +S+G   M  +N IVR L S+E LG  + ICSDKTGTLT  +M   +++I R             N N+     I  F      ++ DGD+   +    R+   D+P+        +  E  +L N ++V  +++   ++  G+ TE A+     KM++ +   +  + ++ +   N   QS++++      S   + ++ F  P +      ++V   NHN T   +  KGA E I+  C+      G     +T+   + I K V  Y    + LR L  A      + V+  ++    + N    ES++ F+GL+G+ DPPR+E   ++     AGI V ++TGD   TA+AI + +GI   +      E       TG +FD LS+ E  +      + AR  P  K ++IE L R  +   MTGDGVND+P+LK A +GIAMG +G+ V+K ASD+VL+DDNF++I+ AVEEGR + +N+++F+  L++ N+ + + + +              L PV++LW+ +VT   PA  LG      D+M+RPP   +  + +  +     A G  +  + + S    F  S  G  ++  +L H   C    N      C+    S+  + A + +    ++ A   +   +S  +M P             W N +L  +I       F ++ +  ++ KVF   P+  +EW   + F+    +  E  K   R
Sbjct:   18 HTLTAEEAAEFIGTSLTEGLTQDEFVHRLKTVGENTLGDDTKIDYKAMVLHQVCNAMIMVLLISMIISFAM------HDWITGGVISFVIAV----NVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKS--ETINSKDVVPGDICLVKVGDTIPADLRL--IETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVG-DRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDK--------RVAIY----AICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVFATKMDLPH---NALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEF--PFDSTVKRMSSVYYNNHNET-YNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNV--YSLSNEGLRVLGFASKSFTKDQVNDDQLKNITS-NRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFTWEVIIDTFAYGIIMTGSCMAS----FTGSLYG--INSGRLGH--DCDGTYNS----SCRDVYRSR--SAAFATMTWCALILAWEVVDMRRSFFRMHPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHKPIG-AEWGLAIAFTIAFWIGAELYKCGKR 1048          
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Match: ENA5 (Protein with similarity to P-type ATPase sodium pumps; member of the Na+ efflux ATPase family [Source:SGD;Acc:S000002445])

HSP 1 Score: 319.316 bits (817), Expect = 5.692e-92
Identity = 301/1082 (27.82%), Postives = 500/1082 (46.21%), Query Frame = 3
Query:   96 HSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVI---DDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTD-----------------------------QVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVR-------------NVNKDGTD-IQEFEISGSKYSPDGDIFCQEK---RVKCSDIPQ------LYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTV--RNHNITGPRLLVKGAPEGILDRCTFVRTSQGR--VEMTNSIKDQIMKKVAAYGTGKDTLRCLALAC---VDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGED------ESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEA-----LIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPP-------------WRNIWLILAITLSMSLHFLILEVGFLS-KVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISR 3077
            H+ +  +  +F   S   GLT  +     +  G N L D+       +VL Q  + ++ +L+ +  ISF +       D  T  V  FVI +    N ++G+ QE  A   +++LK   S NA VIR+     +TI +  +VPGDI  V VGD +PAD+R+  I +     D+S+LTGES  V K ++++   ++  +V  D++N+ FS + V  G+ +G+V    LN+EIGKI   +                                  V TPL +KL   A  L  +  +  I+V        +         R AIY    A+ +A++ IP  L  V+T  +S+G   M  +N IVR L S+E LG  + ICSDKTGTLT  +M   +++I R             N N+     I  F      ++ DGD+   +    R+   D+P+        +  E  +L N ++V  +++   ++  G+ TE A+     KM++ +   +  + ++ +   N   QS++++      S   + ++ F  P +      ++V   NHN T   +  KGA E I+  C+      G     +T+   + I K V  Y    + LR L  A      + V+  ++    + N    ES++ F+GL+G+ DPPR+E   ++     AGI V ++TGD   TA+AI + +GI   +      E       TG +FD LS+ E  +      + AR  P  K ++IE L R  +  AMTGDGVND+P+LK A +GIAMG +G+ V+K ASD+VL+DDNF++I+ AVEEGR + +N+++F+  L++ N+ + + + +              L PV++LW+ +VT   PA  LG      D+M+RPP   +  + +  +     A G  +  + + S    F  S  G  ++  +L H   C    N      C+    S+  + A + +    ++ A   +   +S  +M P             W N +L  +I       F ++ +  ++ KVF   P+  +EW   + F+    +  E  K   R
Sbjct:   18 HTLTTEEAAEFIGTSLTEGLTQDESLRRLKAVGENTLGDDTKIDYKAMVLHQVCNAMIMVLVISMAISFAV------RDWITGGVISFVIAV----NVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKS--ETINSKDVVPGDICLVKVGDTIPADLRL--IETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVG-DRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDK--------RVAIY----AICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVFATKMDLPH---NALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEF--PFDSTVKRMSSVYYNNHNET-YNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNV--YSLSNEGLRVLGFASKSFTKDQVNDDQLKNITS-NRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPNDSEVGIFTWEVIIDTFAYGIIMTGSCMAS----FTGSLYG--INSGRLGH--DCDGTYNS----SCRDVYRSR--SAAFATMTWCALILAWEVVDMRRSFFRMHPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHKPIG-AEWGLAIAFTIAFWIGAELYKCGKR 1048          
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Match: ENA2 (P-type ATPase sodium pump; involved in Na+ efflux to allow salt tolerance; likely not involved in Li+ efflux [Source:SGD;Acc:S000002446])

HSP 1 Score: 319.316 bits (817), Expect = 6.327e-92
Identity = 301/1082 (27.82%), Postives = 500/1082 (46.21%), Query Frame = 3
Query:   96 HSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVI---DDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTD-----------------------------QVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVR-------------NVNKDGTD-IQEFEISGSKYSPDGDIFCQEK---RVKCSDIPQ------LYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTV--RNHNITGPRLLVKGAPEGILDRCTFVRTSQGR--VEMTNSIKDQIMKKVAAYGTGKDTLRCLALAC---VDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGED------ESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEA-----LIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPP-------------WRNIWLILAITLSMSLHFLILEVGFLS-KVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISR 3077
            H+ +  +  +F   S   GLT  +     +  G N L D+       +VL Q  + ++ +L+ +  ISF +       D  T  V  FVI +    N ++G+ QE  A   +++LK   S NA VIR+     +TI +  +VPGDI  V VGD +PAD+R+  I +     D+S+LTGES  V K ++++   ++  +V  D++N+ FS + V  G+ +G+V    LN+EIGKI   +                                  V TPL +KL   A  L  +  +  I+V        +         R AIY    A+ +A++ IP  L  V+T  +S+G   M  +N IVR L S+E LG  + ICSDKTGTLT  +M   +++I R             N N+     I  F      ++ DGD+   +    R+   D+P+        +  E  +L N ++V  +++   ++  G+ TE A+     KM++ +   +  + ++ +   N   QS++++      S   + ++ F  P +      ++V   NHN T   +  KGA E I+  C+      G     +T+   + I K V  Y    + LR L  A      + V+  ++    + N    ES++ F+GL+G+ DPPR+E   ++     AGI V ++TGD   TA+AI + +GI   +      E       TG +FD LS+ E  +      + AR  P  K ++IE L R  +  AMTGDGVND+P+LK A +GIAMG +G+ V+K ASD+VL+DDNF++I+ AVEEGR + +N+++F+  L++ N+ + + + +              L PV++LW+ +VT   PA  LG      D+M+RPP   +  + +  +     A G  +  + + S    F  S  G  ++  +L H   C    N      C+    S+  + A + +    ++ A   +   +S  +M P             W N +L  +I       F ++ +  ++ KVF   P+  +EW   + F+    +  E  K   R
Sbjct:   18 HTLTTEEAAEFIGTSLTEGLTQDESLRRLKAVGENTLGDDTKIDYKAMVLHQVCNAMIMVLVISMAISFAV------RDWITGGVISFVIAV----NVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKS--ETINSKDVVPGDICLVKVGDTIPADLRL--IETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVG-DRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDK--------RVAIY----AICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVFATKMDLPH---NALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEF--PFDSTVKRMSSVYYNNHNET-YNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNV--YSLSNEGLRVLGFASKSFTKDQVNDDQLKNITS-NRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFTWEVIIDTFAYGIIMTGSCMAS----FTGSLYG--INSGRLGH--DCDGTYNS----SCRDVYRSR--SAAFATMTWCALILAWEVVDMRRSFFRMHPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHKPIG-AEWGLAIAFTIAFWIGAELYKCGKR 1048          
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Match: PMC1 (Vacuolar Ca2+ ATPase involved in depleting cytosol of Ca2+ ions; prevents growth inhibition by activation of calcineurin in the presence of elevated concentrations of calcium; similar to mammalian PMCA1a [Source:SGD;Acc:S000002974])

HSP 1 Score: 195.667 bits (496), Expect = 3.672e-51
Identity = 124/338 (36.69%), Postives = 187/338 (55.33%), Query Frame = 3
Query: 1641 RLLVKGAPEGILDRCTFVRTSQGRVEMTNSIK----DQIMKKVAAYGTGKDTLRCLALA------CVDEPVSRSR----MDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKS-YTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEA--LIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLIS 2600
            R  +KGA E +   C++ R S   +E  N       D  +K +A+     D LR +++A      C   P  + R     + A     +  +  +   GL+G+ DP R+ V +S+  C+ AG+ V ++TGDN  TA+AI R   I   D S+   S   G EF +L+  E+   + N  + AR  P  K  ++E L+  G++ A+TGDG NDAPALK A++G +MG SGT VA+ ASD++L  D+FS IV A++ GR +  ++K+FI++ +  NI  V+  F+++     E   L  VQLLW+NL+ D L A AL  + PD +IM+R PR    SLIS
Sbjct:  639 RFFIKGAAEIVSKNCSYKRNSDDTLEEINEDNKKETDDEIKNLAS-----DALRAISVAHKDFCECDSWPPEQLRDKDSPNIAALDLLFNSQKGLILDGLLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDNILTAKAIARNCAILSTDISSEAYSAMEGTEFRKLTKNERIRILPNLRVLARSSPEDKRLLVETLKGMGDVVAVTGDGTNDAPALKLADVGFSMGISGTEVAREASDIILMTDDFSAIVNAIKWGRCVSVSIKKFIQFQLIVNITAVILTFVSSVASSDETSVLTAVQLLWINLIMDTLAALALATDKPDPNIMDRKPRGRSTSLIS 971          

