Calcium:calmodulin dependent protein kinase type

Overview
NameCalcium:calmodulin dependent protein kinase type
Smed IDSMED30029183
Length (bp)1134
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Calcium:calmodulin dependent protein kinase type (SMED30029183) t-SNE clustered cells

Violin plots show distribution of expression levels for Calcium:calmodulin dependent protein kinase type (SMED30029183) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029183

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30029183SMESG000027403.1 SMESG000027402.1 dd_Smed_v4_11876_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30029183SMESG000027403.1 SMESG000027402.1 dd_Smed_v4_11876_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
lateral region of the whole animalSMED30029183SMESG000027403.1 SMESG000027402.1 dd_Smed_v4_11876_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30029183SMESG000027403.1 SMESG000027402.1 dd_Smed_v4_11876_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30029183SMESG000027403.1 SMESG000027402.1 dd_Smed_v6_11876_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
body wall musculatureSMED30029183SMESG000027403.1 SMESG000027402.1 dd_Smed_v4_11876_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
testis primordiumSMED30029183SMESG000027403.1 Contig5924_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Human
Match: PNCK (pregnancy up-regulated nonubiquitous CaM kinase [Source:HGNC Symbol;Acc:HGNC:13415])

HSP 1 Score: 228.409 bits (581), Expect = 1.807e-71
Identity = 118/307 (38.44%), Postives = 189/307 (61.56%), Query Frame = 3
Query:  102 NSRYKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSR-EASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWR 1019
            +S Y+I E LG G F EV+  ++  +   VA+K +            P++  +  + ++  E  V++ ++H NI+ L +V E  + +++ M+L  GG+LFDRI+    + E+DA+ L+ Q+L AV ++H  G VHRDLKPEN+L+ +  +DS I+++DFGLS+ +A   + T CGT  Y APELL    ++K YG  VD+W++GV++YILLCG+ PFY  +  D E+ S+I+R  Y+F SP WD IS +AKDF+ +LL+  P  R T  +A++HLW+        +   +   SE+I  + +R  W+
Sbjct:   12 SSVYEIRERLGSGAFSEVVLAQERGSAHLVALKCI------------PKKALRGKEALVENEIAVLRRISHPNIVALEDVHESPSHLYLAMELVTGGELFDRIMERGSYTEKDASHLVGQVLGAVSYLHSLGIVHRDLKPENLLYATPFEDSKIMVSDFGLSKIQAGNMLGTACGTPGYVAPELL----EQKPYGKAVDVWALGVISYILLCGYPPFYDES--DPELFSQILRASYEFDSPFWDDISESAKDFIRHLLERDPQKRFTCQQALRHLWISGDTAFDRD--ILGSVSEQIRKNFARTHWK 298          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Human
Match: PNCK (pregnancy up-regulated nonubiquitous CaM kinase [Source:HGNC Symbol;Acc:HGNC:13415])

HSP 1 Score: 228.409 bits (581), Expect = 1.807e-71
Identity = 118/307 (38.44%), Postives = 189/307 (61.56%), Query Frame = 3
Query:  102 NSRYKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSR-EASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWR 1019
            +S Y+I E LG G F EV+  ++  +   VA+K +            P++  +  + ++  E  V++ ++H NI+ L +V E  + +++ M+L  GG+LFDRI+    + E+DA+ L+ Q+L AV ++H  G VHRDLKPEN+L+ +  +DS I+++DFGLS+ +A   + T CGT  Y APELL    ++K YG  VD+W++GV++YILLCG+ PFY  +  D E+ S+I+R  Y+F SP WD IS +AKDF+ +LL+  P  R T  +A++HLW+        +   +   SE+I  + +R  W+
Sbjct:   12 SSVYEIRERLGSGAFSEVVLAQERGSAHLVALKCI------------PKKALRGKEALVENEIAVLRRISHPNIVALEDVHESPSHLYLAMELVTGGELFDRIMERGSYTEKDASHLVGQVLGAVSYLHSLGIVHRDLKPENLLYATPFEDSKIMVSDFGLSKIQAGNMLGTACGTPGYVAPELL----EQKPYGKAVDVWALGVISYILLCGYPPFYDES--DPELFSQILRASYEFDSPFWDDISESAKDFIRHLLERDPQKRFTCQQALRHLWISGDTAFDRD--ILGSVSEQIRKNFARTHWK 298          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Human
Match: PNCK (pregnancy up-regulated nonubiquitous CaM kinase [Source:HGNC Symbol;Acc:HGNC:13415])

HSP 1 Score: 228.024 bits (580), Expect = 4.211e-71
Identity = 118/307 (38.44%), Postives = 189/307 (61.56%), Query Frame = 3
Query:  102 NSRYKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSR-EASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWR 1019
            +S Y+I E LG G F EV+  ++  +   VA+K +            P++  +  + ++  E  V++ ++H NI+ L +V E  + +++ M+L  GG+LFDRI+    + E+DA+ L+ Q+L AV ++H  G VHRDLKPEN+L+ +  +DS I+++DFGLS+ +A   + T CGT  Y APELL    ++K YG  VD+W++GV++YILLCG+ PFY  +  D E+ S+I+R  Y+F SP WD IS +AKDF+ +LL+  P  R T  +A++HLW+        +   +   SE+I  + +R  W+
Sbjct:   29 SSVYEIRERLGSGAFSEVVLAQERGSAHLVALKCI------------PKKALRGKEALVENEIAVLRRISHPNIVALEDVHESPSHLYLAMELVTGGELFDRIMERGSYTEKDASHLVGQVLGAVSYLHSLGIVHRDLKPENLLYATPFEDSKIMVSDFGLSKIQAGNMLGTACGTPGYVAPELL----EQKPYGKAVDVWALGVISYILLCGYPPFYDES--DPELFSQILRASYEFDSPFWDDISESAKDFIRHLLERDPQKRFTCQQALRHLWISGDTAFDRD--ILGSVSEQIRKNFARTHWK 315          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Human
Match: PNCK (pregnancy up-regulated nonubiquitous CaM kinase [Source:HGNC Symbol;Acc:HGNC:13415])

HSP 1 Score: 228.409 bits (581), Expect = 1.582e-70
Identity = 118/307 (38.44%), Postives = 189/307 (61.56%), Query Frame = 3
Query:  102 NSRYKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSR-EASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWR 1019
            +S Y+I E LG G F EV+  ++  +   VA+K +            P++  +  + ++  E  V++ ++H NI+ L +V E  + +++ M+L  GG+LFDRI+    + E+DA+ L+ Q+L AV ++H  G VHRDLKPEN+L+ +  +DS I+++DFGLS+ +A   + T CGT  Y APELL    ++K YG  VD+W++GV++YILLCG+ PFY  +  D E+ S+I+R  Y+F SP WD IS +AKDF+ +LL+  P  R T  +A++HLW+        +   +   SE+I  + +R  W+
Sbjct:   95 SSVYEIRERLGSGAFSEVVLAQERGSAHLVALKCI------------PKKALRGKEALVENEIAVLRRISHPNIVALEDVHESPSHLYLAMELVTGGELFDRIMERGSYTEKDASHLVGQVLGAVSYLHSLGIVHRDLKPENLLYATPFEDSKIMVSDFGLSKIQAGNMLGTACGTPGYVAPELL----EQKPYGKAVDVWALGVISYILLCGYPPFYDES--DPELFSQILRASYEFDSPFWDDISESAKDFIRHLLERDPQKRFTCQQALRHLWISGDTAFDRD--ILGSVSEQIRKNFARTHWK 381          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Human
Match: CAMK1 (calcium/calmodulin dependent protein kinase I [Source:HGNC Symbol;Acc:HGNC:1459])

HSP 1 Score: 224.557 bits (571), Expect = 1.219e-69
Identity = 124/316 (39.24%), Postives = 186/316 (58.86%), Query Frame = 3
Query:  111 YKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSR--EASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWRCLGLMATALKR 1052
            Y   + LG G F EV+   D +    VAIK + K      + S            M  E  V+  + H NI+ L ++ E    +++IM L  GG+LFDRI+    + ERDA++L+ Q+L AV+++H  G VHRDLKPEN+L+ S D+DS I+++DFGLS+  +    + T CGT  Y APE+L     +K Y   VD WSIGV+AYILLCG+ PFY    +D ++  +I++ +Y+F SP WD IS +AKDF+ +L++  P  R T ++A++H W+       +N H  SV SE+I  + ++ +W+     ATA+ R
Sbjct:   20 YDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKEALEGKEGS------------MENEIAVLHKIKHPNIVALDDIYESGGHLYLIMQLVSGGELFDRIVEKGFYTERDASRLIFQVLDAVKYLHDLGIVHRDLKPENLLYYSLDEDSKIMISDFGLSKMEDPGSVLSTACGTPGYVAPEVLA----QKPYSKAVDCWSIGVIAYILLCGYPPFYD--ENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIAGDTALDKNIHQ-SV-SEQIKKNFAKSKWK-QAFNATAVVR 314          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Celegans
Match: cmk-1 (Calcium/calmodulin-dependent protein kinase type 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TXJ0])

HSP 1 Score: 228.794 bits (582), Expect = 5.902e-72
Identity = 126/330 (38.18%), Postives = 195/330 (59.09%), Query Frame = 3
Query:  108 RYKIIEELGKGGFCEVLKGRDVKNDF--FVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSR-EASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWRCLGLMATALKRMSQI----NVNR 1076
            +Y   + LG G F +V    + K+D     A+K +DK      KA   +E        +  E +V++ L H NI++L +  ++K  V+++M+L  GG+LFDRI++   + E+DA+ L+ Q+L AV  MH  G VHRDLKPEN+L+ ++D+DS I+++DFGLS+ E S  M T CGT  Y APE+L     +K YG  VD+WSIGV+AYILLCG+ PFY  +  D  + ++II+G+Y+F +P WD IS +AKDF+T+L+   P  R T   A+ H W+        + H     +  +  S+++  W+     A A++++  +    N NR
Sbjct:   21 KYDFRDVLGTGAFSKVFLA-ESKSDAGQMYAVKCIDK------KALKGKEES------LENEIKVLRKLRHNNIVQLFDTYDEKQFVYLVMELVTGGELFDRIVAKGSYTEQDASNLIRQVLEAVGFMHDNGVVHRDLKPENLLYYNQDEDSKIMISDFGLSKTEDSGVMATACGTPGYVAPEVL----QQKPYGKAVDVWSIGVIAYILLCGYPPFYDES--DANLFAQIIKGEYEFDAPYWDQISDSAKDFITHLMCCDPEARFTCQDALSHPWISGNTAYTHDIH--GTVAVHLKKSLAKRNWKKAYNAAAAIRQLQMLRLSSNSNR 329          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Celegans
Match: unc-43 (Calcium/calmodulin-dependent protein kinase type II [Source:UniProtKB/Swiss-Prot;Acc:O62305])

HSP 1 Score: 176.022 bits (445), Expect = 3.331e-52
Identity = 104/291 (35.74%), Postives = 164/291 (56.36%), Query Frame = 3
Query:   63 MSKSETKRKSFPENSRYKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSREA--SEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWL 929
            M  + TK   F +N  Y + EELGKG F  V +          A K ++      +K  S ++  K     + REAR+ + L H NI++L + I++++  +++ DL  GG+LF+ I++ + ++E DA+  ++QIL ++ + H  G VHRDLKPEN+L  S+ K +++ L DFGL+ E   SE      GT  Y +PE+L     +  Y   VDIW+ GV+ YILL G+ PF+    D   + ++I  G Y + SP WDT++  AK  +  +L V P  R+T D+A+K  W+
Sbjct:    1 MMNASTK---FSDN--YDVKEELGKGAFSVVRRCVHKTTGLEFAAKIIN------TKKLSARDFQK-----LEREARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHSNGIVHRDLKPENLLLASKAKGAAVKLADFGLAIEVNDSEAWHGFAGTPGYLSPEVL----KKDPYSKPVDIWACGVILYILLVGYPPFWD--EDQHRLYAQIKAGAYDYPSPEWDTVTPEAKSLIDSMLTVNPKKRITADQALKVPWI 269          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Celegans
Match: unc-43 (Calcium/calmodulin-dependent protein kinase type II [Source:UniProtKB/Swiss-Prot;Acc:O62305])

HSP 1 Score: 176.022 bits (445), Expect = 3.331e-52
Identity = 104/291 (35.74%), Postives = 164/291 (56.36%), Query Frame = 3
Query:   63 MSKSETKRKSFPENSRYKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSREA--SEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWL 929
            M  + TK   F +N  Y + EELGKG F  V +          A K ++      +K  S ++  K     + REAR+ + L H NI++L + I++++  +++ DL  GG+LF+ I++ + ++E DA+  ++QIL ++ + H  G VHRDLKPEN+L  S+ K +++ L DFGL+ E   SE      GT  Y +PE+L     +  Y   VDIW+ GV+ YILL G+ PF+    D   + ++I  G Y + SP WDT++  AK  +  +L V P  R+T D+A+K  W+
Sbjct:    1 MMNASTK---FSDN--YDVKEELGKGAFSVVRRCVHKTTGLEFAAKIIN------TKKLSARDFQK-----LEREARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHSNGIVHRDLKPENLLLASKAKGAAVKLADFGLAIEVNDSEAWHGFAGTPGYLSPEVL----KKDPYSKPVDIWACGVILYILLVGYPPFWD--EDQHRLYAQIKAGAYDYPSPEWDTVTPEAKSLIDSMLTVNPKKRITADQALKVPWI 269          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Celegans
Match: unc-43 (Calcium/calmodulin-dependent protein kinase type II [Source:UniProtKB/Swiss-Prot;Acc:O62305])

HSP 1 Score: 176.022 bits (445), Expect = 3.331e-52
Identity = 104/291 (35.74%), Postives = 164/291 (56.36%), Query Frame = 3
Query:   63 MSKSETKRKSFPENSRYKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSREA--SEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWL 929
            M  + TK   F +N  Y + EELGKG F  V +          A K ++      +K  S ++  K     + REAR+ + L H NI++L + I++++  +++ DL  GG+LF+ I++ + ++E DA+  ++QIL ++ + H  G VHRDLKPEN+L  S+ K +++ L DFGL+ E   SE      GT  Y +PE+L     +  Y   VDIW+ GV+ YILL G+ PF+    D   + ++I  G Y + SP WDT++  AK  +  +L V P  R+T D+A+K  W+
Sbjct:    1 MMNASTK---FSDN--YDVKEELGKGAFSVVRRCVHKTTGLEFAAKIIN------TKKLSARDFQK-----LEREARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHSNGIVHRDLKPENLLLASKAKGAAVKLADFGLAIEVNDSEAWHGFAGTPGYLSPEVL----KKDPYSKPVDIWACGVILYILLVGYPPFWD--EDQHRLYAQIKAGAYDYPSPEWDTVTPEAKSLIDSMLTVNPKKRITADQALKVPWI 269          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Celegans
Match: unc-43 (Calcium/calmodulin-dependent protein kinase type II [Source:UniProtKB/Swiss-Prot;Acc:O62305])