HSP 2 Score: 124.02 bits (310), Expect = 5.326e-29
Identity = 95/284 (33.45%), Postives = 145/284 (51.06%), Query Frame = 3
Query:  441 KEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSV-----------IKHSDVID--------DLLAVNQD--KIN--MLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINI-----------GHFND--PIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMF 1184
            K+ E+    VIR++ + + +I    ++ GD++ +  GD VPAD  ++   S   + D+S +TGES ++            K  + ID        D+  VN+D  KI   ML SG+ + SG  RGV+TS+G+N+  G+     ++ +   TPL   L   A+ +S    V  I+++L+             G F+D  P   GS     +  F  ++ + V A+PEGLP  +T  L+  T RM K   +VR L S ET+G  + +CSDKTGTLT N MTV R F
Sbjct:  187 KKKENRKIIVIRNDQEILISIH--HVLVGDVISLQTGDVVPADCVMI---SGKCEADESSITGESNTIQKFPVDNSLRDFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLISGSRILSGLGRGVITSVGINSVYGQTMTS-LNAEPESTPLQLHLSQLADNISVYGCVSAIILFLVLFTRYLFYIIPEDGRFHDLDPAQKGSKF---MNIFITSITVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKTGTLTENVMTVVRGF 461          
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Match: EDO47465 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM93])

HSP 1 Score: 1343.18 bits (3475), Expect = 0.000e+0
Identity = 681/999 (68.17%), Postives = 801/999 (80.18%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITG-PRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISR 3077
            MD AH+K V ++L +F+VS+  GL   Q++  Q+ +G N LP E+GKPLWKLVLEQFDDLLVKILL AA+ISF+LA F+  ED TTAFVEP VIL+ILILNA++GVWQE+NAESAI+ALKEYE E AKV R +  GIQ IKA  LVPGDIVEV+VGDKVPADIRI  I STTL++DQSILTGES SV+KH+D I D  AVNQDK NMLFSGTN+ASGKC GVV   GL+T+IGKIRDQ++ +D  +TPL +KLD F EQLSKVIT+ICI VW INIGHFNDPIHGGS L+GAIYYFKIAVALAVAAIPEGLPAV+T CL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V + F+++++++   +  EFE+ G+ Y P GDI    + V  SD   L E A ICSLCNDSSV++N  +  YEKVGE+TETAL+ LVEK+N+ N++    +K QL+T+CN  I++  NKEFTLEFSRDRKSMS +  P       Q    N  + G P++ VKGAPEGILDRC FVR    +  MT  +K QI+  + AYGTG DTLRCLALA VD+P++ S+MD   +  F  YES+MTFVG+ GMLDPPR EV D+I  C  AGIRVIVITGDNKATAEAICRRI +FG+DE T G SY+GREFD L+  EQR A   A LF+RVEP+HKSKI+ +LQ +GEISAMTGDGVNDAPALKKAEIG+AMGSGTAVAK+AS+M+LADDNFSTIVAAVEEGR+IY+N KQFIRYLISSNIGEVV IFLTAALGMPEALIPVQLLWVNL+TDG PATAL FNPPD DIM +PPRSP++ LISGWLFFRY+AIG YVG ATVG++AWWFM   NGP VSYYQLTHH+QC T+P+   G+DC VF    PMTMALSVLV IEM NALNSL+EN+SL+ MPPWRN  L+ AI  S  +HFLIL     + +F+I+PL++ EW+ V+KFSFPV+LLDE LK ISR
Sbjct:    1 MDLAHTKPVPEILKYFNVSESKGLDPAQVKQFQKKFGPNELPAEDGKPLWKLVLEQFDDLLVKILLVAAVISFVLALFEEGEDQTTAFVEPIVILVILILNAIIGVWQERNAESAIEALKEYEPEIAKVQRQDKSGIQMIKARDLVPGDIVEVAVGDKVPADIRITTIKSTTLRVDQSILTGESISVVKHTDAIPDERAVNQDKTNMLFSGTNIASGKCSGVVVGTGLSTQIGKIRDQMIPSDDERTPLQQKLDEFGEQLSKVITIICIAVWAINIGHFNDPIHGGSWLKGAIYYFKIAVALAVAAIPEGLPAVVTICLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVHKFFVMKDISRGRAEFHEFEVEGTTYDPVGDITKDGRNVTTSDYEVLPEFATICSLCNDSSVDYNNVRDSYEKVGESTETALIVLVEKLNVLNVDLEGKTKAQLATICNESIKNHFNKEFTLEFSRDRKSMSVYCVP-------QKDGPNSFLDGKPKMFVKGAPEGILDRCDFVRVGNKKHPMTPKMKAQILDLIKAYGTGADTLRCLALATVDDPIAPSKMDLEASEKFVNYESHMTFVGVAGMLDPPRPEVTDAIKLCAKAGIRVIVITGDNKATAEAICRRIEVFGQDEDTTGLSYSGREFDDLTPSEQREACLRARLFSRVEPSHKSKIVTYLQEEGEISAMTGDGVNDAPALKKAEIGVAMGSGTAVAKTASEMILADDNFSTIVAAVEEGRSIYDNTKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLMTDGPPATALSFNPPDSDIMSKPPRSPRQPLISGWLFFRYLAIGVYVGCATVGASAWWFMFYENGPKVSYYQLTHHMQCGTDPS--FGLDCAVFGDLHPMTMALSVLVTIEMFNALNSLAENESLLTMPPWRNPSLLTAIAASFLMHFLILYFPITNTIFRITPLNWVEWMAVLKFSFPVILLDEVLKFISR 990          
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Match: EDO35616 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL15])

HSP 1 Score: 461.07 bits (1185), Expect = 9.652e-145
Identity = 325/1016 (31.99%), Postives = 520/1016 (51.18%), Query Frame = 3
Query:   93 AHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQD-----KINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEK-------MNMTNINKSTYS--KKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRNQQHRK 3095
            A + +V +VL  F+     GL++ +IE  +  +G N     E K LWK  L+QF + ++ +LL++  +S  +  FD +   T A +          +   V   QE  ++ +++A+ +        +R+    +    A  LVPGD+V +S+GD+VPADIR+ +  +  L+ID+S  TGE     K +  I    AVN       + N+ F GT V SG+ +GVV   G N+E G+I   +   +  KTPL K +D+  +QLS     +CI+  ++ +G            R  +  F I V+LAVAAIPEGLP V+T  L+LG  RMAK+NAIV+ LP VETLGC+SVICSDKTGTLT N+MTVS++F       + T        G  YSP G++   E  +  +    + +  E   LCN++S+      GV    G+ TE A+V + +K       ++   +++  +S  KK ++  C  K +S+       E +RD                                VKGAPE ++ +CT    +   V MT    ++I   V A  +    LR +A              FA+  +  +    +T++G++G+LDPPR+ V +++    ++G++V +ITGD++ TA  I   +GI  +   T+    +G E + L   +    +   S+F RV P HK  I++ LQ+ G + AMTGDGVNDA ALK+A+IGIAMG SGT V+K A++M+L DD+F+TI+AA+EEG+ I+ N+K F+R+ +S++I  +  I ++  L +P  L  +Q+LW+N++ DG PA +LG  P D D+M RPPR+ K  +I+  L  + ++    +   T+    W F          + ++  ++     P D               TM  +  V  +M NAL+  S+ +S+ ++    N   + A+  S+   FL++    L  VFQ   L  ++ L ++  S  V ++DE  K I+     R+
Sbjct:   11 ASAMAVEEVLKQFNTDQSRGLSNDEIERRRMLHGWNEFDVVEEKALWKKYLDQFKEPMILLLLASGFVSICMGQFDDAFSITVAIL----------IVVTVAFVQEYRSDKSVEAITKLVPPQCHCVRAGK--MFNFLARCLVPGDLVCISIGDRVPADIRLTE--AVDLEIDESSFTGEMEPASKTTLPIP---AVNSGSGVSARRNIAFMGTLVRSGRGKGVVIGTGENSEFGEIFKLMKAEETPKTPLQKSMDSLGKQLS--FYSLCIIGLIVLLGWIQK--------RAILEMFTIGVSLAVAAIPEGLPIVVTVTLALGVMRMAKRNAIVKKLPIVETLGCSSVICSDKTGTLTKNEMTVSQIFTADGFYAEAT--------GVGYSPLGEVILNEDPITYTSNSSIAKTVEAGYLCNNASIR----NGVL--YGQPTEGAIVTVAQKASTFTCGIDFVRVDERPFSSEKKLMAVKCRRKHRSSA----MAEIARDI-----------------------------YYVKGAPENVMRQCTSYYKNGSAVPMTAKDVERIGDAVLAMSS--RGLRVIA--------------FAHGEDLQQ----LTYLGIMGLLDPPRNGVREAVRTLLDSGVQVKMITGDSRETAITIAELLGIHFKGRPTL----SGEELEALDGLQLSTIIDQVSVFYRVSPRHKVAIVKALQQHGHVVAMTGDGVNDAVALKRADIGIAMGKSGTDVSKEAAEMILVDDDFNTIMAAIEEGKGIFYNIKNFVRFQLSTSIAAISLITISTFLKLPNPLNAMQILWINIIMDGPPAQSLGVEPVDSDVMRRPPRNVKSPMITKTLIAKVISAALLIVCGTL----WVF----------WREMRDNI---ITPRD--------------TTMTFTCFVFFDMFNALSCRSQEKSIFQVGFLTNRMFLYAVGGSLIGQFLVIYFAPLQAVFQTEALHITDILLLLAVSSSVFIVDEIRKFITYRVSKRR 897          
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Match: EDO40680 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6M1])

HSP 1 Score: 363.999 bits (933), Expect = 1.768e-107
Identity = 307/1048 (29.29%), Postives = 493/1048 (47.04%), Query Frame = 3
Query:   96 HSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLW-KLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPF--------VXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFN-ESKGVYEK--VGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQ--TTVRNHNITGPRLLV-KGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESN-------MTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGK-----SYTGREFD------------QLSDFEQRN-----AVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSP-KESLISGWLF-FRYMAIGCYVGAATVGSAAWWFMSSPNG--PSVSY-----YQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISR 3077
            H  +V +++   D + + GLTD++  +  +  G N L      P W K + + F    + + + A +        + +E+      EP         V+  ++I+  +   +QE  +   +++ K    + A V+RS   G +T+ A  LV GD+V V  GD++P DIRI++  S   ++D S LTGES    +  D   +     +   N+ F  T    G   GVV   G NT +G+I +        KTP+  ++++F   ++ V   + +  ++I        I     L   I+     + + VA +PEGL A +T CL+L   RMA KN +V++L +VETLG TS ICSDKTGTLT N+MTV+ ++   N+ +  T   + + SG K S                    Y ++ + +LCN +  + + E K V ++   G+A+E+AL+  VE      I      +K    VC     ST           ++  +S    P  PE D++  + V         +LV KGAPE ILDRC+ +  +     + +  K+   +  A    G    R L       P  +  + F      +  E N       + FVGL+ M+DPPR+ V D++  CR+AGI+VI++TGD+  TA+AI + +GI  E   TV       +    E D            QL D++Q             +FAR  P  K  I+E  QR G I A+TGDGVND+PALKKA+IG+AMG +G+ V+K A+DM+L DDNF++IV  VEEGR I++N+K+ I Y ++SNI E+    +   L +P  L  V +L ++L TD +PA +L +   + DIM+R PR P  + L++  L    Y  IG     A+ G   ++ + + NG  PS+ +     +   ++           G   +  L     T     +V+++  + +   +   SL       N +L   +    +L         +S   ++ PL++  W   M FS  + + DE  + I R
Sbjct:   72 HRITVEELMTRLDTNVQTGLTDEEAAIRLKRDGPNALTPPPTTPEWVKFMKQMFGGFAMLLWIGAILCFIAQGIMEATEE------EPLRDNLYLGIVLAFVVIVTGIFSYYQESKSSKIMESFKNLVPQEANVLRSG--GRKTVGAENLVIGDVVSVKGGDRLPGDIRILECKS--FKVDNSSLTGESEPQSRGPDCTHENPLETR---NLAFFSTYALEGNATGVVVQTGDNTVMGRIANLASGLGSGKTPIAVEIEHFIHIITGVAVFLGVTFFIIAF------ILKYKWLEAVIFL----IGIIVANVPEGLLATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHLWYDNNIVEADTSEDQKQASGEKKS-----------------TTWYALSRVATLCNRAEFKADQEDKPVLKRECTGDASESALLKYVE----LAIGNVISFRKNHKKVCEIPFNST-----------NKYQVSIHEIPDEPEHDIEEGSDVDEREKNSKHILVMKGAPERILDRCSTILVNGKEQALDDKEKENFNQ--AYLDLGGLGERVLGFCHFYLPTEQFPLGFE-----FDPEDNPNFPLEGLCFVGLMSMIDPPRAAVPDAVSKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGTETVEDIAERLNIPVEEVDETKAKAIVVHGSQLKDYDQEKIDGILCNHTEIVFARTSPQQKLIIVEGCQRMGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEISPFLMFIILDIPLPLGTVTILCIDLGTDMVPAISLAYEHAENDIMKRQPRDPINDKLVNERLIAMAYGQIGMI--QASAGFFTYFVIMAENGFRPSLLFGLRRQWDDKYNHSVVDSYGQEWGYSQRKILEYTCHTAFFVSIVIVQWADLIICKTRRNSLFTQ-GMTNKFLNFGLFFETALAAFFSYTPGMSNGLRMYPLNWQWWFPAMPFSLIIWIYDECRRWILR 1054          
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Match: EDO36455 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SII2])

HSP 1 Score: 363.614 bits (932), Expect = 2.324e-107
Identity = 264/804 (32.84%), Postives = 412/804 (51.24%), Query Frame = 3
Query:  387 AVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQI-MKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESN--------MTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTV--------------GKSYT------GREFDQLSDFEQRNAVRNAS--LFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPK-ESLISGWLF-FRYMAIGCYVGAATVGSAAWWFMSSPNG 2696
            A    +QE  +   +D+ K    + A ++R   K ++   A Q+V GDI+ V++GD+VPADIR+  I S   ++D S LTGES    +  +   +     +   N+ F  TN   G C G+V   G NT +G+I          KTP+  ++ +F   ++ V   + +  ++I++      + G ++L+  I+     + + VA +PEGL A +T CL+L   RMA KN +V++L +VETLG TS ICSDKTGTLT N+MTV+ M+          D + FE   ++      +   E       I  L   AE  S  ++ +V   ++ G     G A+E AL+  VE      +   T  +++   V      ST NK               +   I+   D  +T  +H      LL+KGAPE +LDRC+ +        + + +K    M  +   G G+   R L  A       +  +D  N    +++E++        + FVGL+ M+DPPR+ V D++  CR+AGI+V ++TGD+  TA+AI + +GI  E   TV               KS        G E   ++D +  + ++N    +FAR  P  K  I+E  QR+G I A+TGDGVND+PALKKA+IGIAMG SG+ V+K A+DM+L DDNF++IV  VEEGR I++N+K+ I Y ++SNI E+    +    G+P+ L  + +L ++L TD +PA +L +   + DIM+R PR P+ E L++  L    Y  IG     A+ G   ++ + + NG
Sbjct:  179 ACFSYYQESKSSKIMDSFKNMVPQEATILRDGKKVVK--NAEQVVIGDIIFVAIGDRVPADIRV--IESKGFKVDNSSLTGESEPQARGPEFTHENPLETK---NLAFFSTNAVEGTCTGIVVQTGDNTVMGRIAGLASGLGSGKTPIAIEIGHFIHIITGVAVALGVTFFIISL------VLGYTILQAVIFL----IGIIVANVPEGLLATVTVCLTLTAKRMAAKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWF---------DNKTFEADTTEDQSGTAMEKTETWTALGRIAGLCNRAEFVSGQDNVAVLRRDTMG-----GNASEAALLKCVE----LQVGSVTKMREEFHRVAEIPFNST-NK---------------YHVSIHEINDENSTYSHH------LLMKGAPERVLDRCSTILIKGELKPLDDDMKQAFEMAYLDLGGMGE---RVLGFA-------QHYLDKENFPIGFEFETDEPNFPVEGLCFVGLMSMIDPPRAAVPDAVAKCRSAGIKVFMVTGDHPITAKAIAQGVGIISEGTETVEDISLRLEIPVEEVDKSQADAIVVHGGELKDMTDKDIDDILKNHKEIVFARTSPQQKLIIVEGCQRNGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLMFIVAGIPQPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRMPRDPRTEKLVNERLISMTYGQIGFM--QASAGFLTYFVIMAENG 913          
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Match: EDO41775 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3I0])

HSP 1 Score: 240.35 bits (612), Expect = 6.084e-65
Identity = 273/1053 (25.93%), Postives = 465/1053 (44.16%), Query Frame = 3
Query:   93 AHSKSVHDVLDFFDVSDEFGLTD--KQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSE----DSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQS-----------------------ILTGESRSVI------KHSDVIDDLL-AVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTD--------QVKTPLTKKLDNFAEQL------SKVITVICIVVWLINIGHFNDPIH-GGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFA--NAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQL-SDFEQRNAVRN-------ASLFARVEPAHKSKIIE-----HLQRDGEISAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNS-LSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLL 3047
            A +  +H ++     S E G++   + IE  +  +G N +P +  K  W+ +++   D  + IL  AA++S +L  F   E    ++ T +++ F IL+ + + A+V    +   E     L+       K     +   + I  +++V GD+ ++  GD +PAD  +V+  S  L++D+S                       I+ G  + ++        S +I  LL A + DKI+   SG + A  +   +  + G + E   + D    ++        Q K+ L  KL   A  +      + ++T+I + +      +  +      + L   +  F   + + V A+PEGLP  +T  L+    +M   N +VR L + ET+G  + ICSDKTGTLTTN+MTV +++ +      G   +    +  ++SP      +   + C  I      A  C +     +       +  +VG  TE A       + +      TY   +     ++  +ST  K +T  F+  RKSMS  +    P+G            G RL  KGA E +L RCT +    G+ E  +S     + +        D LR + +A  D P +    D    +  +     S MT + + G+ DP R EV  +I  C+ AGI V ++TGDN  TA +I  + GI   D+  +     G+EF++L  D   R + +          + AR  P  K  +++      L    EI A+TGDG ND PALKKA++G AMG +GT VAK ASD++L DDNF +IV AV  GR +Y+++ +F+++ ++ N+  +V  F+ A +     L   QLLWVNL+ D   + AL   PP  +++ R P    + LI+  +    +  G Y            F+    G    ++ +       T         CK   HS    +  +  VL+++ N +NS +   +  V    +RN   +  +  +  +  LI+E+    K F +  L++ +W+  +   F  LL
Sbjct:   51 ASTGGLHGLVRKLHTSTEKGISGFPEDIENRKRVFGPNVIPPKPPKTFWEFLVDACKDTTLIILTVAAVVSLLLGIFAPEECGGSEANTGWIDGFAILIAVCIVALVTAVNDYQKEQQFRGLQSKIELEHKFTVIRNGDAKEILNSEIVVGDLCQIKYGDLLPADGVVVQ--SNDLKVDESSLTGESDMVKKGEKDPLFLAGTHIMEGSGKMIVTAVGLNSQSGIIFTLLGATHPDKID---SGDD-APPQSPAIKGAPGDDFEDVNLDDDQESSENGKERKDKQEKSVLQAKLTKLAVTIGWFGVAAALLTIIVMALQFSIRKYVKEKASWQNTHLNAYVNAFITGLTVLVVAVPEGLPLAVTISLAYSVKKMLDDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQLYTM------GQHHKTIPENPKEFSP------ELLEILCKGIALNSSYASNCVVNGGREI-------LPMQVGNKTECA------LLGLVLDLGDTYQDYR-----DNNPESTFVKVYT--FNSSRKSMSTAIR--MPDG------------GYRLFSKGASEILLSRCTSIIGRNGQPEPFSSQDCLSLVQSVIEPMASDGLRTICMAYRDFPPTGKDHDDTPPDWDDEAGILSEMTAIAIAGIEDPVRQEVPAAIKKCQQAGIVVRMVTGDNVNTARSIAGKCGILEPDKDFL--VLDGKEFNKLIRDSNGRVSQKKFDEIWPRLRVLARSSPEDKYTLVKGIIDSKLNPAREIVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFRSIVMAVMWGRNVYDSISKFLQFQLTVNLVAIVIAFVGACVVEVSPLTGTQLLWVNLIMDSFASLALATEPPTEELLTRKPYGRTKPLITRTMIRNILGHGVY-------QIIVLFVLVFKG--AEFFDIEDGFLEETR--------CKPTQHS---AVIFNTFVLMQLFNEINSRMVHGERNVFKGIFRNPIFVGIMGGTFIVQILIIEL--TGKAFHVVGLNWEQWMWCIFLGFTELL 1027          
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Match: atp2a1l (sarcoplasmic/endoplasmic reticulum calcium ATPase 1 [Source:NCBI gene;Acc:101171864])