HSP 1 Score: 176.022 bits (445), Expect = 3.476e-52
Identity = 104/291 (35.74%), Postives = 164/291 (56.36%), Query Frame = 3
Query:   63 MSKSETKRKSFPENSRYKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSREA--SEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWL 929
            M  + TK   F +N  Y + EELGKG F  V +          A K ++      +K  S ++  K     + REAR+ + L H NI++L + I++++  +++ DL  GG+LF+ I++ + ++E DA+  ++QIL ++ + H  G VHRDLKPEN+L  S+ K +++ L DFGL+ E   SE      GT  Y +PE+L     +  Y   VDIW+ GV+ YILL G+ PF+    D   + ++I  G Y + SP WDT++  AK  +  +L V P  R+T D+A+K  W+
Sbjct:    1 MMNASTK---FSDN--YDVKEELGKGAFSVVRRCVHKTTGLEFAAKIIN------TKKLSARDFQK-----LEREARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHSNGIVHRDLKPENLLLASKAKGAAVKLADFGLAIEVNDSEAWHGFAGTPGYLSPEVL----KKDPYSKPVDIWACGVILYILLVGYPPFWD--EDQHRLYAQIKAGAYDYPSPEWDTVTPEAKSLIDSMLTVNPKKRITADQALKVPWI 269          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Fly
Match: CaMKI (gene:FBgn0016126 transcript:FBtr0333670)

HSP 1 Score: 248.054 bits (632), Expect = 7.614e-79
Identity = 140/352 (39.77%), Postives = 208/352 (59.09%), Query Frame = 3
Query:   48 LFHLQMSKSETKRKSFPENSRYKIIEE-------LGKGGFCEV--LKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSR-EASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWRCLGLMATALKRMSQINVN 1073
            LF  + S  + K K   E ++   IEE       LG G F EV   + +D   + F A+K +DK      KA   +E        +  E RV++ L H NI++L+E  EDK++V+++M+L  GG+LFDRI+    + E+DA+ L+ QIL AV +MH+ G VHRDLKPEN+L+ S D DS I+++DFGLS+ E S  M T CGT  Y APE+L     +K YG  VD+WSIGV++YILLCG+ PFY    +D  + ++I++GD++F SP WD IS +AK F+  L+ V    R T  +A+ H W+        N H     SE++  + ++ RW+     AT +++M ++ +N
Sbjct:    3 LFGKKDSGKKAKAKDLKELNKQVSIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHF-AVKIIDK------KALKGKEES------LENEIRVLRRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSKMEDSGIMATACGTPGYVAPEVLA----QKPYGKAVDVWSIGVISYILLCGYPPFYD--ENDANLFAQILKGDFEFDSPYWDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWISGNEASSRNIH--GTVSEQLKKNFAKSRWKQAYYAATVIRQMQRMALN 333          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Fly
Match: CaMKI (gene:FBgn0016126 transcript:FBtr0089067)

HSP 1 Score: 243.432 bits (620), Expect = 8.528e-77
Identity = 138/356 (38.76%), Postives = 209/356 (58.71%), Query Frame = 3
Query:   48 LFHLQMSKSETKRKSFPENSRYKIIEE-------LGKGGFCEV--LKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLR--EARVMQS--LNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSR-EASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWRCLGLMATALKRMSQINVN 1073
            LF  + S  + K K   E ++   IEE       LG G F EV   + +D   + F A+K +DK K    K  S +   + ++R      + + +    L H NI++L+E  EDK++V+++M+L  GG+LFDRI+    + E+DA+ L+ QIL AV +MH+ G VHRDLKPEN+L+ S D DS I+++DFGLS+ E S  M T CGT  Y APE+L     +K YG  VD+WSIGV++YILLCG+ PFY    +D  + ++I++GD++F SP WD IS +AK F+  L+ V    R T  +A+ H W+        N H     SE++  + ++ RW+     AT +++M ++ +N
Sbjct:    3 LFGKKDSGKKAKAKDLKELNKQVSIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHF-AVKIIDK-KALKGKEESLENEIRVLRRFSANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSKMEDSGIMATACGTPGYVAPEVLA----QKPYGKAVDVWSIGVISYILLCGYPPFYD--ENDANLFAQILKGDFEFDSPYWDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWISGNEASSRNIH--GTVSEQLKKNFAKSRWKQAYYAATVIRQMQRMALN 348          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Fly
Match: CaMKI (gene:FBgn0016126 transcript:FBtr0089065)

HSP 1 Score: 243.432 bits (620), Expect = 8.528e-77
Identity = 138/356 (38.76%), Postives = 209/356 (58.71%), Query Frame = 3
Query:   48 LFHLQMSKSETKRKSFPENSRYKIIEE-------LGKGGFCEV--LKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLR--EARVMQS--LNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSR-EASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWRCLGLMATALKRMSQINVN 1073
            LF  + S  + K K   E ++   IEE       LG G F EV   + +D   + F A+K +DK K    K  S +   + ++R      + + +    L H NI++L+E  EDK++V+++M+L  GG+LFDRI+    + E+DA+ L+ QIL AV +MH+ G VHRDLKPEN+L+ S D DS I+++DFGLS+ E S  M T CGT  Y APE+L     +K YG  VD+WSIGV++YILLCG+ PFY    +D  + ++I++GD++F SP WD IS +AK F+  L+ V    R T  +A+ H W+        N H     SE++  + ++ RW+     AT +++M ++ +N
Sbjct:    3 LFGKKDSGKKAKAKDLKELNKQVSIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHF-AVKIIDK-KALKGKEESLENEIRVLRRFSANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSKMEDSGIMATACGTPGYVAPEVLA----QKPYGKAVDVWSIGVISYILLCGYPPFYD--ENDANLFAQILKGDFEFDSPYWDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWISGNEASSRNIH--GTVSEQLKKNFAKSRWKQAYYAATVIRQMQRMALN 348          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Fly
Match: CaMKI (gene:FBgn0016126 transcript:FBtr0089069)

HSP 1 Score: 243.432 bits (620), Expect = 8.528e-77
Identity = 138/356 (38.76%), Postives = 209/356 (58.71%), Query Frame = 3
Query:   48 LFHLQMSKSETKRKSFPENSRYKIIEE-------LGKGGFCEV--LKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLR--EARVMQS--LNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSR-EASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWRCLGLMATALKRMSQINVN 1073
            LF  + S  + K K   E ++   IEE       LG G F EV   + +D   + F A+K +DK K    K  S +   + ++R      + + +    L H NI++L+E  EDK++V+++M+L  GG+LFDRI+    + E+DA+ L+ QIL AV +MH+ G VHRDLKPEN+L+ S D DS I+++DFGLS+ E S  M T CGT  Y APE+L     +K YG  VD+WSIGV++YILLCG+ PFY    +D  + ++I++GD++F SP WD IS +AK F+  L+ V    R T  +A+ H W+        N H     SE++  + ++ RW+     AT +++M ++ +N
Sbjct:    3 LFGKKDSGKKAKAKDLKELNKQVSIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHF-AVKIIDK-KALKGKEESLENEIRVLRRFSANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSKMEDSGIMATACGTPGYVAPEVLA----QKPYGKAVDVWSIGVISYILLCGYPPFYD--ENDANLFAQILKGDFEFDSPYWDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWISGNEASSRNIH--GTVSEQLKKNFAKSRWKQAYYAATVIRQMQRMALN 348          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Fly
Match: CaMKI (gene:FBgn0016126 transcript:FBtr0089063)

HSP 1 Score: 209.534 bits (532), Expect = 2.815e-65
Identity = 103/235 (43.83%), Postives = 150/235 (63.83%), Query Frame = 3
Query:  372 MDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSR-EASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWRCLGLMATALKRMSQINVN 1073
            M+L  GG+LFDRI+    + E+DA+ L+ QIL AV +MH+ G VHRDLKPEN+L+ S D DS I+++DFGLS+ E S  M T CGT  Y APE+L     +K YG  VD+WSIGV++YILLCG+ PFY    +D  + ++I++GD++F SP WD IS +AK F+  L+ V    R T  +A+ H W+        N H     SE++  + ++ RW+     AT +++M ++ +N
Sbjct:    1 MELVTGGELFDRIVEKGSYTEKDASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSKMEDSGIMATACGTPGYVAPEVLA----QKPYGKAVDVWSIGVISYILLCGYPPFYD--ENDANLFAQILKGDFEFDSPYWDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWISGNEASSRNIH--GTVSEQLKKNFAKSRWKQAYYAATVIRQMQRMALN 227          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Zebrafish
Match: camk1b (calcium/calmodulin-dependent protein kinase Ib [Source:ZFIN;Acc:ZDB-GENE-141014-1])

HSP 1 Score: 229.95 bits (585), Expect = 8.955e-72
Identity = 125/326 (38.34%), Postives = 192/326 (58.90%), Query Frame = 3
Query:   81 KRKSFPENSRYKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSR--EASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWRCLGLMATALKR 1052
            K+K+      Y   E LG G F EV+   + +    VA+K + K K    K +S           +  E  V+  + H NI+ L ++ E K+ ++++M L  GG+LFDRI+    + E+DA+KL++QIL AV+++H  G VHRDLKPEN+L+ S D++S I+++DFGLS+   +   M T CGT  Y APE+L     +K Y   VD WSIGV+AYILLCG+ PFY    +D ++  +I+R +Y+F SP WD IS +AKDF+ +L++  P  R T ++A++H W+       +N H     S +I  + ++ +W+     ATA+ R
Sbjct:   11 KKKTANIKDIYDFKEVLGTGAFSEVMLAEEKRTRKLVAVKCIAK-KALEGKENS-----------IENEIAVLHKIKHANIVSLEDIFESKSHLYLVMQLVSGGELFDRIVEKGFYTEKDASKLIQQILDAVKYLHDMGIVHRDLKPENLLYYSMDEESKIMISDFGLSKIEGSGSVMSTACGTPGYVAPEVLA----QKPYSKAVDCWSIGVIAYILLCGYPPFYD--ENDAKLFEQILRAEYEFDSPYWDDISDSAKDFIVHLMEKDPNQRYTCEQALQHPWIAGDTALDKNIH--ESVSAQIKKNFAKSKWK-QAFNATAVVR 315          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Zebrafish
Match: camk1a (calcium/calmodulin-dependent protein kinase Ia [Source:ZFIN;Acc:ZDB-GENE-131120-147])

HSP 1 Score: 228.794 bits (582), Expect = 2.018e-71
Identity = 123/337 (36.50%), Postives = 196/337 (58.16%), Query Frame = 3
Query:   81 KRKSFPENSRYKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSR--EASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWRCLGLMATALKRMSQINVNREIE 1085
            K+K+      Y   E LG G F EV    + K    VAIK + K K    K +S +            E  V+  + H NI+ L ++ E ++ ++++M L  GG+LFDRI+    + ERDA+KL+ QIL AV+++H  G VHRDLKPEN+L+ S ++DS+I+++DFGLS+  ++   M T CGT  Y APE+L     +K Y   VD WSIGV++YILLCG+ PFY    +D ++  +I++ +Y+F SP WD IS +AKDF+++L++  P  R T ++A+ H W+       +N H     S +I  + ++ +W+        ++ M ++ ++  +E
Sbjct:   11 KKKTTDIKENYDFKEVLGTGAFSEVFLAEEKKTQRLVAIKCIPK-KALEGKENSIE-----------NEIAVLHRIKHENIVSLEDIFESQSHLYLVMQLVSGGELFDRIVEKGFYTERDASKLIRQILDAVKYLHDMGIVHRDLKPENLLYYSMEEDSNIMISDFGLSKIEDSGSVMSTACGTPGYVAPEVLA----QKPYSKAVDCWSIGVISYILLCGYPPFYD--ENDAKLFEQILKAEYEFDSPYWDDISDSAKDFISHLMEKDPSLRYTCEQALLHPWISGDTALDKNIH--ESVSAQIKKNFAKSKWKQAFNATAVVRHMRRLQLSTSLE 327          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Zebrafish
Match: camk1a (calcium/calmodulin-dependent protein kinase Ia [Source:ZFIN;Acc:ZDB-GENE-131120-147])

HSP 1 Score: 228.024 bits (580), Expect = 5.818e-71
Identity = 123/337 (36.50%), Postives = 196/337 (58.16%), Query Frame = 3
Query:   81 KRKSFPENSRYKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSR--EASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWRCLGLMATALKRMSQINVNREIE 1085
            K+K+      Y   E LG G F EV    + K    VAIK + K      KA   +E        +  E  V+  + H NI+ L ++ E ++ ++++M L  GG+LFDRI+    + ERDA+KL+ QIL AV+++H  G VHRDLKPEN+L+ S ++DS+I+++DFGLS+  ++   M T CGT  Y APE+L     +K Y   VD WSIGV++YILLCG+ PFY    +D ++  +I++ +Y+F SP WD IS +AKDF+++L++  P  R T ++A+ H W+       +N H     S +I  + ++ +W+        ++ M ++ ++  +E
Sbjct:   11 KKKTTDIKENYDFKEVLGTGAFSEVFLAEEKKTQRLVAIKCIPK------KALEGKENS------IENEIAVLHRIKHENIVSLEDIFESQSHLYLVMQLVSGGELFDRIVEKGFYTERDASKLIRQILDAVKYLHDMGIVHRDLKPENLLYYSMEEDSNIMISDFGLSKIEDSGSVMSTACGTPGYVAPEVLA----QKPYSKAVDCWSIGVISYILLCGYPPFYD--ENDAKLFEQILKAEYEFDSPYWDDISDSAKDFISHLMEKDPSLRYTCEQALLHPWISGDTALDKNIH--ESVSAQIKKNFAKSKWKQAFNATAVVRHMRRLQLSTSLE 327          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Zebrafish
Match: camk1a (calcium/calmodulin-dependent protein kinase Ia [Source:ZFIN;Acc:ZDB-GENE-131120-147])

HSP 1 Score: 228.024 bits (580), Expect = 5.818e-71
Identity = 123/337 (36.50%), Postives = 196/337 (58.16%), Query Frame = 3
Query:   81 KRKSFPENSRYKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSR--EASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWRCLGLMATALKRMSQINVNREIE 1085
            K+K+      Y   E LG G F EV    + K    VAIK + K      KA   +E        +  E  V+  + H NI+ L ++ E ++ ++++M L  GG+LFDRI+    + ERDA+KL+ QIL AV+++H  G VHRDLKPEN+L+ S ++DS+I+++DFGLS+  ++   M T CGT  Y APE+L     +K Y   VD WSIGV++YILLCG+ PFY    +D ++  +I++ +Y+F SP WD IS +AKDF+++L++  P  R T ++A+ H W+       +N H     S +I  + ++ +W+        ++ M ++ ++  +E
Sbjct:   11 KKKTTDIKENYDFKEVLGTGAFSEVFLAEEKKTQRLVAIKCIPK------KALEGKENS------IENEIAVLHRIKHENIVSLEDIFESQSHLYLVMQLVSGGELFDRIVEKGFYTERDASKLIRQILDAVKYLHDMGIVHRDLKPENLLYYSMEEDSNIMISDFGLSKIEDSGSVMSTACGTPGYVAPEVLA----QKPYSKAVDCWSIGVISYILLCGYPPFYD--ENDAKLFEQILKAEYEFDSPYWDDISDSAKDFISHLMEKDPSLRYTCEQALLHPWISGDTALDKNIH--ESVSAQIKKNFAKSKWKQAFNATAVVRHMRRLQLSTSLE 327          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Zebrafish
Match: pnck (pregnancy up-regulated nonubiquitous CaM kinase [Source:ZFIN;Acc:ZDB-GENE-081105-127])