HSP 1 Score: 1360.51 bits (3520), Expect = 0.000e+0
Identity = 679/999 (67.97%), Postives = 801/999 (80.18%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRN 3080
            M+NAH+K+  + L  F V++  GLT  Q + + E YG N LP EEGK +W+L++EQF+DLLV+ILL AA ISF+LAWF+  E++ TAFVEPFVILLILI NA+VGVWQE+NAESAI+ALKEYE E  KV RS+ K +Q IKA ++VPGDIVEVSVGDKVPADIRI  I STTL++DQSILTGES SVIKH++V+ D+ AVNQDK NMLFSGTN+A+GK  GV  + G+ TEIGKIRDQ+  T+Q KTPL  KLD F EQLSKVI++IC+ VW INIGHFNDP+HGGS +RGA+YYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM V++MF+++N + D  D+  F+ISGSKY+P+G++     R  CS    L E+A IC+LCNDSS+++NESK +YEKVGEATETAL CLVEKMN+ N N    S+ + +  C S I+  + K FTLEFSRDRKSMS + +P   +G            G ++ VKGAPEG++DRC +VR    RV +TN+IKD+IM  +  +GTG+DTLRCLALA  D P+    M   ++  F  YE+++TFVG VGMLDPPR EV  SI  CRNAGIRVI+ITGDNK TA AICRRIGIF EDE   GK+YTGREFD L   EQ  AVR A  FARVEPAHKSKI+E LQ   +I+AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAS+MVLADDNFS+IVAAVEEGRAIYNNMKQFIRYLISSN+GEVVCIFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM +PPRSPKE LISGWLFFRYMAIG YVGAATVG AAWWF+  P GP ++YYQL+H +QC  +  DF G+DC++F    PMTMALSVLV IEM NALNSLSENQSLV+MPPW N WL+ A+TLSMSLHF+I+ V  L  +F++  LS  +W+ V+K SFPV+L+DE LK ++RN
Sbjct:    1 MENAHAKTPAECLAHFGVNENTGLTPDQFKKNLEKYGYNELPAEEGKSIWELIIEQFEDLLVRILLLAACISFVLAWFEEGEETVTAFVEPFVILLILIANAIVGVWQERNAESAIEALKEYEPEMGKVYRSDRKSVQMIKAREIVPGDIVEVSVGDKVPADIRITSIKSTTLRVDQSILTGESVSVIKHTEVVPDMRAVNQDKKNMLFSGTNIAAGKAIGVAIATGVGTEIGKIRDQMAATEQEKTPLQAKLDEFGEQLSKVISLICVAVWAINIGHFNDPVHGGSWIRGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMCVTKMFVIKNADGDHVDLDAFDISGSKYTPEGEVTQGGARTNCSQYDGLVELATICALCNDSSLDYNESKKIYEKVGEATETALCCLVEKMNVFNTNVKNLSRVERANACCSVIKQLMKKNFTLEFSRDRKSMSVYCTPAKGDG------------GAKMFVKGAPEGVIDRCAYVRVGTTRVPLTNAIKDKIMAVIKEWGTGRDTLRCLALATRDTPLKVEEMVLEDSTKFVDYETDLTFVGCVGMLDPPRKEVTSSIELCRNAGIRVIMITGDNKGTAIAICRRIGIFSEDEDVSGKAYTGREFDDLPLHEQAEAVRRACCFARVEPAHKSKIVEFLQGFDDITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSSIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMGKPPRSPKEPLISGWLFFRYMAIGGYVGAATVGGAAWWFLYDPTGPEITYYQLSHFMQCHADNEDFAGIDCEIFEECPPMTMALSVLVTIEMCNALNSLSENQSLVRMPPWSNFWLLAAMTLSMSLHFMIIYVDPLPMIFKLKHLSVDQWMVVLKLSFPVILIDEVLKFVARN 987          
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Match: atp2a1l (sarcoplasmic/endoplasmic reticulum calcium ATPase 1 [Source:NCBI gene;Acc:101171864])

HSP 1 Score: 1359.74 bits (3518), Expect = 0.000e+0
Identity = 679/999 (67.97%), Postives = 801/999 (80.18%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRN 3080
            M+NAH+K+  + L  F V++  GLT  Q + + E YG N LP EEGK +W+L++EQF+DLLV+ILL AA ISF+LAWF+  E++ TAFVEPFVILLILI NA+VGVWQE+NAESAI+ALKEYE E  KV RS+ K +Q IKA ++VPGDIVEVSVGDKVPADIRI  I STTL++DQSILTGES SVIKH++V+ D+ AVNQDK NMLFSGTN+A+GK  GV  + G+ TEIGKIRDQ+  T+Q KTPL  KLD F EQLSKVI++IC+ VW INIGHFNDP+HGGS +RGA+YYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM V++MF+++N + D  D+  F+ISGSKY+P+G++     R  CS    L E+A IC+LCNDSS+++NESK +YEKVGEATETAL CLVEKMN+ N N    S+ + +  C S I+  + K FTLEFSRDRKSMS + +P   +G            G ++ VKGAPEG++DRC +VR    RV +TN+IKD+IM  +  +GTG+DTLRCLALA  D P+    M   ++  F  YE+++TFVG VGMLDPPR EV  SI  CRNAGIRVI+ITGDNK TA AICRRIGIF EDE   GK+YTGREFD L   EQ  AVR A  FARVEPAHKSKI+E LQ   +I+AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAS+MVLADDNFS+IVAAVEEGRAIYNNMKQFIRYLISSN+GEVVCIFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM +PPRSPKE LISGWLFFRYMAIG YVGAATVG AAWWF+  P GP ++YYQL+H +QC  +  DF G+DC++F    PMTMALSVLV IEM NALNSLSENQSLV+MPPW N WL+ A+TLSMSLHF+I+ V  L  +F++  LS  +W+ V+K SFPV+L+DE LK ++RN
Sbjct:    1 MENAHAKTPAECLAHFGVNENTGLTPDQFKKNLEKYGYNELPAEEGKSIWELIIEQFEDLLVRILLLAACISFVLAWFEEGEETVTAFVEPFVILLILIANAIVGVWQERNAESAIEALKEYEPEMGKVYRSDRKSVQMIKAREIVPGDIVEVSVGDKVPADIRITSIKSTTLRVDQSILTGESVSVIKHTEVVPDMRAVNQDKKNMLFSGTNIAAGKAIGVAIATGVGTEIGKIRDQMAATEQEKTPLQAKLDEFGEQLSKVISLICVAVWAINIGHFNDPVHGGSWIRGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMCVTKMFVIKNADGDHVDLDAFDISGSKYTPEGEVTQGGARTNCSQYDGLVELATICALCNDSSLDYNESKKIYEKVGEATETALCCLVEKMNVFNTNVKNLSRVERANACCSVIKQLMKKNFTLEFSRDRKSMSVYCTPAKGDG------------GAKMFVKGAPEGVIDRCAYVRVGTTRVPLTNAIKDKIMAVIKEWGTGRDTLRCLALATRDTPLKVEEMVLEDSTKFVDYETDLTFVGCVGMLDPPRKEVTSSIELCRNAGIRVIMITGDNKGTAIAICRRIGIFSEDEDVSGKAYTGREFDDLPLHEQAEAVRRACCFARVEPAHKSKIVEFLQGFDDITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSSIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMGKPPRSPKEPLISGWLFFRYMAIGGYVGAATVGGAAWWFLYDPTGPEITYYQLSHFMQCHADNEDFAGIDCEIFEECPPMTMALSVLVTIEMCNALNSLSENQSLVRMPPWSNFWLLAAMTLSMSLHFMIIYVDPLPMIFKLKHLSVDQWMVVLKLSFPVILIDEVLKFVARN 987          
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Match: atp2a1l (sarcoplasmic/endoplasmic reticulum calcium ATPase 1 [Source:NCBI gene;Acc:101171864])

HSP 1 Score: 1345.1 bits (3480), Expect = 0.000e+0
Identity = 677/1005 (67.36%), Postives = 800/1005 (79.60%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEG-KPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRNQQHRK 3095
            M+NAH+K+  + L  F V++  GLT  Q + + E YG NG  +  G K +W+L++EQF+DLLV+ILL AA ISF+LAWF+  E++ TAFVEPFVILLILI NA+VGVWQE+NAESAI+ALKEYE E  KV RS+ K +Q IKA ++VPGDIVEVSVGDKVPADIRI  I STTL++DQSILTGES SVIKH++V+ D+ AVNQDK NMLFSGTN+A+GK  GV  + G+ TEIGKIRDQ+  T+Q KTPL  KLD F EQLSKVI++IC+ VW INIGHFNDP+HGGS +RGA+YYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM V++MF+++N + D  D+  F+ISGSKY+P+G++     R  CS    L E+A IC+LCNDSS+++NESK +YEKVGEATETAL CLVEKMN+ N N    S+ + +  C S I+  + K FTLEFSRDRKSMS + +P   +G            G ++ VKGAPEG++DRC +VR    RV +TN+IKD+IM  +  +GTG+DTLRCLALA  D P+    M   ++  F  YE+++TFVG VGMLDPPR EV  SI  CRNAGIRVI+ITGDNK TA AICRRIGIF EDE   GK+YTGREFD L   EQ  AVR A  FARVEPAHKSKI+E LQ   +I+AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAS+MVLADDNFS+IVAAVEEGRAIYNNMKQFIRYLISSN+GEVVCIFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM +PPRSPKE LISGWLFFRYMAIG YVGAATVG AAWWF+  P GP ++YYQL+H +QC  +  DF G+DC++F    PMTMALSVLV IEM NALNSLSENQSLV+MPPW N WL+ A+TLSMSLHF+I+ V  L  +F++  LS  +W+ V+K SFPV+L+DE LK ++RN    K
Sbjct:    1 MENAHAKTPAECLAHFGVNENTGLTPDQFKKNLEKYGYNG--ESLGRKSIWELIIEQFEDLLVRILLLAACISFVLAWFEEGEETVTAFVEPFVILLILIANAIVGVWQERNAESAIEALKEYEPEMGKVYRSDRKSVQMIKAREIVPGDIVEVSVGDKVPADIRITSIKSTTLRVDQSILTGESVSVIKHTEVVPDMRAVNQDKKNMLFSGTNIAAGKAIGVAIATGVGTEIGKIRDQMAATEQEKTPLQAKLDEFGEQLSKVISLICVAVWAINIGHFNDPVHGGSWIRGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMCVTKMFVIKNADGDHVDLDAFDISGSKYTPEGEVTQGGARTNCSQYDGLVELATICALCNDSSLDYNESKKIYEKVGEATETALCCLVEKMNVFNTNVKNLSRVERANACCSVIKQLMKKNFTLEFSRDRKSMSVYCTPAKGDG------------GAKMFVKGAPEGVIDRCAYVRVGTTRVPLTNAIKDKIMAVIKEWGTGRDTLRCLALATRDTPLKVEEMVLEDSTKFVDYETDLTFVGCVGMLDPPRKEVTSSIELCRNAGIRVIMITGDNKGTAIAICRRIGIFSEDEDVSGKAYTGREFDDLPLHEQAEAVRRACCFARVEPAHKSKIVEFLQGFDDITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSSIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMGKPPRSPKEPLISGWLFFRYMAIGGYVGAATVGGAAWWFLYDPTGPEITYYQLSHFMQCHADNEDFAGIDCEIFEECPPMTMALSVLVTIEMCNALNSLSENQSLVRMPPWSNFWLLAAMTLSMSLHFMIIYVDPLPMIFKLKHLSVDQWMVVLKLSFPVILIDEVLKFVARNYVESK 991          
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Match: atp2a1 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1 [Source:NCBI gene;Acc:101160483])

HSP 1 Score: 1342.02 bits (3472), Expect = 0.000e+0
Identity = 669/1004 (66.63%), Postives = 806/1004 (80.28%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRNQQHRK 3095
            M+NAHSK   +VL  F V+++ GL+  Q++ + E YG N LP EEGK +W LV+EQF+DLLV+ILL AA ISF+LAWF+  E++ TAFVEPFVILLILI NA+VGVWQE+NAESAI+ALKEYE E  KV R++ K +Q IKA ++VPGD+VEVSVGDKVPADIRI+ I STTL++DQSILTGES SVIKH+D + D  AVNQDK NMLFSGTN+A+GK  G+  + G+ TEIGKIRDQ+  T+Q KTPL +KLD F EQLSKVI++IC+ VW+INIGHFNDP+HGGS +RGAIYYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM V++MFI+  V  D   + +F+ISGSKY+P+G++      VKC     L E+A IC+LCNDSS+++NESKG+YEKVGEATETAL CLVEKMN+ N +    SK + +  C S I+  + KEFTLEFSRDRKSMS + +P                 G ++ VKGAPEG++DRC++VR    R+ +T+ +KD IM  +  +GTG+DTLRCLALA  D P  +  M+  ++ +F  YE+++TFVG VGMLDPPR EV  SI  CR AGIRVI+ITGDNK TA AICRRIGIF E+E   GK++TGREFD LS +EQ+NAVR A  FARVEP+HKSKI+E LQ   EI+AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAS+MVLADDNFS+IV+AVEEGRAIYNNMKQFIRYLISSN+GEVVCIFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM + PRSPKE LISGWLFFRY+AIG YVG+ATV +AAWWF+    GP V++YQL+H +QC+ +  DF G+ C+VF  + PMTMALSVLV IEM NALNSLSENQSLV+MPPW N+WL+ A++LSMSLHF+I+ V  L  +F+++ L+  +WL V+K SFPV+L+DE LK ++R     K
Sbjct:    1 MENAHSKESAEVLAHFGVTEDTGLSPDQVKRNLEKYGFNELPAEEGKSIWDLVVEQFEDLLVRILLLAACISFVLAWFEEGEETVTAFVEPFVILLILIANAIVGVWQERNAESAIEALKEYEPEMGKVYRADRKSVQRIKAREIVPGDVVEVSVGDKVPADIRIISIKSTTLRVDQSILTGESVSVIKHTDAVPDPRAVNQDKKNMLFSGTNIAAGKATGIAVATGVTTEIGKIRDQMAATEQEKTPLQQKLDEFGEQLSKVISLICVAVWIINIGHFNDPVHGGSWMRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMCVTKMFIIDKVEGDNVALGQFDISGSKYTPEGEVTRNSSLVKCGQYDGLVELATICALCNDSSLDYNESKGIYEKVGEATETALCCLVEKMNVFNTDVRGLSKVERANTCCSVIKQLMKKEFTLEFSRDRKSMSVYCTPAK---------SAKAPVGSKMFVKGAPEGVIDRCSYVRVGTNRIPLTSPVKDHIMSVIKEWGTGRDTLRCLALATRDTPPRKEEMNLEDSNHFVDYETDLTFVGCVGMLDPPRKEVTSSIELCRAAGIRVIMITGDNKGTAVAICRRIGIFTEEEDVTGKAFTGREFDDLSLYEQKNAVRKACCFARVEPSHKSKIVEFLQGFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMGKAPRSPKEPLISGWLFFRYLAIGGYVGSATVAAAAWWFLYCDEGPMVTFYQLSHFMQCSEDNEDFDGIRCEVFESAPPMTMALSVLVTIEMCNALNSLSENQSLVRMPPWSNLWLMGAMSLSMSLHFMIIYVDPLPMIFKLTHLNLEQWLMVLKLSFPVILIDELLKFVARTYLEGK 995          
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Match: atp2a1 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1 [Source:NCBI gene;Acc:101160483])

HSP 1 Score: 1328.92 bits (3438), Expect = 0.000e+0
Identity = 664/999 (66.47%), Postives = 801/999 (80.18%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRN 3080
            M+NAHSK   +VL  F V+++ GL+  Q++ + E YG NG      K +W LV+EQF+DLLV+ILL AA ISF+LAWF+  E++ TAFVEPFVILLILI NA+VGVWQE+NAESAI+ALKEYE E  KV R++ K +Q IKA ++VPGD+VEVSVGDKVPADIRI+ I STTL++DQSILTGES SVIKH+D + D  AVNQDK NMLFSGTN+A+GK  G+  + G+ TEIGKIRDQ+  T+Q KTPL +KLD F EQLSKVI++IC+ VW+INIGHFNDP+HGGS +RGAIYYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM V++MFI+  V  D   + +F+ISGSKY+P+G++      VKC     L E+A IC+LCNDSS+++NESKG+YEKVGEATETAL CLVEKMN+ N +    SK + +  C S I+  + KEFTLEFSRDRKSMS + +P                 G ++ VKGAPEG++DRC++VR    R+ +T+ +KD IM  +  +GTG+DTLRCLALA  D P  +  M+  ++ +F  YE+++TFVG VGMLDPPR EV  SI  CR AGIRVI+ITGDNK TA AICRRIGIF E+E   GK++TGREFD LS +EQ+NAVR A  FARVEP+HKSKI+E LQ   EI+AMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAS+MVLADDNFS+IV+AVEEGRAIYNNMKQFIRYLISSN+GEVVCIFLTAALG+PEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM + PRSPKE LISGWLFFRY+AIG YVG+ATV +AAWWF+    GP V++YQL+H +QC+ +  DF G+ C+VF  + PMTMALSVLV IEM NALNSLSENQSLV+MPPW N+WL+ A++LSMSLHF+I+ V  L  +F+++ L+  +WL V+K SFPV+L+DE LK ++R 
Sbjct:    1 MENAHSKESAEVLAHFGVTEDTGLSPDQVKRNLEKYGFNG------KSIWDLVVEQFEDLLVRILLLAACISFVLAWFEEGEETVTAFVEPFVILLILIANAIVGVWQERNAESAIEALKEYEPEMGKVYRADRKSVQRIKAREIVPGDVVEVSVGDKVPADIRIISIKSTTLRVDQSILTGESVSVIKHTDAVPDPRAVNQDKKNMLFSGTNIAAGKATGIAVATGVTTEIGKIRDQMAATEQEKTPLQQKLDEFGEQLSKVISLICVAVWIINIGHFNDPVHGGSWMRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMCVTKMFIIDKVEGDNVALGQFDISGSKYTPEGEVTRNSSLVKCGQYDGLVELATICALCNDSSLDYNESKGIYEKVGEATETALCCLVEKMNVFNTDVRGLSKVERANTCCSVIKQLMKKEFTLEFSRDRKSMSVYCTPAK---------SAKAPVGSKMFVKGAPEGVIDRCSYVRVGTNRIPLTSPVKDHIMSVIKEWGTGRDTLRCLALATRDTPPRKEEMNLEDSNHFVDYETDLTFVGCVGMLDPPRKEVTSSIELCRAAGIRVIMITGDNKGTAVAICRRIGIFTEEEDVTGKAFTGREFDDLSLYEQKNAVRKACCFARVEPSHKSKIVEFLQGFDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMGKAPRSPKEPLISGWLFFRYLAIGGYVGSATVAAAAWWFLYCDEGPMVTFYQLSHFMQCSEDNEDFDGIRCEVFESAPPMTMALSVLVTIEMCNALNSLSENQSLVRMPPWSNLWLMGAMSLSMSLHFMIIYVDPLPMIFKLTHLNLEQWLMVLKLSFPVILIDELLKFVART 984          
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Match: SMESG000010260.1 (SMESG000010260.1)

HSP 1 Score: 2079.68 bits (5387), Expect = 0.000e+0
Identity = 1027/1029 (99.81%), Postives = 1027/1029 (99.81%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRNQQHRKSIFTNCHLIVLMWGLFAAAVLYCPL 3170
            MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKILLSAAIISFILAWFDHSEDSTTAFVEPFVILLILILNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSD IDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRNQQH KSIFTNCHLIVLMWGLFAAAVLYCPL
Sbjct:    1 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKILLSAAIISFILAWFDHSEDSTTAFVEPFVILLILILNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDAIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRNQQHHKSIFTNCHLIVLMWGLFAAAVLYCPL 1029          
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Match: SMESG000050554.1 (SMESG000050554.1)