HSP 1 Score: 221.476 bits (563), Expect = 2.816e-69
Identity = 118/308 (38.31%), Postives = 184/308 (59.74%), Query Frame = 3
Query:  102 NSRYKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMML-REARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSR-EASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWR 1019
            N+ Y++ E+LG+G F EV   +       VA+K + K             R  K K  ML  E  V++ +NH NI+ L E  E   +++++M L  GG+L +RI+    + E+DA++++ Q+L AV+++HQ G VHRDLKPEN++F++  +DS I+++DFGLS+ E    + T CGT  Y APELL     +K YG EVD+W+IGV+ +ILLCG+ PFY    +DT++   II+ +Y+F SP W+ IS +AKDF+ +LL+  P  R   ++A +H W+        N H     S +I  + ++  W+
Sbjct:   14 NAVYELKEKLGEGSFSEVRVAQHRCTQKLVAVKCIRK-------------RALKGKESMLENEVAVLRRINHENIVSLEETFETPTKLYLVMTLLTGGELLNRILERGSYTEKDASRVIYQVLQAVKYLHQLGVVHRDLKPENLIFETPLEDSKIVISDFGLSKMEEQGALSTACGTPAYVAPELL----QQKTYGKEVDLWAIGVITFILLCGYPPFYDD--NDTQLYKLIIKAEYEFDSPYWNDISDSAKDFIVHLLQKDPAKRFNCEQASQHPWISGGAALDRNIH--GSVSAQIQKNFAKSHWK 300          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Xenopus
Match: exosc4 (exosome component 4 [Source:Xenbase;Acc:XB-GENE-969649])

HSP 1 Score: 236.498 bits (602), Expect = 8.540e-75
Identity = 119/307 (38.76%), Postives = 192/307 (62.54%), Query Frame = 3
Query:  102 NSRYKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSR-EASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWR 1019
            N  Y I E+LG G F EV+  ++  ++  VA+K +            P++  +  + ++  E  V++ + H NI+ L ++ E    +++ M+L  GG+LFDRII    + E+DA++L+ Q+L AVQ++H  G VHRDLKPEN+L+ +  +DS I+++DFGLS+ E    M T CGT  Y APELL    ++K YG  VD+W+IGV++YILLCG+ PFY    +D+E+ ++I++ +Y+F SP WD IS +AKDF+ +LL+  P  R+T ++A++H W+        + H     SE+I  + +R +W+
Sbjct:   15 NMAYNIKEKLGAGAFSEVVLAQEKNSERLVALKCI------------PKKALRGKEAVVENEIAVLKKITHKNIVSLEDIYESPTHLYLAMELVTGGELFDRIIERGYYTEKDASQLIRQVLDAVQYLHNMGIVHRDLKPENLLYATPFEDSKIMISDFGLSKIEDGGMMATACGTPGYVAPELL----EQKPYGKAVDVWAIGVISYILLCGYPPFYD--ENDSELFNQILKAEYEFDSPYWDDISESAKDFIRHLLEREPEKRLTCEQALQHPWICGDTALERDIH--GSVSEQIQKNFARTQWK 301          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Xenopus
Match: dnz1 (DNZDHHC/NEW1 zinc finger protein 11 [Source:Xenbase;Acc:XB-GENE-5747351])

HSP 1 Score: 233.417 bits (594), Expect = 1.965e-73
Identity = 127/316 (40.19%), Postives = 191/316 (60.44%), Query Frame = 3
Query:  111 YKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSR--EASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWRCLGLMATALKR 1052
            Y+  E LG G F EV+   + K    VAIK + K K    K +S           +  E  V++ + H NI+ L ++ E ++ +++IM L  GG+LFDRI+    + E+DA++L++QIL AV+++H  G VHRDLKPEN+L+ S D+DS I+++DFGLS+   +   M T CGT  Y APE+L     +K Y   VD WSIGV+AYILLCG+ PFY    +D ++  +I++ +Y+F SP WD IS +AKDF+ +L++  P  R T D+A++H W+       +N H     SE+I  + ++ RW+     ATA+ R
Sbjct:   21 YEFREVLGTGAFSEVVLAEEKKTQKLVAIKCIPK-KALEGKETS-----------IENEIAVLRKIKHANIVSLEDIYESRSHLYLIMQLVSGGELFDRIVEKGFYTEKDASQLIKQILDAVKYLHDMGIVHRDLKPENLLYYSIDEDSKIMISDFGLSKIEGSGSVMSTACGTPGYVAPEVLA----QKPYSKAVDCWSIGVIAYILLCGYPPFYD--ENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIQHLMEKDPNKRNTCDQALQHPWIAGDTALDKNIH--ESVSEQIRKNFAKSRWK-QAFNATAVVR 315          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Xenopus
Match: dnz1 (DNZDHHC/NEW1 zinc finger protein 11 [Source:Xenbase;Acc:XB-GENE-5747351])

HSP 1 Score: 233.802 bits (595), Expect = 2.104e-73
Identity = 127/316 (40.19%), Postives = 191/316 (60.44%), Query Frame = 3
Query:  111 YKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSR--EASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWRCLGLMATALKR 1052
            Y+  E LG G F EV+   + K    VAIK + K K    K +S           +  E  V++ + H NI+ L ++ E ++ +++IM L  GG+LFDRI+    + E+DA++L++QIL AV+++H  G VHRDLKPEN+L+ S D+DS I+++DFGLS+   +   M T CGT  Y APE+L     +K Y   VD WSIGV+AYILLCG+ PFY    +D ++  +I++ +Y+F SP WD IS +AKDF+ +L++  P  R T D+A++H W+       +N H     SE+I  + ++ RW+     ATA+ R
Sbjct:   21 YEFREVLGTGAFSEVVLAEEKKTQKLVAIKCIPK-KALEGKETS-----------IENEIAVLRKIKHANIVSLEDIYESRSHLYLIMQLVSGGELFDRIVEKGFYTEKDASQLIKQILDAVKYLHDMGIVHRDLKPENLLYYSIDEDSKIMISDFGLSKIEGSGSVMSTACGTPGYVAPEVLA----QKPYSKAVDCWSIGVIAYILLCGYPPFYD--ENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIQHLMEKDPNKRNTCDQALQHPWIAGDTALDKNIH--ESVSEQIRKNFAKSRWK-QAFNATAVVR 315          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Xenopus
Match: dnz1 (DNZDHHC/NEW1 zinc finger protein 11 [Source:Xenbase;Acc:XB-GENE-5747351])

HSP 1 Score: 234.187 bits (596), Expect = 2.777e-73
Identity = 127/316 (40.19%), Postives = 191/316 (60.44%), Query Frame = 3
Query:  111 YKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSR--EASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWRCLGLMATALKR 1052
            Y+  E LG G F EV+   + K    VAIK + K K    K +S           +  E  V++ + H NI+ L ++ E ++ +++IM L  GG+LFDRI+    + E+DA++L++QIL AV+++H  G VHRDLKPEN+L+ S D+DS I+++DFGLS+   +   M T CGT  Y APE+L     +K Y   VD WSIGV+AYILLCG+ PFY    +D ++  +I++ +Y+F SP WD IS +AKDF+ +L++  P  R T D+A++H W+       +N H     SE+I  + ++ RW+     ATA+ R
Sbjct:   21 YEFREVLGTGAFSEVVLAEEKKTQKLVAIKCIPK-KALEGKETS-----------IENEIAVLRKIKHANIVSLEDIYESRSHLYLIMQLVSGGELFDRIVEKGFYTEKDASQLIKQILDAVKYLHDMGIVHRDLKPENLLYYSIDEDSKIMISDFGLSKIEGSGSVMSTACGTPGYVAPEVLA----QKPYSKAVDCWSIGVIAYILLCGYPPFYD--ENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIQHLMEKDPNKRNTCDQALQHPWIAGDTALDKNIH--ESVSEQIRKNFAKSRWK-QAFNATAVVR 315          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Xenopus
Match: dnz1 (DNZDHHC/NEW1 zinc finger protein 11 [Source:Xenbase;Acc:XB-GENE-5747351])

HSP 1 Score: 233.802 bits (595), Expect = 3.004e-73
Identity = 127/316 (40.19%), Postives = 191/316 (60.44%), Query Frame = 3
Query:  111 YKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSR--EASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWRCLGLMATALKR 1052
            Y+  E LG G F EV+   + K    VAIK + K K    K +S           +  E  V++ + H NI+ L ++ E ++ +++IM L  GG+LFDRI+    + E+DA++L++QIL AV+++H  G VHRDLKPEN+L+ S D+DS I+++DFGLS+   +   M T CGT  Y APE+L     +K Y   VD WSIGV+AYILLCG+ PFY    +D ++  +I++ +Y+F SP WD IS +AKDF+ +L++  P  R T D+A++H W+       +N H     SE+I  + ++ RW+     ATA+ R
Sbjct:   21 YEFREVLGTGAFSEVVLAEEKKTQKLVAIKCIPK-KALEGKETS-----------IENEIAVLRKIKHANIVSLEDIYESRSHLYLIMQLVSGGELFDRIVEKGFYTEKDASQLIKQILDAVKYLHDMGIVHRDLKPENLLYYSIDEDSKIMISDFGLSKIEGSGSVMSTACGTPGYVAPEVLA----QKPYSKAVDCWSIGVIAYILLCGYPPFYD--ENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIQHLMEKDPNKRNTCDQALQHPWIAGDTALDKNIH--ESVSEQIRKNFAKSRWK-QAFNATAVVR 315          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Mouse
Match: Pnck (pregnancy upregulated non-ubiquitously expressed CaM kinase [Source:MGI Symbol;Acc:MGI:1347357])

HSP 1 Score: 229.95 bits (585), Expect = 3.030e-72
Identity = 118/307 (38.44%), Postives = 190/307 (61.89%), Query Frame = 3
Query:  102 NSRYKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSR-EASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWR 1019
            +S Y+I E+LG G F EV+  ++  +   VA+K +            P++  +  + ++  E  V++ ++H NI+ L +V E  + +++ M+L  GG+LFDRI+    + E+DA+ L+ Q+L AV ++H  G VHRDLKPEN+L+ +  +DS I+++DFGLS+ +A   + T CGT  Y APELL    ++K YG  VD+W++GV++YILLCG+ PFY  +  D E+ S+I+R  Y+F SP WD IS +AKDF+ +LL+  P  R T  +A++HLW+        +   +   SE+I  + +R  W+
Sbjct:   12 SSVYEIREKLGSGAFSEVMLAQERGSAHLVALKCI------------PKKALRGKEALVENEIAVLRRISHPNIVALEDVHESPSHLYLAMELVTGGELFDRIMERGSYTEKDASHLVGQVLGAVSYLHSLGIVHRDLKPENLLYATPFEDSKIMVSDFGLSKIQAGNMLGTACGTPGYVAPELL----EQKPYGKAVDVWALGVISYILLCGYPPFYDES--DPELFSQILRASYEFDSPFWDDISESAKDFIRHLLERDPQKRFTCQQALQHLWISGDAAFDRD--ILGSVSEQIQKNFARTHWK 298          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Mouse
Match: Pnck (pregnancy upregulated non-ubiquitously expressed CaM kinase [Source:MGI Symbol;Acc:MGI:1347357])

HSP 1 Score: 229.95 bits (585), Expect = 3.030e-72
Identity = 118/307 (38.44%), Postives = 190/307 (61.89%), Query Frame = 3
Query:  102 NSRYKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSR-EASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWR 1019
            +S Y+I E+LG G F EV+  ++  +   VA+K +            P++  +  + ++  E  V++ ++H NI+ L +V E  + +++ M+L  GG+LFDRI+    + E+DA+ L+ Q+L AV ++H  G VHRDLKPEN+L+ +  +DS I+++DFGLS+ +A   + T CGT  Y APELL    ++K YG  VD+W++GV++YILLCG+ PFY  +  D E+ S+I+R  Y+F SP WD IS +AKDF+ +LL+  P  R T  +A++HLW+        +   +   SE+I  + +R  W+
Sbjct:   12 SSVYEIREKLGSGAFSEVMLAQERGSAHLVALKCI------------PKKALRGKEALVENEIAVLRRISHPNIVALEDVHESPSHLYLAMELVTGGELFDRIMERGSYTEKDASHLVGQVLGAVSYLHSLGIVHRDLKPENLLYATPFEDSKIMVSDFGLSKIQAGNMLGTACGTPGYVAPELL----EQKPYGKAVDVWALGVISYILLCGYPPFYDES--DPELFSQILRASYEFDSPFWDDISESAKDFIRHLLERDPQKRFTCQQALQHLWISGDAAFDRD--ILGSVSEQIQKNFARTHWK 298          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Mouse
Match: Pnck (pregnancy upregulated non-ubiquitously expressed CaM kinase [Source:MGI Symbol;Acc:MGI:1347357])

HSP 1 Score: 229.95 bits (585), Expect = 3.030e-72
Identity = 118/307 (38.44%), Postives = 190/307 (61.89%), Query Frame = 3
Query:  102 NSRYKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSR-EASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWR 1019
            +S Y+I E+LG G F EV+  ++  +   VA+K +            P++  +  + ++  E  V++ ++H NI+ L +V E  + +++ M+L  GG+LFDRI+    + E+DA+ L+ Q+L AV ++H  G VHRDLKPEN+L+ +  +DS I+++DFGLS+ +A   + T CGT  Y APELL    ++K YG  VD+W++GV++YILLCG+ PFY  +  D E+ S+I+R  Y+F SP WD IS +AKDF+ +LL+  P  R T  +A++HLW+        +   +   SE+I  + +R  W+
Sbjct:   12 SSVYEIREKLGSGAFSEVMLAQERGSAHLVALKCI------------PKKALRGKEALVENEIAVLRRISHPNIVALEDVHESPSHLYLAMELVTGGELFDRIMERGSYTEKDASHLVGQVLGAVSYLHSLGIVHRDLKPENLLYATPFEDSKIMVSDFGLSKIQAGNMLGTACGTPGYVAPELL----EQKPYGKAVDVWALGVISYILLCGYPPFYDES--DPELFSQILRASYEFDSPFWDDISESAKDFIRHLLERDPQKRFTCQQALQHLWISGDAAFDRD--ILGSVSEQIQKNFARTHWK 298          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Mouse
Match: Camk1 (calcium/calmodulin-dependent protein kinase I [Source:MGI Symbol;Acc:MGI:1098535])

HSP 1 Score: 226.098 bits (575), Expect = 2.583e-70
Identity = 126/316 (39.87%), Postives = 187/316 (59.18%), Query Frame = 3
Query:  111 YKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSR--EASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWRCLGLMATALKR 1052
            Y   + LG G F EV+   D +    VAIK + K K    K  S           M  E  V+  + H NI+ L ++ E    +++IM L  GG+LFDRI+    + ERDA++L+ Q+L AV+++H  G VHRDLKPEN+L+ S D+DS I+++DFGLS+  +    + T CGT  Y APE+L     +K Y   VD WSIGV+AYILLCG+ PFY    +D ++  +I++ +Y+F SP WD IS +AKDF+ +L++  P  R T ++A++H W+       +N H  SV SE+I  + ++ +W+     ATA+ R
Sbjct:   20 YDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAK-KALEGKEGS-----------MENEIAVLHKIKHPNIVALDDIYESGGHLYLIMQLVSGGELFDRIVEKGFYTERDASRLIFQVLDAVKYLHDLGIVHRDLKPENLLYYSLDEDSKIMISDFGLSKMEDPGSVLSTACGTPGYVAPEVLA----QKPYSKAVDCWSIGVIAYILLCGYPPFYD--ENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIAGDTALDKNIHQ-SV-SEQIKKNFAKSKWK-QAFNATAVVR 314          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Mouse
Match: Camk1d (calcium/calmodulin-dependent protein kinase ID [Source:MGI Symbol;Acc:MGI:2442190])