HSP 1 Score: 1422.14 bits (3680), Expect = 0.000e+0
Identity = 717/998 (71.84%), Postives = 835/998 (83.67%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISR 3077
            M+N+H K+V +VL++F+V +E GL+D+Q++   E +G N +P EE K LW+L+LEQFDDLLVKILL AAIISF+LA F+  EDS TAFVEPFVI+LILI NA+VGVWQE+NAESAI+ALKEYE E AKV R N KG+Q IKA +LVPGDI +++VGDKVPADIRI KI STT++IDQSILTGES SVIKHSD I D  AVNQDK N+LFSGTNVASGKCRGVV   GL+TEIGKIR+Q+M T+Q +TPL +KLD F +QLSKVIT+ICI VW INIGHFNDP HGGS +RGAIYYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V+RMF+  N+ +      +FEI+GSKY+P+G++F   ++V+  D   L E+A IC++CNDSS+++NE+K  YEKVGEATETAL CLVEKMN+ N++K+  +KKQL   CN  IQ    KEFTLEFSRDRKSMS +V+P   EG             P++  KGAPEGILDRC FVR    ++ MT +IK +IM+    YGTG+DTLRCLALA +D P  + +M+  ++  FYKYE+NMTFVG+VGMLDPPR+EV DSI  CR AGIRVIVITGDNKATAEAICRRIG+F E+E+T GKSYTGREFD LS+  ++ AVR A LFARVEPAHKSKI+E+LQ DGE+SAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAS+MVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSN+GEVV IFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM +PPRS +E LI+GWLFFRYMA+G YVGAATVG+AAWWF   P GP ++YYQLTHH+QC  E   F G+DCK+F + KPMTMALSVLVLIEMLNA+NSLSENQSL+KMPPW N+WL+ ++ LSMSLHFLILEV FLSKVFQI+PLS  EW  V+K SFPV+LLDE LK+I+R
Sbjct:    1 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKILLLAAIISFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAK-EG------------SPKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMAVGTYVGAATVGAAAWWFTIYPKGPQLNYYQLTHHMQCLAETESFNGIDCKIFQNPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIAR 985          
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Match: SMESG000050554.1 (SMESG000050554.1)

HSP 1 Score: 1419.45 bits (3673), Expect = 0.000e+0
Identity = 716/998 (71.74%), Postives = 834/998 (83.57%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISR 3077
            M+N+H K+V +VL++F+V +E GL+D+Q++   E +G N +P EE K LW+L+LEQFDDLLVKILL AAIISF+LA F+  EDS TAFVEPFVI+LILI NA+VGVWQE+NAESAI+ALKEYE E AKV R N KG+Q IKA +LVPGDI +++VGDKVPADIRI KI STT++IDQSILTGES SVIKHSD I D  AVNQDK N+LFSGTNVASGKCRGVV   GL+TEIGKIR+Q+M T+Q +TPL +KLD F +QLSKVIT+ICI VW INIGHFNDP HGGS +RGAIYYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQM+V+RMF+  N+ +      +FEI+GSKY+P+G++F   ++V+  D   L E+A IC++CNDSS+++NE+K  YEKVGEATETAL CLVEKMN+ N++K+  +KKQL   CN  IQ    KEFTLEFSRDRKSMS +V+P   EG             P++  KGAPEGILDRC FVR    ++ MT +IK +IM+    YGTG+DTLRCLALA +D P  + +M+  ++  FYKYE+NMTFVG+VGMLDPPR+EV DSI  CR AGIRVIVITGDNKATAEAICRRIG+F E+E+T GKSYTGREFD LS+  ++ AVR A LFARVEPAHKSKI+E+LQ DGE+SAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAS+MVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSN+GEVV IFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM +PPRS +E LI+GWLFFRYMA+G YVGAATVG+AAWWF   P GP ++YYQLTH  QC  + + F GVDC +F+H KPMTMALSVLVLIEMLNA+NSLSENQSL+KMPPW N+WL+ ++ LSMSLHFLILEV FLSKVFQI+PLS  EW  V+K SFPV+LLDE LK+I+R
Sbjct:    1 MENSHVKTVDEVLNYFNVDEEVGLSDEQVKRQVERFGFNEMPAEETKALWQLILEQFDDLLVKILLLAAIISFVLALFEEHEDSITAFVEPFVIMLILIANAIVGVWQERNAESAIEALKEYEPEIAKVYRKNAKGVQKIKARELVPGDICDIAVGDKVPADIRITKIFSTTIRIDQSILTGESVSVIKHSDAIPDPRAVNQDKKNLLFSGTNVASGKCRGVVIGTGLDTEIGKIRNQMMETEQERTPLQQKLDEFGQQLSKVITIICIAVWAINIGHFNDPAHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVARMFVFSNITETEISTHQFEITGSKYAPEGEVFLNGQKVRTGDYETLLEIANICAMCNDSSIDYNETKSAYEKVGEATETALTCLVEKMNVHNLSKAGLTKKQLGMACNHHIQGFWKKEFTLEFSRDRKSMSCYVNPAK-EGS------------PKMFCKGAPEGILDRCAFVRVGSKKIPMTAAIKSEIMRITGEYGTGRDTLRCLALATLDNPFKKEQMNLEDSNQFYKYETNMTFVGVVGMLDPPRTEVFDSIVKCRMAGIRVIVITGDNKATAEAICRRIGVFSENETTFGKSYTGREFDDLSEEMKKEAVRRAKLFARVEPAHKSKIVEYLQMDGEVSAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRSTREPLITGWLFFRYMAVGTYVGAATVGAAAWWFTIYPKGPQLNYYQLTHQAQCLAQESRFEGVDCSIFIHPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIAR 985          
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Match: SMESG000039058.1 (SMESG000039058.1)

HSP 1 Score: 1386.7 bits (3588), Expect = 0.000e+0
Identity = 698/1028 (67.90%), Postives = 828/1028 (80.54%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRNQQHRKSIFTNCHLIVLMWGLFAAAVLYCP 3167
            M+  H+++V +VL ++ +++E GL++  I+ +++ YG N LP E+ K L  LVLEQFDDLLVKILL AA+ISFILA F+ +ED+T AFVEPFVILLILI NAVVGVWQE+NAESAI+ALKEYES+ AKV RS+H+GIQ IKA +LVPGD+VE+S+GDKVPADIRI  I STT+++DQSILTGES SVIKH+D I D  AVNQDK N+LFSGTN+ASGKCRGVV +IGL TEIGKIR QI  ++  KTPL +KLD F EQLSKVI++IC+ VW INIGHFNDP HGGS +RGAIYYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVS++F++ N        Q F+I+GSKY+P+G+I+ + K VK SD   L E++ IC++CNDS++++NE+KG YEKVGEATETAL+CLVEK+N  NI K   SK  L+   N  +QS  +K+FTLEFSRDRKSMS F+ P       + ++  H  TG R+ VKGAPEG++DRCTFVR +    +MT  IK +I++ ++AYGTG+DTLRCLALA +D P     MD  ++  F  YE+ MT VG+VGMLDPPRSEV DSI  C  AGIRVIVITGDNKATAEAICRRIG+F E+E+T GKS+TGREFD+LS   Q +A R A LFARVEPAHKSKIIE+LQ DG ISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVL+DDNFS+IV+AVEEGRAIYNNMKQFIRYLISSNIGEVV IFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM+R PR   + LIS WLFFRYM IG YVG ATVGSAAWWFM    GP ++YYQLTHH+QC  E + F G+ C +F + KPM++ALSVLV IEMLNA+NSLSENQSL  MPPW N+WLI A+ LS  LHF+ILEV  LSK+FQI+PL+  EW  VMK S PV+++DE++K ISR     + +    + + LMW  + A +  CP
Sbjct:    1 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNELPPEKSKSLLSLVLEQFDDLLVKILLLAAVISFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADIRITSILSTTIRVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVP-------RDSIDGH--TGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMDDEPLMQGAYGVFLMWAAYFALLFLCP 1019          
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Match: SMESG000039058.1 (SMESG000039058.1)

HSP 1 Score: 1386.7 bits (3588), Expect = 0.000e+0
Identity = 698/1028 (67.90%), Postives = 827/1028 (80.45%), Query Frame = 3
Query:   84 MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKXXXXXXXXXXXXXWFDHSEDSTTAFVEPFVXXXXXXXNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEKRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRNQQHRKSIFTNCHLIVLMWGLFAAAVLYCP 3167
            M+  H+++V +VL ++ +++E GL++  I+ +++ YG N LP E+ K L  LVLEQFDDLLVKILL AA+ISFILA F+ +ED+T AFVEPFVILLILI NAVVGVWQE+NAESAI+ALKEYES+ AKV RS+H+GIQ IKA +LVPGD+VE+S+GDKVPADIRI  I STT+++DQSILTGES SVIKH+D I D  AVNQDK N+LFSGTN+ASGKCRGVV +IGL TEIGKIR QI  ++  KTPL +KLD F EQLSKVI++IC+ VW INIGHFNDP HGGS +RGAIYYFKIAVALAVAAIPEGLPAVITTCL+LGT RMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVS++F++ N        Q F+I+GSKY+P+G+I+ + K VK SD   L E++ IC++CNDS++++NE+KG YEKVGEATETAL+CLVEK+N  NI K   SK  L+   N  +QS  +K+FTLEFSRDRKSMS F+ P       + ++  H  TG R+ VKGAPEG++DRCTFVR +    +MT  IK +I++ ++AYGTG+DTLRCLALA +D P     MD  ++  F  YE+ MT VG+VGMLDPPRSEV DSI  C  AGIRVIVITGDNKATAEAICRRIG+F E+E+T GKS+TGREFD+LS   Q +A R A LFARVEPAHKSKIIE+LQ DG ISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVL+DDNFS+IV+AVEEGRAIYNNMKQFIRYLISSNIGEVV IFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM+R PR   + LIS WLFFRYM IG YVG ATVGSAAWWFM    GP ++YYQLTH  QC  +   F  +DC +F+H KPM+MALSVLV+IEMLNA+NSLSENQSL  MPPW N+WLI A+ LS  LHF+ILEV  LSK+FQI+PL+  EW  VMK S PV+++DE++K ISR     + +    + + LMW  + A +  CP
Sbjct:    1 MEAMHNRTVAEVLQYYKITEETGLSEDNIKEARKKYGYNELPPEKSKSLLSLVLEQFDDLLVKILLLAAVISFILALFEDAEDATFAFVEPFVILLILIANAVVGVWQERNAESAIEALKEYESDEAKVTRSSHRGIQKIKARELVPGDVVEISIGDKVPADIRITSILSTTIRVDQSILTGESMSVIKHTDAIADTRAVNQDKKNILFSGTNIASGKCRGVVIAIGLETEIGKIRTQIGSSEADKTPLQQKLDEFGEQLSKVISIICVAVWAINIGHFNDPAHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSKLFVMANSATGEITTQHFDITGSKYAPEGEIYFEGKAVKTSDHKNLVELSNICAMCNDSAIDYNETKGTYEKVGEATETALICLVEKLNPYNIPKHGLSKSDLAMCSNYSVQSKWSKKFTLEFSRDRKSMSTFLVP-------RDSIDGH--TGQRMFVKGAPEGVIDRCTFVRVNGESHKMTPIIKSEILRHISAYGTGRDTLRCLALATIDNPTKPEEMDLTDSTKFVNYETKMTLVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRKPRHASDPLISKWLFFRYMVIGIYVGCATVGSAAWWFMFYSRGPQLNYYQLTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMDDEPLMQGAYGVFLMWAAYFALLFLCP 1019          
The following BLAST results are available for this feature:
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP2A20.000e+067.67ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
ATP2A20.000e+067.57ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
ATP2A10.000e+067.67ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
ATP2A10.000e+067.67ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
ATP2A30.000e+063.58ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sca-10.000e+066.83Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
sca-10.000e+066.83Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
sca-10.000e+066.83Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
sca-10.000e+066.83Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
sca-10.000e+067.09Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SERCA0.000e+067.65gene:FBgn0263006 transcript:FBtr0072216[more]
SERCA0.000e+067.65gene:FBgn0263006 transcript:FBtr0072211[more]
SERCA0.000e+067.65gene:FBgn0263006 transcript:FBtr0072214[more]
SERCA0.000e+067.65gene:FBgn0263006 transcript:FBtr0072212[more]
SERCA0.000e+067.65gene:FBgn0263006 transcript:FBtr0072217[more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp2a30.000e+066.90ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
atp2a30.000e+066.90ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
atp2a10.000e+066.87ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
atp2a10.000e+066.87ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
atp2a10.000e+066.63ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP2A20.000e+067.67ATPase, Ca++ transporting, cardiac muscle, slow tw... [more]
ATP2A20.000e+067.23ATPase, Ca++ transporting, cardiac muscle, slow tw... [more]
ATP2A20.000e+067.67ATPase, Ca++ transporting, cardiac muscle, slow tw... [more]
ATP2A20.000e+067.67ATPase, Ca++ transporting, cardiac muscle, slow tw... [more]
atp2a30.000e+064.85ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atp2a20.000e+067.23ATPase, Ca++ transporting, cardiac muscle, slow tw... [more]
Atp2a20.000e+067.77ATPase, Ca++ transporting, cardiac muscle, slow tw... [more]
Atp2a20.000e+067.77ATPase, Ca++ transporting, cardiac muscle, slow tw... [more]
Atp2a10.000e+068.17ATPase, Ca++ transporting, cardiac muscle, fast tw... [more]
Atp2a30.000e+064.20ATPase, Ca++ transporting, ubiquitous [Source:MGI ... [more]
back to top
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7PPA5|ATC1_ANOGA0.000e+067.32Calcium-transporting ATPase sarcoplasmic/endoplasm... [more]
sp|P70083|AT2A1_MAKNI0.000e+067.37Sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
sp|P22700|ATC1_DROME0.000e+067.65Calcium-transporting ATPase sarcoplasmic/endoplasm... [more]
sp|Q9YGL9|AT2A3_CHICK0.000e+066.00Sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
sp|Q292Q0|ATC1_DROPS0.000e+067.97Calcium-transporting ATPase sarcoplasmic/endoplasm... [more]
back to top
BLAST of Calcium-transporting ATPase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0U1ZY670.000e+069.85Calcium-transporting ATPase OS=Hyriopsis cumingii ... [more]
R7UQP20.000e+070.35Calcium-transporting ATPase OS=Capitella teleta OX... [more]
A0A4S2M4910.000e+070.20Calcium-transporting ATPase OS=Opisthorchis feline... [more]
A0A4E0RER10.000e+071.17Calcium-transporting ATPase OS=Fasciola hepatica O... [more]
B2KKR10.000e+069.41Calcium-transporting ATPase OS=Pinctada fucata OX=... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp2a10.000e+066.73sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
atp2a10.000e+066.97sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
atp2a30.000e+067.00sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
atp2a30.000e+067.00sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
atp2a1l0.000e+067.13sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010373.10.000e+068.46pep scaffold:Pmarinus_7.0:GL481096:3909:20014:1 ge... [more]
atp2c15.257e-6831.77ATPase secretory pathway Ca2+ transporting 1 [Sour... [more]
atp2c12.299e-6331.01ATPase secretory pathway Ca2+ transporting 1 [Sour... [more]
ENSPMAT00000002888.11.094e-5830.41pep scaffold:Pmarinus_7.0:GL478641:194938:205936:1... [more]
ENSPMAT00000002145.16.222e-4330.12pep scaffold:Pmarinus_7.0:GL482157:124:4919:1 gene... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PMR13.107e-12530.31High affinity Ca2+/Mn2+ P-type ATPase; required fo... [more]
ENA11.740e-9228.00P-type ATPase sodium pump; involved in Na+ and Li+... [more]
ENA55.692e-9227.82Protein with similarity to P-type ATPase sodium pu... [more]
ENA26.327e-9227.82P-type ATPase sodium pump; involved in Na+ efflux ... [more]
PMC13.672e-5136.69Vacuolar Ca2+ ATPase involved in depleting cytosol... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO474650.000e+068.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356169.652e-14531.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406801.768e-10729.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO364552.324e-10732.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO417756.084e-6525.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp2a1l0.000e+067.97sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
atp2a1l0.000e+067.97sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
atp2a1l0.000e+067.36sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
atp2a10.000e+066.63ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
atp2a10.000e+066.47ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000010260.10.000e+099.81SMESG000010260.1[more]
SMESG000050554.10.000e+071.84SMESG000050554.1[more]
SMESG000050554.10.000e+071.74SMESG000050554.1[more]
SMESG000039058.10.000e+067.90SMESG000039058.1[more]
SMESG000039058.10.000e+067.90SMESG000039058.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029216 ID=SMED30029216|Name=Calcium-transporting ATPase|organism=Schmidtea mediterranea sexual|type=transcript|length=3781bp
ATTTCATAAAGTCGTTTAGCGTAATTGAAACACGTAATTTTAATAATTTG
ACTGAGTAATTGTAAAATTACTAAGTAAAAATTATGGATAATGCACATTC
CAAGTCAGTCCATGATGTTTTGGATTTCTTTGATGTTTCAGACGAGTTTG
GTCTAACAGATAAACAGATAGAATTGTCTCAAGAAACTTATGGTGTTAAT
GGTCTGCCAGATGAAGAAGGAAAACCTCTATGGAAATTAGTACTAGAACA
ATTTGATGACTTGCTCGTTAAGATTTTATTATCGGCCGCCATTATATCAT
TTATATTAGCGTGGTTTGATCACAGTGAAGATAGTACCACAGCATTTGTT
GAACCATTTGTTATTTTGTTGATTCTAATTTTGAATGCCGTTGTCGGTGT
ATGGCAAGAAAAAAATGCGGAATCAGCCATTGATGCTTTAAAAGAATATG
AGTCAGAAAATGCCAAAGTTATTAGATCGAATCACAAAGGTATTCAGACG
ATTAAAGCGGCACAACTAGTGCCAGGAGACATCGTAGAAGTCAGTGTGGG
AGATAAAGTTCCAGCCGATATAAGAATTGTTAAAATTCACAGTACAACTC
TTCAAATCGACCAGTCGATTTTGACAGGAGAGTCTCGATCAGTTATTAAA
CACTCCGACGTCATTGATGACTTACTCGCCGTAAATCAGGATAAAATAAA
TATGCTTTTCAGCGGAACTAATGTTGCATCTGGCAAATGTAGAGGAGTTG
TAACGAGCATTGGATTAAATACGGAAATCGGTAAAATCAGAGATCAAATT
ATGCACACAGATCAAGTTAAAACACCCTTGACTAAGAAATTAGACAATTT
TGCTGAACAACTTTCAAAAGTCATTACAGTTATTTGTATTGTTGTGTGGT
TGATTAATATCGGACATTTCAATGATCCAATTCACGGCGGTTCTGTATTA
CGAGGAGCAATTTATTATTTCAAAATTGCAGTCGCTTTAGCTGTGGCTGC
AATTCCCGAAGGACTTCCAGCTGTTATTACAACATGCTTGTCATTAGGCA
CATGGCGAATGGCGAAAAAGAACGCAATTGTTAGATCATTGCCTAGTGTA
GAAACTTTAGGCTGTACCAGTGTCATTTGTTCTGATAAAACCGGAACGCT
TACCACAAATCAAATGACAGTTTCCCGAATGTTTATCGTACGTAATGTTA
ACAAGGACGGGACAGATATCCAAGAATTCGAAATTAGTGGATCTAAATAC
AGTCCAGACGGCGACATCTTTTGTCAAGAAAAACGAGTGAAATGCTCAGA
TATTCCACAACTATATGAAGTAGCAGAAATCTGTTCTCTATGCAATGATT
CCAGTGTGGAATTCAATGAATCGAAAGGCGTGTATGAAAAAGTCGGCGAA
GCGACCGAAACTGCACTGGTGTGCCTTGTGGAGAAAATGAACATGACGAA
CATCAACAAATCGACATACTCTAAGAAACAGTTGAGCACGGTTTGCAATT
CCAAAATCCAGTCAACAGTTAATAAAGAATTCACACTGGAATTCTCGAGG
GACCGTAAATCGATGTCGGCGTTTGTTAGCCCGATAAATCCCGAAGGAGA
CGTTCAAACGACTGTGAGGAACCACAACATTACAGGACCAAGATTGCTAG
TTAAGGGAGCACCGGAGGGTATTTTGGACCGCTGCACATTTGTCCGCACC
AGTCAAGGCAGGGTGGAAATGACCAACTCGATTAAAGACCAAATTATGAA
GAAAGTGGCCGCCTACGGAACAGGAAAAGACACCCTGAGATGTCTGGCAT
TGGCGTGTGTCGATGAGCCCGTCTCACGGTCGCGTATGGATTTTGCGAAC
GCAGGAAATTTCTATAAATATGAGTCGAATATGACATTTGTCGGCCTTGT
CGGTATGCTCGACCCCCCTCGATCGGAGGTATTGGACAGTATCGGTGCTT
GTCGCAACGCTGGAATTCGAGTCATTGTAATCACCGGGGATAATAAGGCA
ACTGCTGAGGCAATCTGTCGACGAATCGGAATCTTTGGAGAGGACGAATC
AACTGTCGGTAAGTCATACACCGGCAGAGAGTTCGATCAATTGTCCGACT
TCGAGCAACGGAACGCTGTTCGTAACGCCAGTTTGTTTGCTCGAGTTGAG
CCAGCACACAAGAGTAAAATCATCGAACATTTGCAAAGGGACGGTGAAAT
TTCCGCAATGACCGGGGATGGAGTGAACGATGCGCCCGCACTCAAGAAAG
CGGAAATCGGTATTGCTATGGGCAGCGGAACCGCCGTTGCTAAGAGCGCA
TCCGATATGGTATTGGCAGATGACAATTTCAGCACAATCGTTGCCGCTGT
CGAGGAAGGACGAGCCATTTACAACAACATGAAACAATTCATTCGCTACT
TGATCTCATCAAACATCGGGGAAGTTGTGTGCATCTTCCTGACGGCCGCA
CTGGGCATGCCAGAGGCGCTGATTCCCGTGCAATTGCTGTGGGTGAACTT
GGTAACCGACGGGTTGCCCGCTACCGCGCTCGGATTCAACCCGCCTGACC
TCGATATCATGGAGCGCCCCCCGAGGAGTCCTAAGGAATCGCTGATTAGT
GGCTGGTTGTTCTTCCGGTACATGGCGATCGGTTGCTATGTGGGTGCCGC
AACGGTGGGCTCGGCCGCCTGGTGGTTCATGAGCAGCCCGAACGGCCCCA
GCGTGAGCTATTATCAACTGACTCACCACTTGCAATGCGCAACGGAACCG
AACGATTTTATCGGTGTTGACTGCAAGGTGTTCCTGCACTCGAAACCCAT
GACAATGGCGCTTTCTGTGCTTGTTCTCATCGAGATGCTGAACGCGCTTA
ACAGCTTATCCGAGAATCAATCCTTGGTGAAAATGCCGCCATGGAGAAAC
ATTTGGCTCATACTCGCAATAACTCTCAGCATGTCGCTACATTTCCTCAT
TCTAGAAGTCGGATTTCTATCTAAAGTGTTCCAAATCTCTCCTCTCAGTT
TCAGTGAATGGTTGACCGTAATGAAATTTTCATTTCCCGTACTTCTGTTG
GACGAATCGCTGAAGATCATTTCAAGGAATCAACAGCACCGCAAAAGCAT
TTTTACCAACTGTCACTTGATTGTTTTGATGTGGGGCCTGTTTGCAGCTG
CTGTGTTATATTGTCCCTTATAATTATCATTTTCCTATAATATATTTAGA
AATATAGTTTCAGTATCAGTACTGATGGTTCCTTTTCTCTAGTTCTACTG
CACCTCCTTTGTACATATTTTCTTCTTTCTCAGTTGACACATCATTTTAC
CTTTATATTATTTTTTGTTTCATTTGTATTAATTGTATTATTATTTACTG
TGTTGTTTGATAACGTTTGCTATCATTACTATTATTATGAGTAGTTTCTA
TTGGTTGGTTTGTTTTGTGTGTGGTTTATATGGATTTCTATTGGTTGTAT
GTATTTGACTCATTTATTTGAGTTGTGTGTGTGTGTCCTATTGGGTGTCC
TATTTGTGGTGTTGTATGTGTGTCCTATTGGTGGTGTTGAATGTGTGTCC
TATTGGGTGGTGTGTGTGTCTATCCTATTGGTAGTGTTGTATGTGTGTCC
CATTGGTGGTGTTGTGTGTGTCCTATTGGGTGGTGTTGAATGTATGTCCT
ATTGGTAGTGTTGAATGTGTGTCCTATTGGGTGGTGTGTGTGTCTATCCT
ATTGGTAGTGTTGTATGTGTGTCCCATTGGTGGTGTTGTGTGTGTCCTAT
TGGGTGGTGTTGAATGTATGTCCTATTGGTA
back to top