HSP 1 Score: 222.246 bits (565), Expect = 1.083e-68
Identity = 120/316 (37.97%), Postives = 185/316 (58.54%), Query Frame = 3
Query:  111 YKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSR--EASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWRCLGLMATALKR 1052
            ++  E LG G F EV+   +       A+K + K K    K SS +            E  V++ + H NI+ L ++ E  N ++++M L  GG+LFDRI+    + E+DA+ L+ Q+L AV ++H+ G VHRDLKPEN+L+ S+D++S I+++DFGLS+     + M T CGT  Y APE+L     +K Y   VD WSIGV+AYILLCG+ PFY    +D+++  +I++ +Y+F SP WD IS +AKDF+  L++  P  R T ++A +H W+       +N H     S +I  + ++ +WR     ATA+ R
Sbjct:   23 FEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPK-KALKGKESSIE-----------NEIAVLRKIKHENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVYYLHRMGIVHRDLKPENLLYYSQDEESKIMISDFGLSKMEGKGDVMSTACGTPGYVAPEVLA----QKPYSKAVDCWSIGVIAYILLCGYPPFYD--ENDSKLFEQILKAEYEFDSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIAGDTALSKNIH--ESVSAQIRKNFAKSKWR-QAFNATAVVR 317          
BLAST of Calcium:calmodulin dependent protein kinase type vs. UniProt/SwissProt
Match: sp|W0LYS5|CAMKI_MACNP (Calcium/calmodulin-dependent protein kinase type 1 OS=Macrobrachium nipponense OX=159736 GN=CaMKI PE=2 SV=1)

HSP 1 Score: 241.121 bits (614), Expect = 1.035e-75
Identity = 136/328 (41.46%), Postives = 200/328 (60.98%), Query Frame = 3
Query:  108 RYKIIEELGKGGFCEVLKGRDVKND--FFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSR-EASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWRCLGLMATALKRMSQINVNREI 1082
            +Y + + LG G F +V +  +VK D    VAIK +DK K    K  S           +  E RV++ L H NI++L+E  ED+  V++I++L  GG+LFDRI+    + E+DA+ L+ Q+L AV +MH  G VHRDLKPEN+L+ S D+DS I+++DFGLS+ E S  M T CGT  Y APE+L     +K YG  VD+WSIGV+AYILLCG+ PFY    +D  + ++I++G+++F SP WD IS +AKDF+  L+ V    R T  +A+ H W+       EN H  S  SE++  + ++ RWR     ATA+ R  ++   +++
Sbjct:   30 KYILKDLLGTGAFSQV-RLAEVKEDPSRVVAIKIIDK-KALKGKEDS-----------LENEIRVLRRLQHPNIVQLMETYEDREHVYLIIELVTGGELFDRIVEKGSYTEKDASDLIRQVLEAVDYMHDQGVVHRDLKPENLLYYSPDEDSKIMISDFGLSKMEDSGIMATACGTPGYVAPEVLA----QKPYGKAVDVWSIGVIAYILLCGYPPFYD--ENDANLFAQILKGEFEFDSPYWDEISESAKDFIRQLMCVDVEKRYTCKQALGHPWISGNAASTENIH--SSVSEQLKKNFAKSRWR-QAYHATAVIRQMRLFATKQV 335          
BLAST of Calcium:calmodulin dependent protein kinase type vs. UniProt/SwissProt
Match: sp|O70150|KCC1B_RAT (Calcium/calmodulin-dependent protein kinase type 1B OS=Rattus norvegicus OX=10116 GN=Pnck PE=1 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 1.423e-71
Identity = 118/307 (38.44%), Postives = 190/307 (61.89%), Query Frame = 3
Query:  102 NSRYKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSR-EASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWR 1019
            +S Y+I E+LG G F EV+  ++  +   VA+K +            P++  +  + ++  E  V++ ++H NI+ L +V E  + +++ M+L  GG+LFDRI+    + E+DA+ L+ Q+L AV ++H  G VHRDLKPEN+L+ +  +DS I+++DFGLS+ +A   + T CGT  Y APELL    ++K YG  VD+W++GV++YILLCG+ PFY  +  D E+ S+I+R  Y+F SP WD IS +AKDF+ +LL+  P  R T  +A++HLW+        +   +   SE+I  + +R  W+
Sbjct:   12 SSVYEIREKLGSGAFSEVMLAQERGSAHLVALKCI------------PKKALRGKEALVENEIAVLRRISHPNIVALEDVHESPSHLYLAMELVTGGELFDRIMERGSYTEKDASHLVGQVLGAVSYLHSLGIVHRDLKPENLLYATPFEDSKIMVSDFGLSKIQAGNMLGTACGTPGYVAPELL----EQKPYGKAVDVWALGVISYILLCGYPPFYDES--DPELFSQILRASYEFDSPFWDDISESAKDFIRHLLERDPQKRFTCQQALQHLWISGDAALDRD--ILGSVSEQIQKNFARTHWK 298          
BLAST of Calcium:calmodulin dependent protein kinase type vs. UniProt/SwissProt
Match: sp|Q9QYK9|KCC1B_MOUSE (Calcium/calmodulin-dependent protein kinase type 1B OS=Mus musculus OX=10090 GN=Pnck PE=1 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 2.119e-71
Identity = 118/307 (38.44%), Postives = 190/307 (61.89%), Query Frame = 3
Query:  102 NSRYKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSR-EASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWR 1019
            +S Y+I E+LG G F EV+  ++  +   VA+K +            P++  +  + ++  E  V++ ++H NI+ L +V E  + +++ M+L  GG+LFDRI+    + E+DA+ L+ Q+L AV ++H  G VHRDLKPEN+L+ +  +DS I+++DFGLS+ +A   + T CGT  Y APELL    ++K YG  VD+W++GV++YILLCG+ PFY  +  D E+ S+I+R  Y+F SP WD IS +AKDF+ +LL+  P  R T  +A++HLW+        +   +   SE+I  + +R  W+
Sbjct:   12 SSVYEIREKLGSGAFSEVMLAQERGSAHLVALKCI------------PKKALRGKEALVENEIAVLRRISHPNIVALEDVHESPSHLYLAMELVTGGELFDRIMERGSYTEKDASHLVGQVLGAVSYLHSLGIVHRDLKPENLLYATPFEDSKIMVSDFGLSKIQAGNMLGTACGTPGYVAPELL----EQKPYGKAVDVWALGVISYILLCGYPPFYDES--DPELFSQILRASYEFDSPFWDDISESAKDFIRHLLERDPQKRFTCQQALQHLWISGDAAFDRD--ILGSVSEQIQKNFARTHWK 298          
BLAST of Calcium:calmodulin dependent protein kinase type vs. UniProt/SwissProt
Match: sp|Q9TXJ0|CMK1_CAEEL (Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis elegans OX=6239 GN=cmk-1 PE=1 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 7.508e-71
Identity = 126/330 (38.18%), Postives = 195/330 (59.09%), Query Frame = 3
Query:  108 RYKIIEELGKGGFCEVLKGRDVKNDF--FVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSR-EASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWRCLGLMATALKRMSQI----NVNR 1076
            +Y   + LG G F +V    + K+D     A+K +DK      KA   +E        +  E +V++ L H NI++L +  ++K  V+++M+L  GG+LFDRI++   + E+DA+ L+ Q+L AV  MH  G VHRDLKPEN+L+ ++D+DS I+++DFGLS+ E S  M T CGT  Y APE+L     +K YG  VD+WSIGV+AYILLCG+ PFY  +  D  + ++II+G+Y+F +P WD IS +AKDF+T+L+   P  R T   A+ H W+        + H     +  +  S+++  W+     A A++++  +    N NR
Sbjct:   21 KYDFRDVLGTGAFSKVFLA-ESKSDAGQMYAVKCIDK------KALKGKEES------LENEIKVLRKLRHNNIVQLFDTYDEKQFVYLVMELVTGGELFDRIVAKGSYTEQDASNLIRQVLEAVGFMHDNGVVHRDLKPENLLYYNQDEDSKIMISDFGLSKTEDSGVMATACGTPGYVAPEVL----QQKPYGKAVDVWSIGVIAYILLCGYPPFYDES--DANLFAQIIKGEYEFDAPYWDQISDSAKDFITHLMCCDPEARFTCQDALSHPWISGNTAYTHDIH--GTVAVHLKKSLAKRNWKKAYNAAAAIRQLQMLRLSSNSNR 329          
BLAST of Calcium:calmodulin dependent protein kinase type vs. UniProt/SwissProt
Match: sp|Q6P2M8|KCC1B_HUMAN (Calcium/calmodulin-dependent protein kinase type 1B OS=Homo sapiens OX=9606 GN=PNCK PE=2 SV=2)

HSP 1 Score: 228.409 bits (581), Expect = 8.679e-71
Identity = 118/307 (38.44%), Postives = 189/307 (61.56%), Query Frame = 3
Query:  102 NSRYKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSR-EASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWR 1019
            +S Y+I E LG G F EV+  ++  +   VA+K +            P++  +  + ++  E  V++ ++H NI+ L +V E  + +++ M+L  GG+LFDRI+    + E+DA+ L+ Q+L AV ++H  G VHRDLKPEN+L+ +  +DS I+++DFGLS+ +A   + T CGT  Y APELL    ++K YG  VD+W++GV++YILLCG+ PFY  +  D E+ S+I+R  Y+F SP WD IS +AKDF+ +LL+  P  R T  +A++HLW+        +   +   SE+I  + +R  W+
Sbjct:   12 SSVYEIRERLGSGAFSEVVLAQERGSAHLVALKCI------------PKKALRGKEALVENEIAVLRRISHPNIVALEDVHESPSHLYLAMELVTGGELFDRIMERGSYTEKDASHLVGQVLGAVSYLHSLGIVHRDLKPENLLYATPFEDSKIMVSDFGLSKIQAGNMLGTACGTPGYVAPELL----EQKPYGKAVDVWALGVISYILLCGYPPFYDES--DPELFSQILRASYEFDSPFWDDISESAKDFIRHLLERDPQKRFTCQQALRHLWISGDTAFDRD--ILGSVSEQIRKNFARTHWK 298          
BLAST of Calcium:calmodulin dependent protein kinase type vs. TrEMBL
Match: A0A0R3WJ96 (Protein kinase domain-containing protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS733 PE=4 SV=1)

HSP 1 Score: 372.474 bits (955), Expect = 1.795e-124
Identity = 179/334 (53.59%), Postives = 246/334 (73.65%), Query Frame = 3
Query:   60 QMSKSETKRKSFPENS-RYKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSREASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWRCLGLMATALKRMS 1058
            Q  ++  K K  P  S +Y++I  LG GGFCEV K +D+ N+ +VAIKRVD++KP + K S P++ +KK+K++M REA +M+SL+H N+IKL E++ED  ++FI M LAEGG+LFDRII   +F E+DAA ++ Q+++A+++MH  GFVHRD+KPENILF S   DS +L+TDFGLSRE  + M+TNCGT+DYSAPELL ++  + GYGPEVD WSIGV++YILLCG+ PFYST +DD+EI+ +I+ G Y F  P WD IS  AK FV  LLKV P +RM+L  A++H W+K + P   +  Y  +E E + D+I++ RWRCLGL A A+  MS
Sbjct:    7 QQREASKKAKIEPLKSDKYRLISRLGDGGFCEVFKAKDLVNNRYVAIKRVDRSKPTYQKYS-PKDVEKKVKKLMYREATIMRSLDHPNLIKLYELVEDNEQIFIAMQLAEGGELFDRIIKRGKFTEKDAATVVAQVIAAIKYMHDRGFVHRDIKPENILFDSISDDSKLLITDFGLSRELEQKMLTNCGTVDYSAPELLKSKLTKVGYGPEVDNWSIGVVSYILLCGYPPFYSTNQDDSEIKKQIMSGTYHFHHPHWDNISKHAKSFVAGLLKVDPSERMSLKNALEHPWIKLECPNTLD-LYPLIE-ERMRDTIAKQRWRCLGLAAGAVHLMS 337          
BLAST of Calcium:calmodulin dependent protein kinase type vs. TrEMBL
Match: A0A068YE86 (Calcium:calmodulin dependent protein kinase type OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000826600 PE=4 SV=1)

HSP 1 Score: 370.548 bits (950), Expect = 9.942e-124
Identity = 180/334 (53.89%), Postives = 245/334 (73.35%), Query Frame = 3
Query:   60 QMSKSETKRKSFPENS-RYKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSREASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWRCLGLMATALKRMS 1058
            Q  ++  K K  P  S +Y++I  LG GGFCEV K +D+ N+ +VAIKRVD++KP + K S P++ +KK+K++M REA +M+SL+H N+IKL E++ED  ++FI M LAEGG+LFDRII   +F ERDAA ++ Q+++A+++MH  GFVHRD+KPENILF S   DS +L+TDFGLSRE  + M+TNCGT+DYSAPELL ++  + GYGPEVD WSIGV++YILLCG+ PFYST +DD EI+ +I+ G Y F  P WD IS  AK FV  LLKV P +RM+L  A++H W+K + P   +  Y  +E E + D+I++ RWRCLGL A A+  MS
Sbjct:    7 QQREASKKAKIEPLKSDKYRLISRLGDGGFCEVFKAKDLVNNRYVAIKRVDRSKPTYQKYS-PKDVEKKVKKLMYREATIMRSLDHPNLIKLYELVEDNEQIFIAMQLAEGGELFDRIIKRGKFTERDAAIVVAQVIAAIKYMHDRGFVHRDIKPENILFDSISDDSKLLITDFGLSRELEQKMLTNCGTVDYSAPELLRSKITKVGYGPEVDNWSIGVVSYILLCGYPPFYSTNQDDGEIKKQIMSGIYHFHHPHWDNISKHAKSFVAGLLKVDPSERMSLKNALEHPWIKMECPNTLD-LYPLIE-ERMRDTIAKQRWRCLGLAAGAVHLMS 337          
BLAST of Calcium:calmodulin dependent protein kinase type vs. TrEMBL
Match: U6IVQ1 (Calcium/calmodulin-dependent protein kinase type 1G OS=Echinococcus granulosus OX=6210 GN=EGR_01325 PE=4 SV=1)

HSP 1 Score: 370.163 bits (949), Expect = 1.538e-123
Identity = 180/334 (53.89%), Postives = 245/334 (73.35%), Query Frame = 3
Query:   60 QMSKSETKRKSFPENS-RYKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSREASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWRCLGLMATALKRMS 1058
            Q  ++  K K  P  S +Y++I  LG GGFCEV K +D+ N+ +VAIKRVD++KP + K S P++ +KK+K++M REA +M+SL+H N+IKL E++ED  ++FI M LAEGG+LFDRII   +F ERDAA ++ Q+++A+++MH  GFVHRD+KPENILF S   DS +L+TDFGLSRE  + M+TNCGT+DYSAPELL ++  + GYGPEVD WSIGV++YILLCG+ PFYST +DD EI+ +I+ G Y F  P WD IS  AK FV  LLKV P +RM+L  A++H W+K + P   +  Y  +E E + D+I++ RWRCLGL A A+  MS
Sbjct:    7 QQREASKKAKIEPLKSDKYRLISRLGDGGFCEVFKAKDLVNNRYVAIKRVDRSKPTYQKYS-PKDVEKKVKKLMYREATIMRSLDHPNLIKLYELVEDNEQIFIAMQLAEGGELFDRIIKRGKFTERDAAIVVSQVIAAIKYMHDRGFVHRDIKPENILFDSISDDSKLLITDFGLSRELEQKMLTNCGTVDYSAPELLRSKITKVGYGPEVDNWSIGVVSYILLCGYPPFYSTNQDDGEIKKQIMSGIYHFHHPHWDNISKHAKSFVAGLLKVDPSERMSLKNALEHPWIKLECPNTLD-LYPLIE-ERMRDTIAKQRWRCLGLAAGAVHLMS 337          
BLAST of Calcium:calmodulin dependent protein kinase type vs. TrEMBL
Match: A0A0R3VSI0 (Protein kinase domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS121 PE=4 SV=1)

HSP 1 Score: 369.777 bits (948), Expect = 2.227e-123
Identity = 179/334 (53.59%), Postives = 245/334 (73.35%), Query Frame = 3
Query:   60 QMSKSETKRKSFPENS-RYKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSREASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWRCLGLMATALKRMS 1058
            Q  ++  K K  P  S +Y++I  LG GGFCEV K +D+ N+ +VAIKRVD++KP + K S P++ +KK+K++M REA +M+SL+H N+IKL E++ED  ++FI M LAEGG+LFDRII   +F E+DAA ++ Q+++A+++MH  GFVHRD+KPENILF S   DS +L+TDFGLSRE  + M+TNCGT+DYSAPELL ++  + GYGPEVD WSIGV++YILLCG+ PFYST +DD EI+ +I+ G Y F  P WD IS  AK FV  LLKV P +RM+L  A++H W+K + P   +  Y  +E E + D+I++ RWRCLGL A A+  MS
Sbjct:    7 QQREASKKAKIEPLKSDKYRLISRLGDGGFCEVFKAKDLVNNRYVAIKRVDRSKPTYQKYS-PKDVEKKVKKLMYREATIMRSLDHPNLIKLYELVEDNEQIFIAMQLAEGGELFDRIIKRGKFTEKDAAIVVAQVIAAIKYMHDRGFVHRDIKPENILFDSISDDSKLLITDFGLSRELEQKMLTNCGTVDYSAPELLRSKLTKVGYGPEVDNWSIGVVSYILLCGYPPFYSTNQDDGEIKKQIMSGVYHFHHPHWDNISKHAKSFVAGLLKVDPSERMSLKNALEHPWIKLECPNTLD-LYPLIE-ERMRDTIAKQRWRCLGLAAGAVHLMS 337          
BLAST of Calcium:calmodulin dependent protein kinase type vs. TrEMBL
Match: A0A0R3UGS0 (Protein kinase domain-containing protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS6453 PE=4 SV=1)

HSP 1 Score: 369.392 bits (947), Expect = 2.566e-123
Identity = 176/334 (52.69%), Postives = 248/334 (74.25%), Query Frame = 3
Query:   60 QMSKSETKRKSFPENS-RYKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSREASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWRCLGLMATALKRMS 1058
            Q  ++  K K  P  S +Y++I  LG GGFCEV K +D+ N+ +VAIKRVD++KP + K S P++ +KK+K++M REA +M++L+H N+IKL E++ED +++FI M LAEGG+LFDRII   +F E+DAA+++ Q++ A+++MH  GFVHRD+KPENILF S   DS +L+TDFGLSRE  + M+TNCGT+DYSAPELL ++  + GYGPEVD WSIGV++YILLCG+ PFYST +DD EI+ +I+ G Y F  P WD+IS  AK FV  LLKV P +RM+L  A++H W++ + P   +  Y  +E E++ D+I++ RWRCLGL A A+  +S
Sbjct:    7 QQREASKKAKIEPLKSDKYRLISRLGDGGFCEVFKAKDLVNNRYVAIKRVDRSKPTYQKYS-PKDVEKKVKKLMYREAAIMRALDHPNLIKLYELVEDNDQIFIAMQLAEGGELFDRIIKRGKFTEKDAAQVMAQVIGAIKYMHDRGFVHRDIKPENILFYSAGDDSKLLITDFGLSRELEQKMLTNCGTVDYSAPELLKSKLTKVGYGPEVDNWSIGVVSYILLCGYPPFYSTNQDDGEIKKQIMSGVYHFHHPHWDSISKQAKSFVAGLLKVDPSERMSLKSALEHPWIRLECPSTID-IYPLIE-EKMKDTIAKQRWRCLGLAAGAVHLLS 337          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Cavefish
Match: pnck (calcium/calmodulin-dependent protein kinase type 1B-like [Source:NCBI gene;Acc:103046554])

HSP 1 Score: 220.705 bits (561), Expect = 7.005e-69
Identity = 118/317 (37.22%), Postives = 193/317 (60.88%), Query Frame = 3
Query:   75 ETKRKSFPENSRYKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLR-EARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSR-EASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWR 1019
            + ++K+   ++ Y++ E+LG+G F EV   +  K    VA+K + K             R  K K  ML  E  V++ + H NII L E  E   +++++M L  GG+L DRI+    + E+DA++++ Q+L AV+++HQ G VHRDLKPEN+L+++  +DS I+++DFGLS+ E    + T CGT  Y APELL     +K YG  VD+W++GV+++ILLCG+ PFY    +DT++  +II+ +++F SP WD IS +AKDF+ +LL+  P  R   ++A++H W+       +N H     S +I  + ++ +W+
Sbjct:    6 DVRKKADDISAVYELREKLGEGSFSEVRVAQHRKTHKLVAVKCIRK-------------RALKGKESMLENEIAVLRRIKHENIISLEETFETPTKLYLVMTLVTGGELLDRILERGSYTEKDASRVILQVLEAVKYLHQLGIVHRDLKPENLLYETPLEDSKIVISDFGLSKMEEQGALSTACGTPAYVAPELL----QQKTYGKGVDLWALGVISFILLCGYPPFYD--ENDTQLYKQIIKAEFEFDSPYWDDISDSAKDFIVHLLQKDPERRFNCEQALQHPWISGGAALDKNIH--GSVSAQIQKNFAKSQWK 301          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Cavefish
Match: pnck (calcium/calmodulin-dependent protein kinase type 1B-like [Source:NCBI gene;Acc:103046554])

HSP 1 Score: 220.705 bits (561), Expect = 7.005e-69
Identity = 118/317 (37.22%), Postives = 193/317 (60.88%), Query Frame = 3
Query:   75 ETKRKSFPENSRYKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLR-EARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSR-EASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWR 1019
            + ++K+   ++ Y++ E+LG+G F EV   +  K    VA+K + K             R  K K  ML  E  V++ + H NII L E  E   +++++M L  GG+L DRI+    + E+DA++++ Q+L AV+++HQ G VHRDLKPEN+L+++  +DS I+++DFGLS+ E    + T CGT  Y APELL     +K YG  VD+W++GV+++ILLCG+ PFY    +DT++  +II+ +++F SP WD IS +AKDF+ +LL+  P  R   ++A++H W+       +N H     S +I  + ++ +W+
Sbjct:    6 DVRKKADDISAVYELREKLGEGSFSEVRVAQHRKTHKLVAVKCIRK-------------RALKGKESMLENEIAVLRRIKHENIISLEETFETPTKLYLVMTLVTGGELLDRILERGSYTEKDASRVILQVLEAVKYLHQLGIVHRDLKPENLLYETPLEDSKIVISDFGLSKMEEQGALSTACGTPAYVAPELL----QQKTYGKGVDLWALGVISFILLCGYPPFYD--ENDTQLYKQIIKAEFEFDSPYWDDISDSAKDFIVHLLQKDPERRFNCEQALQHPWISGGAALDKNIH--GSVSAQIQKNFAKSQWK 301          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Cavefish
Match: camk1gb (calcium/calmodulin-dependent protein kinase type 1D-like [Source:NCBI gene;Acc:103033882])

HSP 1 Score: 222.246 bits (565), Expect = 4.896e-68
Identity = 126/355 (35.49%), Postives = 199/355 (56.06%), Query Frame = 3
Query:   57 LQMSKSETKRKSFPENSR--YKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSR-EASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPEN-PHYVSVESEEIYDSISRLRWRCLGLMATALKRMSQINVNREIEI*YFLVHC 1109
            + + ++++  K   EN R  +  IE LG G   EV K ++     F A+K V K               K     +  E  V++ + H NI+ L +  E ++  +++M L  GG+LFDR++    F+E+DA+ ++ Q+L  V ++HQ   VHRDLKPEN+L+ S+D++S I+++DFGLS+ E ++ M T CGT  Y APE+L     +K Y   VD WSIGV+ YILLCG+ PFY  T  +T + SKI++  Y+F SP WD IS +AKDF+  +++  P  R T D+A++H W+  +  R ++  H VSV   +I  + ++ +W+       A+  M ++           L HC
Sbjct:   19 MGLRQADSDWKKTVENIREIFDFIEVLGSGASSEVFKVKEKSTGKFFAMKCVIK---------------KNRNTTLENEIAVLKRIKHNNIVALEDFYETQSHYYLVMQLVSGGELFDRLLDRGMFSEKDASMVIRQVLEGVHYLHQNNIVHRDLKPENLLYYSQDENSKIMISDFGLSKMEDNDIMSTACGTPGYVAPEVLA----QKPYSKAVDCWSIGVITYILLCGYPPFYEET--ETRLFSKIMKAQYEFDSPFWDNISESAKDFIRNMMQKNPKLRFTTDQALRHPWIIGKTARSQDIYHSVSV---QIQKNFAKSKWKQAFNATVAIHHMKKLQ----------LAHC 339          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Cavefish
Match: camk1db (calcium/calmodulin-dependent protein kinase type 1D-like [Source:NCBI gene;Acc:103041809])

HSP 1 Score: 219.55 bits (558), Expect = 9.043e-68
Identity = 121/317 (38.17%), Postives = 188/317 (59.31%), Query Frame = 3
Query:  111 YKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSR---EASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWRCLGLMATALKR 1052
            +++ E LG G F EV+  ++       A+K + K K    K SS +            E  V++ + H NI+ L ++ E  N +++IM L  GG+LFDRI+    + E+DA+ L++Q+L AV ++H  G VHRDLKPEN+L+ ++D +S I+++DFGLS+    A++ M T CGT  Y APE+L     +K Y   VD WSIGV++YILLCG+ PFY    +D+++  +I++ DY+F SP WD IS +AKDF++ L+   P  R T D+A+ H W+       +N H     S ++  + ++ +WR     ATA+ R
Sbjct:   24 FELKEILGTGAFSEVVLAQERSTGKMYAVKCIPK-KALRGKESSIE-----------NEIAVLRKIKHENIVALEDIYESPNHLYLIMQLVSGGELFDRIVERGFYTEQDASALIKQVLDAVNYLHSLGIVHRDLKPENLLYYNQD-ESKIMISDFGLSKMEGAANDIMSTACGTPGYVAPEVLA----QKPYSKAVDCWSIGVISYILLCGYPPFYD--ENDSKLFEQILKADYEFDSPYWDDISDSAKDFISNLMLKNPEKRFTCDQALLHPWIAGDTALRKNIH--ESVSRQMKKNFAKAKWR-QAFNATAVIR 318          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Cavefish
Match: camk1gb (calcium/calmodulin-dependent protein kinase type 1D-like [Source:NCBI gene;Acc:103033882])

HSP 1 Score: 221.476 bits (563), Expect = 9.114e-68
Identity = 127/355 (35.77%), Postives = 202/355 (56.90%), Query Frame = 3
Query:   57 LQMSKSETKRKSFPENSR--YKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSR-EASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPEN-PHYVSVESEEIYDSISRLRWRCLGLMATALKRMSQINVNREIEI*YFLVHC 1109
            + + ++++  K   EN R  +  IE LG G F EV   ++ K     A+K V K            +RD  ++     E  V++ + H N++ L +  E ++  +++M L  GG+LFDRI+    ++E DA+ ++ Q+L AV ++H  G VHRDLKPEN+L+ S+D++S I+++DFGLS+ E ++ M T CGT  Y APE+L     +K Y   VD WSIGV+ YILLCG+ PFY  T  +T + SKI++  Y+F SP WD IS +AKDF+  +++  P  R T D+A++H W+  +  R ++  H VSV   +I  + ++ +W+       A+  M ++           L HC
Sbjct:   19 MGLRQADSDWKKTVENIREIFDFIEVLGSGAFSEVFMVKERKTGKLFAMKCVKKK----------NKRDINLEN----EIAVLRRIKHENVVGLEDFYESRSHYYLVMQLVSGGELFDRILDRGMYSEMDASLVIRQVLEAVSYLHINGIVHRDLKPENLLYYSQDENSKIMISDFGLSKMEDNDIMSTACGTPGYVAPEVLA----QKPYSKAVDCWSIGVITYILLCGYPPFYEET--ETRLFSKIMKAQYEFDSPFWDNISESAKDFIRNMMQKNPKLRFTTDQALRHPWIIGKTARSQDIYHSVSV---QIQKNFAKSKWKQAFNATVAIHHMKKLQ----------LAHC 340          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003135.1 (pep scaffold:Pmarinus_7.0:GL491838:799:5626:1 gene:ENSPMAG00000002863.1 transcript:ENSPMAT00000003135.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 194.897 bits (494), Expect = 1.276e-60
Identity = 108/273 (39.56%), Postives = 161/273 (58.97%), Query Frame = 3
Query:  135 KGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLA----EGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSR--EASEFMMTNCGTLDY---SAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLW 926
            +G F EV+   +      VAIK + KT        + + +D  ++     E  V+  + H NII L ++ E  + +++IM L      GG+LFDRI+    + ERDA+ L+ Q+L AV H+H  G VHRDLKPEN+L+ S + DS I+++DFGLS+       M T CGT  Y    APE+L     +K Y   VD WSIGV++YILLCG+ PFY     D+ +  +I++ +Y+F SP WD IS +AKDF+ +L++    +R T ++A++H W
Sbjct:    1 RGAFSEVVLAEERSTGRHVAIKCIAKT--------ALRGKDNTVEN----EVCVLSRIKHENIIALEDIYETDSHLYLIMQLVLLLIRGGELFDRIVERGFYTERDASALIRQVLRAVSHLHGQGVVHRDLKPENLLYYSAEDDSKIMISDFGLSKVEAPGSVMSTACGTPGYVACEAPEVLA----QKPYTRAVDCWSIGVISYILLCGYPPFYDEV--DSRLFDQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDVAERFTCEQALQHPW 255          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008748.1 (pep scaffold:Pmarinus_7.0:GL476577:591:63029:-1 gene:ENSPMAG00000007907.1 transcript:ENSPMAT00000008748.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 191.045 bits (484), Expect = 9.662e-58
Identity = 101/276 (36.59%), Postives = 161/276 (58.33%), Query Frame = 3
Query:  111 YKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSREA---SEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWL 929
            Y++ EELGKG F  V +             +V   + F +K  + ++   +  + + REAR+ + L H NI++L E I ++   +++ DL  GG+LF+ I++ + ++E DA+  ++QIL +V H HQ G VHRDLKPEN+L  S+ K +++ L DFGL+ E     +      GT  Y +PE+L  R+D   YG  VD+W+ GV+ YILL G+ PF+    D  ++  +I  G Y F SP WDT++  AK+ +  +L + P  R+T  +A+KH W+
Sbjct:   14 YQLYEELGKGAFSVVRR-----------CVKVSTGQEFAAKIINTKKLSARDHQKLEREARICRLLKHSNIVRLHESIAEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVHHCHQHGIVHRDLKPENLLLASKMKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVL--RKD--PYGKPVDMWACGVILYILLVGYPPFWD--EDQHKLYQQIKAGAYDFPSPEWDTVTAEAKNLINQMLTINPAKRITAAEALKHPWI 272          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010548.1 (pep scaffold:Pmarinus_7.0:GL477749:266235:284843:-1 gene:ENSPMAG00000009555.1 transcript:ENSPMAT00000010548.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 187.578 bits (475), Expect = 5.726e-54
Identity = 112/316 (35.44%), Postives = 170/316 (53.80%), Query Frame = 3
Query:   57 LQMSKSETKRKSFPE-----------NSRYKIIEELGKGGFCEVLKGRDVKN--------DFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILF-KSRDKDSSILLTDFGLSREASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTIS---HTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKE 935
            L+   ++ K K FP             SRY+I   +G G F  V + R V +        ++ +A+K +DK K           R++ ++  +    R+ Q   H N+++L+E +E  ++ +++++   GGDLFD I    RF ER AA ++  +  A+Q++H    VHRD+KPEN+L  ++ D  +++ L D GL+ E +  + T CGT  Y APE+L       GYG EVD+W+ GV+ YILLCGF PF S  RD  E+   I  G+Y+F SP WD IS     AKD V+ LL V    R T  +A+ H W+ +
Sbjct:  334 LKDGDADKKSKKFPNLPMPIVSLQDIESRYEIGRTIGDGNFATVKECRRVSSGDGSAGEAEWDLAMKIIDKAKLV--------GREEMLRSEVALTTRLGQ---HPNVVRLVEAMESPSDAYLVLERVRGGDLFDAITESVRFTERHAAAMVADLCRALQYLHANNIVHRDVKPENLLVQRNADGGTTLKLADLGLAMEVTGPIYTVCGTPTYVAPEILAE----TGYGLEVDMWAAGVITYILLCGFPPFRSLERDQEELFEIIQLGEYEFLSPYWDHISDGHEAAKDLVSRLLVVDTARRYTARQALHHPWVSD 634          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006410.1 (pep scaffold:Pmarinus_7.0:GL476370:17405:31068:-1 gene:ENSPMAG00000005688.1 transcript:ENSPMAT00000006410.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 176.022 bits (445), Expect = 1.208e-49
Identity = 103/284 (36.27%), Postives = 162/284 (57.04%), Query Frame = 3
Query:   93 FPENSRYKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSREASEFMMTN-----CGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWL 929
             P    Y++++ +GKG F +V   R +     VAIK +DKT+       +P    K     + RE R+M+ LNH NI+KL EVIE +  ++++M+ A GG++FD +++  R  E++A     QI+SAVQ+ HQ   VHRDLK EN+L    D D  I + DFG S   +EF + N     CG+  Y+APEL    + +K  GPEVD+WS+GV+ Y L+ G  PF    ++  E+R K++RG Y+   P +  +S   ++ +   L + P  R +L++ ++  W+
Sbjct:   33 LPHIGNYRLLKTIGKGNFAKVKLARHILTGREVAIKIIDKTQ------LNPTSLQK-----LFREVRIMKCLNHPNIVKLYEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKNIVHRDLKAENLLL---DVDMHIKIADFGFS---NEFTLVNKLDTFCGSPPYAAPELF---QGKKYDGPEVDVWSLGVILYTLVSGSLPF--DGQNLKELREKVLRGKYRI--PFY--MSTDCENLLKRFLVLNPIKRGSLEQIMRDRWM 290          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006316.1 (pep scaffold:Pmarinus_7.0:GL479319:16843:32374:1 gene:ENSPMAG00000005682.1 transcript:ENSPMAT00000006316.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 168.318 bits (425), Expect = 1.212e-49
Identity = 87/228 (38.16%), Postives = 134/228 (58.77%), Query Frame = 3
Query:  318 NIIKLIEVIED----KNEVFIIMDLAEGGDLFDRIISM--KRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSREASEF--MMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYST--TRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVS 971
            +I++++EV E+    K  + I+M+  EGG+LF+RI     + F ER+A++++  I  A++H+H     HRD+KPEN+L+ SR  D  + LTDFG ++E   F  + T C T  Y APE+L      + Y    D+WS+GV+ YILLCGF PFYS         ++ +I  G Y+F SP W  +S  AK  +  LLK  P +RMT+ + + H W+ + +  P+ P + S
Sbjct:   27 HIVRIVEVYENIHQSKKCLLIVMECMEGGELFNRIQDRGDQAFTEREASEIMRDIGRAIEHLHSINIAHRDVKPENLLYTSRRSDPVLKLTDFGFAKETLSFNSLATPCYTPYYVAPEVL----GPEKYDKSCDMWSLGVIMYILLCGFPPFYSNHGLAISPGMKKRIRLGQYEFPSPEWTAVSEEAKQVIRKLLKTDPTERMTIAEFMNHPWINQLMEVPQTPLHTS 250          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Yeast
Match: CMK2 (Calmodulin-dependent protein kinase; may play a role in stress response, many CA++/calmodulan dependent phosphorylation substrates demonstrated in vitro, amino acid sequence similar to mammalian Cam Kinase II; CMK2 has a paralog, CMK1, that arose from the whole genome duplication [Source:SGD;Acc:S000005376])