protein sequence of SMED30029216-orf-1

>SMED30029216-orf-1 ID=SMED30029216-orf-1|Name=SMED30029216-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1030bp
MDNAHSKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLW
KLVLEQFDDLLVKILLSAAIISFILAWFDHSEDSTTAFVEPFVILLILIL
NAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDI
VEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDVIDDLLAV
NQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLT
KKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAV
ALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICS
DKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQEK
RVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVE
KMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSP
INPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSI
KDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNM
TFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGI
FGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHL
QRDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFS
TIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQ
LLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIG
CYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVF
LHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSM
SLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRNQ
QHRKSIFTNCHLIVLMWGLFAAAVLYCPL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR005782P-type_ATPase_IIA
IPR030332SERCA1/2
IPR036412HAD-like_sf
IPR001757P_typ_ATPase
IPR004014ATPase_P-typ_cation-transptr_N
IPR008250ATPase_P-typ_transduc_dom_A_sf
IPR023298ATPase_P-typ_TM_dom_sf
IPR023299ATPase_P-typ_cyto_dom_N
IPR006068ATPase_P-typ_cation-transptr_C
IPR023214HAD_sf
IPR018303ATPase_P-typ_P_site
IPR0028882Fe-2S-bd
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005783endoplasmic reticulum
GO:0016020membrane
GO:0033017sarcoplasmic reticulum membrane
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0000166nucleotide binding
GO:0016491oxidoreductase activity
GO:0005388calcium-transporting ATPase activity
GO:0005524ATP binding
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0006810transport
GO:0006811ion transport
GO:0006816calcium ion transport
GO:0070588calcium ion transmembrane transport
GO:0099132ATP hydrolysis coupled cation transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001757P-type ATPasePRINTSPR00120HATPASEcoord: 710..726
score: 89.12
coord: 682..698
score: 45.88
coord: 741..766
score: 38.75
IPR001757P-type ATPaseTIGRFAMTIGR01494TIGR01494coord: 93..371
e-value: 5.0E-43
score: 145.2
coord: 680..795
e-value: 1.3E-35
score: 120.7
NoneNo IPR availablePRINTSPR00119CATATPASEcoord: 710..729
score: 83.2
coord: 604..615
score: 56.99
coord: 733..745
score: 57.46
coord: 349..363
score: 80.03
coord: 176..190
score: 59.75
coord: 626..636
score: 66.86
NoneNo IPR availableGENE3DG3DSA:2.70.150.10coord: 97..242
e-value: 1.9E-53
score: 182.6
NoneNo IPR availableGENE3DG3DSA:1.20.1110.10coord: 243..998
e-value: 0.0
score: 1221.8
NoneNo IPR availablePFAMPF08282Hydrolase_3coord: 695..752
e-value: 1.7E-6
score: 27.9
NoneNo IPR availablePFAMPF00122E1-E2_ATPasecoord: 123..329
e-value: 4.5E-54
score: 182.7
NoneNo IPR availablePFAMPF13246Cation_ATPasecoord: 419..537
e-value: 4.9E-18
score: 65.0
NoneNo IPR availableGENE3DG3DSA:2.70.150.10coord: 1..65
e-value: 1.5E-8
score: 36.6
NoneNo IPR availableSFLDSFLDG00002C1.7:_P-type_atpase_likecoord: 330..762
e-value: 0.0
score: 253.4
NoneNo IPR availableSFLDSFLDF00027p-type_atpasecoord: 330..762
e-value: 0.0
score: 253.4
NoneNo IPR availablePANTHERPTHR42861FAMILY NOT NAMEDcoord: 1..1002
NoneNo IPR availableCDDcd02083P-type_ATPase_SERCAcoord: 5..998
e-value: 0.0
score: 1822.67
NoneNo IPR availableTMHMMTMhelixcoord: 769..791
NoneNo IPR availableTMHMMTMhelixcoord: 796..818
NoneNo IPR availableTMHMMTMhelixcoord: 940..962
NoneNo IPR availableTMHMMTMhelixcoord: 60..78
NoneNo IPR availableTMHMMTMhelixcoord: 260..279
NoneNo IPR availableTMHMMTMhelixcoord: 841..863
NoneNo IPR availableTMHMMTMhelixcoord: 88..107
NoneNo IPR availableTMHMMTMhelixcoord: 299..321
NoneNo IPR availableTMHMMTMhelixcoord: 1005..1027
IPR004014Cation-transporting P-type ATPase, N-terminalSMARTSM00831Cation_ATPase_N_a_2coord: 3..77
e-value: 1.9E-13
score: 60.7
IPR004014Cation-transporting P-type ATPase, N-terminalPFAMPF00690Cation_ATPase_Ncoord: 5..72
e-value: 2.3E-16
score: 59.2
IPR006068Cation-transporting P-type ATPase, C-terminalPFAMPF00689Cation_ATPase_Ccoord: 793..996
e-value: 2.1E-44
score: 151.4
IPR023299P-type ATPase, cytoplasmic domain NGENE3DG3DSA:3.40.1110.10coord: 359..612
e-value: 0.0
score: 1221.8
IPR023299P-type ATPase, cytoplasmic domain NSUPERFAMILYSSF81660Metal cation-transporting ATPase, ATP-binding domain Ncoord: 356..608
IPR005782P-type ATPase, subfamily IIA, SERCA-typeTIGRFAMTIGR01116TIGR01116coord: 53..865
e-value: 8.3E-301
score: 997.8
IPR023214HAD superfamilyGENE3DG3DSA:3.40.50.1000coord: 331..748
e-value: 0.0
score: 1221.8
IPR030332Sarcoplasmic/endoplasmic reticulum calcium ATPase 1/2PANTHERPTHR42861:SF18SARCOPLASMIC/ENDOPLASMIC RETICULUM CALCIUM ATPASE 2coord: 1..1002
IPR018303P-type ATPase, phosphorylation sitePROSITEPS00154ATPASE_E1_E2coord: 351..357
IPR036412HAD-like superfamilySUPERFAMILYSSF56784HAD-likecoord: 347..813
IPR023298P-type ATPase, transmembrane domain superfamilySUPERFAMILYSSF81665Calcium ATPase, transmembrane domain Mcoord: 2..999
IPR008250P-type ATPase, A domain superfamilySUPERFAMILYSSF81653Calcium ATPase, transduction domain Acoord: 127..238