HSP 1 Score: 176.792 bits (447), Expect = 1.113e-51
Identity = 98/292 (33.56%), Postives = 161/292 (55.14%), Query Frame = 3
Query:   63 MSKSETKRKSFPENSRYKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSRE---ASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWL 929
            ++K   + +S+   + Y     LG G F  V + R +  +  VAIK + K         + Q  + ++ +M+  E  ++Q L+H NI+   +  E K++ +I+  LA GG+LFDRI+S  +F E DA +++ QIL AV++MH    VHRDLKPEN+L+  + ++S +++ DFG++++     + +    G+L Y APE+L     + G+G   DIWSIGV+ Y LLCG++PF + + +         R    F  P WD IS   K F+   L++ P DR T  + +   W+
Sbjct:   31 INKLSGQPESYVNRTNYIFGRTLGAGSFGVVRQARKLSTNEDVAIKILLK--------KALQGNNVQL-QMLYEELSILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIIVQILGAVEYMHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGEEDLIYKAAGSLGYVAPEVLT----QDGHGKPCDIWSIGVITYTLLCGYSPFIAESVEGFMEECTASRYPVTFHMPYWDNISIDVKRFILKALRLNPADRPTATELLDDPWI 309          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Yeast
Match: CMK1 (Calmodulin-dependent protein kinase; may play a role in stress response, many Ca++/calmodulin dependent phosphorylation substrates demonstrated in vitro, amino acid sequence similar to mammalian Cam Kinase II; CMK1 has a paralog, CMK2, that arose from the whole genome duplication [Source:SGD;Acc:S000001910])

HSP 1 Score: 170.629 bits (431), Expect = 2.471e-49
Identity = 97/285 (34.04%), Postives = 155/285 (54.39%), Query Frame = 3
Query:   90 SFPENSRYKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLS---REASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDY--KFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWL 929
            S+    +Y   + LG G F  V + ++ +    VA+K + K     +K              +  E  ++Q L+H NI+   +  E K++ +II  LA+GG+LFDRI+   +F E DA ++L +ILSAV++MH    VHRDLKPEN+L+  +  +S +++ DFG++   +   E +    G+L Y APE+L     + G+G   DIWSIGV+ Y LLCG++ F +    D     +   G+Y  KF  P WD++S+ AK F+   L + P  R T  + ++  W+
Sbjct:   30 SYVNKKKYVFGKTLGAGTFGVVRQAKNTETGEDVAVKILIKKALKGNKVQL---------EALYDELDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEEDAVRILVEILSAVKYMHSQNIVHRDLKPENLLYIDKSDESPLVVADFGIAKRLKSDEELLYKPAGSLGYVAPEVLT----QDGHGKPCDIWSIGVITYTLLCGYSAFRAERVQD--FLDECTTGEYPVKFHRPYWDSVSNKAKQFILKALNLDPSKRPTAAELLEDPWI 299          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Yeast
Match: RCK1 (Protein kinase involved in oxidative stress response; promotes pseudohyphal growth via activation of Ubp3p phosphorylation; identified as suppressor of S. pombe cell cycle checkpoint mutations; RCK1 has a paralog, RCK2, that arose from the whole genome duplication [Source:SGD;Acc:S000003126])

HSP 1 Score: 169.474 bits (428), Expect = 2.128e-48
Identity = 116/364 (31.87%), Postives = 187/364 (51.37%), Query Frame = 3
Query:   24 NLKKKEFY--LFHLQMSKSETKRKS---------FPEN---SRYKIIEELGKGGFCEVLKGRDVKND--FFVAIKRVDKTKPFFSKASSPQERDK---KIKRMMLREARV--MQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFK-----SRDKD----------------SSILLTDFGLSREA-SEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLK--EQLPRPENPHYVSVES 980
            N ++ E++  +F  ++   ET  KS         +PE      YK++ ++G+G F  V K   +  D    VAIK +   K   S  +  +  D+     ++ +L E  +  + S N+ +  K I   E  N  +++ +L  GG++FDRI+ +  F+E  A  ++ Q+  A++HMH  G VHRD+KPEN+LF+       D D                  + L DFGL+++  +    T CGT++Y A E+  ++R    Y  +VD+WSIG + + LLCG+ PFY   +++  +  KI RGDY+F +P WD IS  AK+ VT+LL+V P  R  +D  +   WL   + L    +  Y SV+S
Sbjct:   78 NSQEDEYFCDIFSTELKLDETSNKSTDYSSSNHQYPEQLELHNYKLLNKIGEGAFSRVFKAVGINTDDQAPVAIKAI--IKKGISSDAILKGNDRIQGSSRKKVLNEVAIHKLVSKNNPHCTKFIAFQESANYYYLVTELVTGGEIFDRIVQLTCFSEDLARHVITQVAIAIKHMHYMGIVHRDVKPENLLFEPIPFYGLDGDMQKEDEFTLGVGGGGIGLVKLMDFGLAKKLRNNTAKTPCGTIEYVASEVFTSKR----YSMKVDMWSIGCVLFTLLCGYPPFYE--KNEKTLLKKISRGDYEFLAPWWDNISSGAKNAVTHLLEVDPNKRYDIDDFLNDPWLNSYDCLKDSNSNSYASVQS 433          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Yeast
Match: RAD53 (DNA damage response protein kinase; required for cell-cycle arrest, regulation of copper genes in response to DNA damage; phosphorylates nuclear pores to counteract gene gating, preventing aberrant transitions at forks approaching transcribed genes; activates downstream kinase Dun1p; differentially senses mtDNA depletion, mitochondrial ROS; relocalizes to cytosol under hypoxia; human homolog CHEK2 implicated in breast cancer can complement yeast null mutant [Source:SGD;Acc:S000006074])

HSP 1 Score: 159.073 bits (401), Expect = 1.904e-43
Identity = 98/287 (34.15%), Postives = 150/287 (52.26%), Query Frame = 3
Query:  111 YKIIEEL-GKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSR--EASEFMMTNCGTLDYSAPELLLNR---------RDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWD-TISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLK 932
            + II+E+ G+G F  V K  +       A+K + K K   +               + RE  V+Q LNH  I++L    ED    +++M+   GGDL D + +     E    ++  QIL+A++++H  G  HRDLKP+NIL + +D    + +TDFGL++      FM T CGTL Y APE++  +          +R  Y   VD+WS+G + Y++L G  PF  +T+D  ++  +I RG Y    P  D  IS  A+DF+  LL+V P +R T  KA+ H W+K
Sbjct:  197 FSIIDEVVGQGAFATVKKAIERTTGKTFAVKIISKRKVIGNMDG------------VTRELEVLQKLNHPRIVRLKGFYEDTESYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQILTAIKYIHSMGISHRDLKPDNILIE-QDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPEVIRGKDTSVSPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPFSGSTQD--QLYKQIGRGSY-HEGPLKDFRISEEARDFIDSLLQVDPNNRSTAAKALNHPWIK 467          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Yeast
Match: DUN1 (Cell-cycle checkpoint S/T protein kinase; required for transient G2/M arrest after DNA damage, damage-induced transcription, and nuclear-to-cytoplasmic redistribution of Rnr2p-Rnr4p after genotoxic stress and iron deprivation; phosphorylates repair protein Rad55p, transcriptional repressor Sml1p, superoxide dismutase, and ribonucleotide reductase inhibitors Crt1p and Dif1p; functions in the Mec1p pathway to regulate dNTP pools and telomere length; postreplicative repair role [Source:SGD;Acc:S000002259])

HSP 1 Score: 155.221 bits (391), Expect = 4.266e-43
Identity = 87/299 (29.10%), Postives = 159/299 (53.18%), Query Frame = 3
Query:  108 RYKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIE-----VIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFK--SRDKDSSILL--------------TDFGLSREASEFMMTN--CGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKE 935
            +Y + +ELG G +  V + ++ K    VA+K       F ++ +  Q+++K+ +     E  ++  + H NI+ L++     + + + + +++++  + G+LF+RI+      + ++  L +Q+L+ ++++H+   +HRD+KPENIL     R+  S + L               DFGL++   E   TN  CGT  Y APE+L     +KGY  +VD+WS GV+ Y+ LCGF PF S       ++ +I++  Y F SP WD I  +    ++ LL + P +R  +D+A+ H W  +
Sbjct:  199 KYLLGKELGAGHYALVKEAKNKKTGQQVAVK------IFHAQQNDDQKKNKQFRE----ETNILMRVQHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLRQDESKALFKQLLTGLKYLHEQNIIHRDIKPENILLNITRRENPSQVQLGPWDEDEIDIQVKIADFGLAKFTGEMQFTNTLCGTPSYVAPEVLT----KKGYTSKVDLWSAGVILYVCLCGFPPF-SDQLGPPSLKEQILQAKYAFYSPYWDKIDDSVLHLISNLLVLNPDERYNIDEALNHPWFND 482          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Nematostella
Match: EDO36253 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ85])

HSP 1 Score: 222.246 bits (565), Expect = 3.185e-70
Identity = 119/306 (38.89%), Postives = 185/306 (60.46%), Query Frame = 3
Query:  108 RYKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSREASE--FMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWR 1019
            +Y + E LG G F EV+   +       A+K + K K    K  S +            E  +++ + H NII L ++ ++K+ ++++MDL +GG+LFDRI+    + E+DA+ L++QIL A  ++H  G VHRDLKPEN+L+ S D+DS I+++DFGLS+  ++  FM T CGT  Y APE+L     ++ YG  VD WSIGV+ YILLCG+ PFY  +  D  + ++I+R +Y+F SP WD IS +AKDF+ +L+++ P  R T  +A+ H W+        + H  SV SE+I  +  + +W+
Sbjct:   16 KYDLREVLGTGAFSEVVLAEEKATGSLFAVKCISK-KELKGKEESVE-----------NEIAILKKVRHKNIIGLKDIFDNKSHLYLVMDLVQGGELFDRIVEKGNYTEQDASALVQQILEAADYLHSLGIVHRDLKPENLLYYSPDEDSKIMISDFGLSKIEAQGSFMDTACGTPGYVAPEVL----KQQPYGKAVDCWSIGVITYILLCGYPPFYDDS--DANLFAQIMRAEYEFDSPYWDEISESAKDFIRHLMELDPKLRYTCRQALSHPWICGGEALTRDIH-ASV-SEQIKKNFYKQKWK 301          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Nematostella
Match: EDO42276 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1X1])

HSP 1 Score: 199.134 bits (505), Expect = 4.202e-61
Identity = 118/317 (37.22%), Postives = 179/317 (56.47%), Query Frame = 3
Query:   96 PENSRYKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSREASEFMMTN--CGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWRCLGLMAT 1040
            P    Y I +ELG+G    V   R    +   A+K + KT             DKKI   +  E  ++  +NH NII + E+ E    +F++++L  GG+LFDR++    + E+DAA  ++ IL AV H+H+   VHRDLKPEN+L+ +  +DS + + DFGLS+   + +MT+  CGT  Y APE+L      + Y   VD+W+IGV+AYILLCGF PFY  T  D ++  +I++ DY F SP WD +S  AKD V  L+      R+T  +A+ H W+K +  R E+      + +E +++  +L+   LG+MA 
Sbjct:   13 PIEDFYDIGKELGRGASSVVKLCRQKGTNKEFAVKIMKKT------------VDKKI---IQTETGILFRINHPNIIHMKELFETHTHLFMVLELVTGGELFDRVVEKGYYCEKDAADAIKMILEAVGHLHKNDIVHRDLKPENLLYANEREDSPLKIADFGLSKILPQEVMTSTVCGTPGYCAPEVLKG----ESYDTGVDMWAIGVIAYILLCGFEPFYDET--DQQMFQRILKCDYDFVSPWWDDVSSGAKDLVKRLITGDKNKRLTAKQALDHPWVKGENARREDMERTRKKLKE-FNAKRKLKGGMLGVMAA 307          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Nematostella
Match: EDO42432 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1C2])

HSP 1 Score: 191.43 bits (485), Expect = 2.415e-56
Identity = 105/273 (38.46%), Postives = 154/273 (56.41%), Query Frame = 3
Query:  111 YKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSR-DKDSSILLTDFGLSREASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLW 926
            Y   ++LG G F  V + +D       AIK +DK K           R K+  +M+  E  +M+   H NI++L E  +   E++++M+L +GGDLFD I S  +F E  A      +  A+ ++H+   VHRDLKPEN+L   R D  + + L DFGL+ E +  + T CGT  Y APE+L    +  GYG +VD+W+ GV+ YI+LCGF PF S  RD  E+   I  G+++F SP WD +S  AKD ++ +L V P  R T D+ ++H W
Sbjct:  246 YNFGQKLGDGNFAIVRQCKDKITQKEFAIKIIDKRK----------IRGKE--KMIDDEIAIMRRCRHPNIVRLFEDYDSATEIYLVMELIKGGDLFDAISSSVKFTEHVAKSYFRDMCKALAYLHKRKIVHRDLKPENLLVHKRSDGQTHLKLADFGLAMEVTAPIFTVCGTPTYVAPEIL----EENGYGLKVDMWAAGVITYIMLCGFPPFRSPNRDQDELFDLIQSGEFEFLSPYWDPVSDDAKDLISTMLVVDPTKRATADQVLQHRW 502          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Nematostella
Match: EDO44613 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVB0])

HSP 1 Score: 191.43 bits (485), Expect = 3.351e-56
Identity = 110/313 (35.14%), Postives = 173/313 (55.27%), Query Frame = 3
Query:   12 DFGFNLKKKEFYLFHLQMSKSETKRKSFPENSR--YKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSREASE--FMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQ 938
            +   ++ K + Y+F  ++ KS+ +  + PE+ R  Y + + LG+G F EV            A+K + K +   S  S    +D         E  ++++LNH  II++ +V E  + ++I+++L EGG+LFDR++S+KRF E  A  L  Q++ AV+++H  G  HRDLKPENIL  S   ++ + +TDFG+S+   E   M T CGT  Y APE +L      GY   VD WS+G M YI L G+APF S   +  ++   I+ G Y F    W  +S  A D +  LL V P  R+T+ + ++H W+K++
Sbjct:  159 EISLSVTKNKAYIFQ-ELGKSQEEVANIPEDFRKKYTLSKLLGRGAFGEVRLAFTKGTCHKFAVKLISKRQFSVSPVSHASIKD---------EVNILKALNHPCIIEIADVFESPDMLYIVLELVEGGELFDRVVSVKRFEESVAKLLFYQMVVAVEYLHSKGITHRDLKPENILLCSDKNETLLKITDFGVSKMVGEQSLMKTLCGTPSYLAPE-VLRSAGLGGYSKAVDCWSLGCMLYICLGGYAPF-SDEVEPYDVNKLILAGKYTFPKQHWKCVSDEAIDLIKKLLTVDPSKRLTIQQVLEHPWIKDE 459          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Nematostella
Match: EDO46647 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPA2])

HSP 1 Score: 182.956 bits (463), Expect = 1.168e-54
Identity = 108/307 (35.18%), Postives = 174/307 (56.68%), Query Frame = 3
Query:   57 LQMSKSETKRKSFPENSR---YKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSREAS-----------EFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKE 935
            + +S+ E KR  F +  R   Y + + +G+G F +V +G  V     VA+K +DK +            D+ + + M REAR++Q + H +II L+EV+E +N  +++ +LA GGDL D I   KR  E +  K + QI+SAVQ++HQ G +HRDLK EN+L    D++ +I + DFGLS   S           ++  T CG+  Y+APE+L      + YG +VD+WSIGV  Y +L G  P+ +   +   + +K++RG+    +   D +S + +D +   L   P +R++LD+AI H+WLK+
Sbjct:    6 VHVSREELKR--FLKCKRVGNYLLGKTIGEGSFAKVKQGFHVLTGEKVAVKIIDKKQAL---------EDRYVSKNMRREARILQMVRHPHIISLLEVVETENRYYLVFELAGGGDLMDYICYRKRLGETEVRKFIRQIISAVQYLHQGGIIHRDLKVENLLL---DEEYNIRIIDFGLSNTVSVAKPGDLSPIKDYCKTQCGSPAYAAPEIL----GHQLYGTKVDVWSIGVNMYAMLTGKLPYTAEPFNIVTLYNKMVRGE---MNAVPDRLSPSCRDLLMRFLTFDPDERISLDEAINHVWLKK 291          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Medaka
Match: camk1b (calcium/calmodulin-dependent protein kinase type 1 [Source:NCBI gene;Acc:101170017])

HSP 1 Score: 226.483 bits (576), Expect = 1.266e-70
Identity = 126/326 (38.65%), Postives = 191/326 (58.59%), Query Frame = 3
Query:   81 KRKSFPENSRYKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSR--EASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWRCLGLMATALKR 1052
            K+++     +Y   E LG G F EV+   + +    VAIK + K K    K +S           +  E  V+  + H NI+ L ++ E K+ +++IM L  GG+LFDRII    + E+DA+KL++QIL AV+++H  G VHRDLKPEN+L+ S D+DS I+++DFGLS+   +   M T CGT  Y APE+L     +K Y   VD WSIGV++YILLCG+ PFY    +D ++  +I++ +Y+F SP WD IS +AKDF+ +L++     R T D+A+ H W+       +N H     S +I  + ++ +W+     ATA+ R
Sbjct:   11 KKRTTDVKEQYDFKEILGTGAFSEVVLAEEKRTHKLVAIKCIPK-KALEGKENS-----------IENEIAVLHKIKHPNIVSLEDIFESKSHLYLIMQLVSGGELFDRIIEKGFYTEKDASKLIQQILDAVKYLHDMGIVHRDLKPENLLYYSMDEDSKIMISDFGLSKIEGSGSVMSTACGTPGYVAPEVLA----QKPYSKAVDCWSIGVISYILLCGYPPFYD--ENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIVHLMEKDSNTRYTCDQALLHPWIAGDTALDKNIH--ESVSAQIKKNFAKSKWK-QAFNATAVIR 315          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Medaka
Match: camk1b (calcium/calmodulin-dependent protein kinase type 1 [Source:NCBI gene;Acc:101170017])

HSP 1 Score: 227.254 bits (578), Expect = 1.325e-70
Identity = 126/326 (38.65%), Postives = 191/326 (58.59%), Query Frame = 3
Query:   81 KRKSFPENSRYKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSR--EASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWRCLGLMATALKR 1052
            K+++     +Y   E LG G F EV+   + +    VAIK + K K    K +S           +  E  V+  + H NI+ L ++ E K+ +++IM L  GG+LFDRII    + E+DA+KL++QIL AV+++H  G VHRDLKPEN+L+ S D+DS I+++DFGLS+   +   M T CGT  Y APE+L     +K Y   VD WSIGV++YILLCG+ PFY    +D ++  +I++ +Y+F SP WD IS +AKDF+ +L++     R T D+A+ H W+       +N H     S +I  + ++ +W+     ATA+ R
Sbjct:   29 KKRTTDVKEQYDFKEILGTGAFSEVVLAEEKRTHKLVAIKCIPK-KALEGKENS-----------IENEIAVLHKIKHPNIVSLEDIFESKSHLYLIMQLVSGGELFDRIIEKGFYTEKDASKLIQQILDAVKYLHDMGIVHRDLKPENLLYYSMDEDSKIMISDFGLSKIEGSGSVMSTACGTPGYVAPEVLA----QKPYSKAVDCWSIGVISYILLCGYPPFYD--ENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIVHLMEKDSNTRYTCDQALLHPWIAGDTALDKNIH--ESVSAQIKKNFAKSKWK-QAFNATAVIR 333          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Medaka
Match: camk1b (calcium/calmodulin-dependent protein kinase type 1 [Source:NCBI gene;Acc:101170017])

HSP 1 Score: 226.868 bits (577), Expect = 1.495e-70
Identity = 126/326 (38.65%), Postives = 191/326 (58.59%), Query Frame = 3
Query:   81 KRKSFPENSRYKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSR--EASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWRCLGLMATALKR 1052
            K+++     +Y   E LG G F EV+   + +    VAIK + K K    K +S           +  E  V+  + H NI+ L ++ E K+ +++IM L  GG+LFDRII    + E+DA+KL++QIL AV+++H  G VHRDLKPEN+L+ S D+DS I+++DFGLS+   +   M T CGT  Y APE+L     +K Y   VD WSIGV++YILLCG+ PFY    +D ++  +I++ +Y+F SP WD IS +AKDF+ +L++     R T D+A+ H W+       +N H     S +I  + ++ +W+     ATA+ R
Sbjct:   24 KKRTTDVKEQYDFKEILGTGAFSEVVLAEEKRTHKLVAIKCIPK-KALEGKENS-----------IENEIAVLHKIKHPNIVSLEDIFESKSHLYLIMQLVSGGELFDRIIEKGFYTEKDASKLIQQILDAVKYLHDMGIVHRDLKPENLLYYSMDEDSKIMISDFGLSKIEGSGSVMSTACGTPGYVAPEVLA----QKPYSKAVDCWSIGVISYILLCGYPPFYD--ENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIVHLMEKDSNTRYTCDQALLHPWIAGDTALDKNIH--ESVSAQIKKNFAKSKWK-QAFNATAVIR 328          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Medaka
Match: camk1gb (calcium/calmodulin-dependent protein kinase type 1D [Source:NCBI gene;Acc:101164726])

HSP 1 Score: 227.639 bits (579), Expect = 2.017e-70
Identity = 123/321 (38.32%), Postives = 195/321 (60.75%), Query Frame = 3
Query:  111 YKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSREA-SEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWRCLGLMATALKRMSQINV 1070
            + ++EELG G F EV   R+ K     A+K + K K          +RD  ++     E  V++ + H N++ L ++ E +   ++IM L  GG+LFDRI+    + E+DA+++++Q+L AV ++HQ G VHRDLKPENIL+ S+D+DS I+++DFGLS+   +  M T CGT  Y APE+L     +K Y   VD WSIGV+ YILLCG+ PFY  +  +T++ SKI++  Y+F SP WD IS +AKDF+  +++  P  R + ++A++H W+  +  R  N  Y SV S +I  + ++ +W+     A A+  M ++ +
Sbjct:   21 FDLMEELGSGAFSEVFMVRERKTGKKFAMKCIKKKK----------KRDINLEN----EMAVLRRIKHENVVGLEDIYESRTHYYLIMQLVSGGELFDRILDRGMYTEKDASRVIQQVLQAVSYLHQNGIVHRDLKPENILYYSQDEDSKIMISDFGLSKMTDTGIMSTACGTPGYVAPEVLA----QKPYSKAVDCWSIGVITYILLCGYPPFYEES--ETKLFSKIMKAQYEFDSPFWDDISESAKDFIRNMMQKTPSMRYSTEQALRHPWIIGKTAR-SNDIYYSV-STQIQKNFAQTKWKQAYNAAVAINHMKKLKL 319          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Medaka
Match: camk1b (calcium/calmodulin-dependent protein kinase type 1 [Source:NCBI gene;Acc:101170017])

HSP 1 Score: 226.868 bits (577), Expect = 2.876e-70
Identity = 126/326 (38.65%), Postives = 191/326 (58.59%), Query Frame = 3
Query:   81 KRKSFPENSRYKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSR--EASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWRCLGLMATALKR 1052
            K+++     +Y   E LG G F EV+   + +    VAIK + K K    K +S +            E  V+  + H NI+ L ++ E K+ +++IM L  GG+LFDRII    + E+DA+KL++QIL AV+++H  G VHRDLKPEN+L+ S D+DS I+++DFGLS+   +   M T CGT  Y APE+L     +K Y   VD WSIGV++YILLCG+ PFY    +D ++  +I++ +Y+F SP WD IS +AKDF+ +L++     R T D+A+ H W+       +N H     S +I  + ++ +W+     ATA+ R
Sbjct:   47 KKRTTDVKEQYDFKEILGTGAFSEVVLAEEKRTHKLVAIKCIPK-KALEGKENSIE-----------NEIAVLHKIKHPNIVSLEDIFESKSHLYLIMQLVSGGELFDRIIEKGFYTEKDASKLIQQILDAVKYLHDMGIVHRDLKPENLLYYSMDEDSKIMISDFGLSKIEGSGSVMSTACGTPGYVAPEVLA----QKPYSKAVDCWSIGVISYILLCGYPPFYD--ENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIVHLMEKDSNTRYTCDQALLHPWIAGDTALDKNIH--ESVSAQIKKNFAKSKWK-QAFNATAVIR 351          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Planmine SMEST
Match: SMESG000027403.1 (SMESG000027403.1)

HSP 1 Score: 707.212 bits (1824), Expect = 0.000e+0
Identity = 342/342 (100.00%), Postives = 342/342 (100.00%), Query Frame = 3
Query:   63 MSKSETKRKSFPENSRYKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSREASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWRCLGLMATALKRMSQINVNREIEI 1088
            MSKSETKRKSFPENSRYKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSREASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWRCLGLMATALKRMSQINVNREIEI
Sbjct:    1 MSKSETKRKSFPENSRYKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSREASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWRCLGLMATALKRMSQINVNREIEI 342          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Planmine SMEST
Match: SMESG000076544.1 (SMESG000076544.1)

HSP 1 Score: 341.273 bits (874), Expect = 6.230e-116
Identity = 160/327 (48.93%), Postives = 236/327 (72.17%), Query Frame = 3
Query:   81 KRKSFPENS-RYKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSREASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPHYVSVESEEIYDSISRLRWRCLGLMATALKRMS 1058
            K+ + P  S RYK+ + LG+GGFCEV K +D     +VAIKR D++KP + K SS  E +KKIK++M +EA +M+SLNH N++K  E+I+D+  +F++++LAEGG+LF+ IIS  + +E+DA  ++EQI++AV +MH  GF+HRD+KPEN+LFKS D++S I+L DFGLSR+  ++M+T+CGT+DYSAPELL ++  +  Y  ++D WSIGV+ YILLCG+ PFYS  +DD EI+  I+ G+Y+F SP W+ IS  AK  +  LLKV   DR++LD+A+KH W+   +       Y  +E+  + ++I+R RWRCLGL A A+  +S
Sbjct:   16 KQIATPSRSDRYKMEKRLGEGGFCEVFKAKDTITGMYVAIKRTDRSKPTYQKYSSA-EVEKKIKKIMYKEAAIMKSLNHENLLKFFELIDDEVNIFLVIELAEGGELFEFIISRGKLSEKDATVIMEQIMNAVHYMHTQGFIHRDIKPENVLFKSPDENSKIVLADFGLSRQIDDYMLTSCGTMDYSAPELLKSKSTKVPYSCKIDNWSIGVVCYILLCGYPPFYSLNQDDQEIKKMILLGNYQFHSPHWNIISKAAKSLIASLLKVNASDRISLDQALKHQWI--TMGGNTKDIYPIIET-SLKETIARQRWRCLGLTANAIHSLS 338          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Planmine SMEST
Match: SMESG000026357.1 (SMESG000026357.1)

HSP 1 Score: 311.227 bits (796), Expect = 6.989e-105
Identity = 142/274 (51.82%), Postives = 209/274 (76.28%), Query Frame = 3
Query:   99 ENSRYKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSREASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKH 920
            E+ RY I  ++G+GGFCEVL+  D+  +  VAIKR+D++KP + K S+ +  DK IKR+M REA +MQ+L+H NIIK  ++I+D  +++I+M LAEGG+L+DRI+  ++F E +A  +L+QI+  V++MH+ G+VHRD+KPEN+LF++ + DS +++TDFGLSRE +E MMTNCGT+DYSAPELL NR ++ GY  +VD WSIGV+AYILLCG+ PFYS  +D  EI+ +I+ G Y F  P W+T+S + K  ++ LLKV+P +R++LD  ++H
Sbjct:   10 ESERYSIECKIGEGGFCEVLRANDILTNKKVAIKRIDRSKPTYRKYSNLEIEDK-IKRIMYREASIMQALDHPNIIKFYDLIDDGIDLYIVMQLAEGGELYDRILKRQKFTENEAVIVLKQIICGVKYMHEHGYVHRDIKPENVLFETINDDSRLMITDFGLSREINEKMMTNCGTIDYSAPELLKNRLNKLGYNEKVDHWSIGVVAYILLCGYPPFYSMCKDVQEIKKQIMDGKYYFHKPHWNTVSRSCKRLISSLLKVKPEERISLDSCLEH 282          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Planmine SMEST
Match: SMESG000026329.1 (SMESG000026329.1)

HSP 1 Score: 302.753 bits (774), Expect = 8.196e-102
Identity = 136/268 (50.75%), Postives = 206/268 (76.87%), Query Frame = 3
Query:   66 SKSETKRKSFP--ENSRYKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSREASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVT 863
            ++ E K+++F   E+ RY I   LG GGFCEV K +D+  D +VAIKR D++K  + K ++ +E +KKIK++M REA +MQ+L+H N++K+ E+++D   ++++++LAEGG+LFDRII  K+F+ERDAA +L+Q+++ +++MH+ G+VHRD+KPEN+LFK+  ++S +++TDFGLSRE S+ MMTNCGT+DYSAPELL ++  + GYG +VD WSIGV+AYILLCG+ PFYS  RD+ E++ +I+ G+Y F  P WD I+ T K +  
Sbjct:    9 TREERKKEAFESLESDRYTIECRLGDGGFCEVFKAKDLVADKYVAIKRTDRSKNAYKKYTA-EEVEKKIKKIMYREASIMQALDHPNLVKIYEMVDDGKNIYLVIELAEGGELFDRIIKRKKFSERDAAIVLKQMINGIKYMHEHGYVHRDIKPENVLFKTPAENSKLMITDFGLSREISDKMMTNCGTVDYSAPELLKSKLTKSGYGEKVDNWSIGVVAYILLCGYPPFYSLNRDENEVKRQIMGGNYHFHRPHWDFITKTGKKYCV 275          
BLAST of Calcium:calmodulin dependent protein kinase type vs. Planmine SMEST
Match: SMESG000012141.1 (SMESG000012141.1)

HSP 1 Score: 266.929 bits (681), Expect = 2.617e-87
Identity = 122/276 (44.20%), Postives = 184/276 (66.67%), Query Frame = 3
Query:  102 NSRYKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDKTKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEVFIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRDLKPENILFKSRDKDSSILLTDFGLSREASEFMMTNCGTLDYSAPELLLNRRDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKFSSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWL 929
            N RYKI+  LG GGF +V K +D+K+  +VA+K++D +K  F    S + ++K +K+++ +EA ++Q LNH+NIIK +    DK + +++++ A GG+LFD I S    +E DAA +L Q+L AV+++H  GF+HRD+K EN+L ++ +  S + L DFG+SR   + + TNCGTLDYSAPEL+ N+    GY   VD WS+GV  YI+LCG+ PFYS T +  E++ +I+  DYKF SP WD IS  AK F++  L+  P +RM++   I   W+
Sbjct:   19 NYRYKILSVLGIGGFSKVFKAKDLKSHIYVAVKKMDFSKKVFRGTQSVKLKNK-MKKIIEKEAHILQCLNHINIIKFLNYYADKEDAYLVLEYAAGGELFDIIASKGSLSEHDAAFILIQLLRAVEYLHTNGFIHRDIKLENLLLETHNIKSVLKLCDFGISRGMKDILFTNCGTLDYSAPELIKNKDYLSGYNKMVDNWSVGVSGYIMLCGYCPFYSETGNQNEVKKQILECDYKFHSPKWDNISKQAKTFISGFLEFDPRNRMSITSGINSEWI 293          
The following BLAST results are available for this feature:
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PNCK1.807e-7138.44pregnancy up-regulated nonubiquitous CaM kinase [S... [more]
PNCK1.807e-7138.44pregnancy up-regulated nonubiquitous CaM kinase [S... [more]
PNCK4.211e-7138.44pregnancy up-regulated nonubiquitous CaM kinase [S... [more]
PNCK1.582e-7038.44pregnancy up-regulated nonubiquitous CaM kinase [S... [more]
CAMK11.219e-6939.24calcium/calmodulin dependent protein kinase I [Sou... [more]
back to top
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cmk-15.902e-7238.18Calcium/calmodulin-dependent protein kinase type 1... [more]
unc-433.331e-5235.74Calcium/calmodulin-dependent protein kinase type I... [more]
unc-433.331e-5235.74Calcium/calmodulin-dependent protein kinase type I... [more]
unc-433.331e-5235.74Calcium/calmodulin-dependent protein kinase type I... [more]
unc-433.476e-5235.74Calcium/calmodulin-dependent protein kinase type I... [more]
back to top
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CaMKI7.614e-7939.77gene:FBgn0016126 transcript:FBtr0333670[more]
CaMKI8.528e-7738.76gene:FBgn0016126 transcript:FBtr0089067[more]
CaMKI8.528e-7738.76gene:FBgn0016126 transcript:FBtr0089065[more]
CaMKI8.528e-7738.76gene:FBgn0016126 transcript:FBtr0089069[more]
CaMKI2.815e-6543.83gene:FBgn0016126 transcript:FBtr0089063[more]
back to top
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
camk1b8.955e-7238.34calcium/calmodulin-dependent protein kinase Ib [So... [more]
camk1a2.018e-7136.50calcium/calmodulin-dependent protein kinase Ia [So... [more]
camk1a5.818e-7136.50calcium/calmodulin-dependent protein kinase Ia [So... [more]
camk1a5.818e-7136.50calcium/calmodulin-dependent protein kinase Ia [So... [more]
pnck2.816e-6938.31pregnancy up-regulated nonubiquitous CaM kinase [S... [more]
back to top
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
exosc48.540e-7538.76exosome component 4 [Source:Xenbase;Acc:XB-GENE-96... [more]
dnz11.965e-7340.19DNZDHHC/NEW1 zinc finger protein 11 [Source:Xenbas... [more]
dnz12.104e-7340.19DNZDHHC/NEW1 zinc finger protein 11 [Source:Xenbas... [more]
dnz12.777e-7340.19DNZDHHC/NEW1 zinc finger protein 11 [Source:Xenbas... [more]
dnz13.004e-7340.19DNZDHHC/NEW1 zinc finger protein 11 [Source:Xenbas... [more]
back to top
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pnck3.030e-7238.44pregnancy upregulated non-ubiquitously expressed C... [more]
Pnck3.030e-7238.44pregnancy upregulated non-ubiquitously expressed C... [more]
Pnck3.030e-7238.44pregnancy upregulated non-ubiquitously expressed C... [more]
Camk12.583e-7039.87calcium/calmodulin-dependent protein kinase I [Sou... [more]
Camk1d1.083e-6837.97calcium/calmodulin-dependent protein kinase ID [So... [more]
back to top
BLAST of Calcium:calmodulin dependent protein kinase type vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|W0LYS5|CAMKI_MACNP1.035e-7541.46Calcium/calmodulin-dependent protein kinase type 1... [more]
sp|O70150|KCC1B_RAT1.423e-7138.44Calcium/calmodulin-dependent protein kinase type 1... [more]
sp|Q9QYK9|KCC1B_MOUSE2.119e-7138.44Calcium/calmodulin-dependent protein kinase type 1... [more]
sp|Q9TXJ0|CMK1_CAEEL7.508e-7138.18Calcium/calmodulin-dependent protein kinase type 1... [more]
sp|Q6P2M8|KCC1B_HUMAN8.679e-7138.44Calcium/calmodulin-dependent protein kinase type 1... [more]
back to top
BLAST of Calcium:calmodulin dependent protein kinase type vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3WJ961.795e-12453.59Protein kinase domain-containing protein OS=Hydati... [more]
A0A068YE869.942e-12453.89Calcium:calmodulin dependent protein kinase type O... [more]
U6IVQ11.538e-12353.89Calcium/calmodulin-dependent protein kinase type 1... [more]
A0A0R3VSI02.227e-12353.59Protein kinase domain-containing protein OS=Taenia... [more]
A0A0R3UGS02.566e-12352.69Protein kinase domain-containing protein OS=Mesoce... [more]
back to top
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pnck7.005e-6937.22calcium/calmodulin-dependent protein kinase type 1... [more]
pnck7.005e-6937.22calcium/calmodulin-dependent protein kinase type 1... [more]
camk1gb4.896e-6835.49calcium/calmodulin-dependent protein kinase type 1... [more]
camk1db9.043e-6838.17calcium/calmodulin-dependent protein kinase type 1... [more]
camk1gb9.114e-6835.77calcium/calmodulin-dependent protein kinase type 1... [more]
back to top
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003135.11.276e-6039.56pep scaffold:Pmarinus_7.0:GL491838:799:5626:1 gene... [more]
ENSPMAT00000008748.19.662e-5836.59pep scaffold:Pmarinus_7.0:GL476577:591:63029:-1 ge... [more]
ENSPMAT00000010548.15.726e-5435.44pep scaffold:Pmarinus_7.0:GL477749:266235:284843:-... [more]
ENSPMAT00000006410.11.208e-4936.27pep scaffold:Pmarinus_7.0:GL476370:17405:31068:-1 ... [more]
ENSPMAT00000006316.11.212e-4938.16pep scaffold:Pmarinus_7.0:GL479319:16843:32374:1 g... [more]
back to top
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CMK21.113e-5133.56Calmodulin-dependent protein kinase; may play a ro... [more]
CMK12.471e-4934.04Calmodulin-dependent protein kinase; may play a ro... [more]
RCK12.128e-4831.87Protein kinase involved in oxidative stress respon... [more]
RAD531.904e-4334.15DNA damage response protein kinase; required for c... [more]
DUN14.266e-4329.10Cell-cycle checkpoint S/T protein kinase; required... [more]
back to top
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO362533.185e-7038.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO422764.202e-6137.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424322.415e-5638.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO446133.351e-5635.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466471.168e-5435.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Calcium:calmodulin dependent protein kinase type vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
camk1b1.266e-7038.65calcium/calmodulin-dependent protein kinase type 1... [more]
camk1b1.325e-7038.65calcium/calmodulin-dependent protein kinase type 1... [more]
camk1b1.495e-7038.65calcium/calmodulin-dependent protein kinase type 1... [more]
camk1gb2.017e-7038.32calcium/calmodulin-dependent protein kinase type 1... [more]
camk1b2.876e-7038.65calcium/calmodulin-dependent protein kinase type 1... [more]
back to top
BLAST of Calcium:calmodulin dependent protein kinase type vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000027403.10.000e+0100.00SMESG000027403.1[more]
SMESG000076544.16.230e-11648.93SMESG000076544.1[more]
SMESG000026357.16.989e-10551.82SMESG000026357.1[more]
SMESG000026329.18.196e-10250.75SMESG000026329.1[more]
SMESG000012141.12.617e-8744.20SMESG000012141.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029183 ID=SMED30029183|Name=Calcium:calmodulin dependent protein kinase type|organism=Schmidtea mediterranea sexual|type=transcript|length=1134bp
CATGATGTTATGATTTCGGATTTAATTTGAAGAAAAAGGAATTTTATTTG
TTTCATTTACAAATGTCAAAATCGGAAACTAAGCGAAAATCATTTCCGGA
AAATTCTCGATACAAAATAATTGAAGAGCTTGGCAAAGGAGGATTTTGTG
AAGTATTGAAAGGTAGAGATGTAAAAAATGATTTTTTTGTTGCAATTAAA
AGAGTTGACAAAACGAAGCCGTTTTTCTCGAAAGCTTCGTCGCCACAAGA
GCGAGACAAGAAAATCAAACGAATGATGCTTAGAGAAGCCCGAGTTATGC
AGAGTCTCAATCATGTTAATATCATTAAACTAATTGAAGTCATCGAGGAT
AAAAATGAAGTTTTTATAATCATGGATTTGGCGGAGGGTGGCGATTTATT
CGATCGGATAATCAGCATGAAGAGATTTGCAGAGCGAGATGCGGCAAAAT
TACTTGAACAAATTCTTTCTGCTGTTCAACATATGCATCAATGTGGCTTC
GTCCATCGGGATCTTAAACCGGAAAATATATTGTTTAAATCAAGAGATAA
AGACTCGAGTATCTTATTAACAGATTTTGGATTGTCCCGAGAAGCGAGCG
AATTTATGATGACTAATTGTGGAACTTTAGATTATTCAGCTCCAGAACTT
CTCTTGAATAGACGAGACCGGAAAGGATACGGTCCAGAAGTTGATATTTG
GAGTATCGGTGTAATGGCTTATATACTCTTGTGTGGGTTTGCCCCATTTT
ATTCCACAACTCGAGACGATACAGAAATTAGATCAAAAATTATAAGAGGA
GATTATAAATTTTCAAGTCCAACTTGGGATACGATATCACATACCGCCAA
AGACTTTGTTACTTATCTACTTAAAGTTCGACCAGGTGACAGAATGACAT
TAGATAAGGCAATAAAGCATTTGTGGTTAAAAGAACAGCTTCCTCGGCCT
GAGAATCCGCATTACGTTTCTGTAGAAAGCGAAGAAATCTATGATTCGAT
TTCACGTTTGCGTTGGAGATGCCTGGGATTAATGGCTACAGCTTTAAAAA
GAATGTCACAAATTAATGTTAATAGAGAAATCGAGATCTAATATTTTCTT
GTCCATTGTTTCACTTTGCCTTGCGAAAAATAAA
back to top

protein sequence of SMED30029183-orf-1

>SMED30029183-orf-1 ID=SMED30029183-orf-1|Name=SMED30029183-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=343bp
MSKSETKRKSFPENSRYKIIEELGKGGFCEVLKGRDVKNDFFVAIKRVDK
TKPFFSKASSPQERDKKIKRMMLREARVMQSLNHVNIIKLIEVIEDKNEV
FIIMDLAEGGDLFDRIISMKRFAERDAAKLLEQILSAVQHMHQCGFVHRD
LKPENILFKSRDKDSSILLTDFGLSREASEFMMTNCGTLDYSAPELLLNR
RDRKGYGPEVDIWSIGVMAYILLCGFAPFYSTTRDDTEIRSKIIRGDYKF
SSPTWDTISHTAKDFVTYLLKVRPGDRMTLDKAIKHLWLKEQLPRPENPH
YVSVESEEIYDSISRLRWRCLGLMATALKRMSQINVNREIEI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000240body wall musculature
PLANA:0000418head
PLANA:0002056medial muscle cell
PLANA:0003001lateral region of the whole animal
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 17..289
e-value: 6.7E-93
score: 324.6
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 17..289
e-value: 8.9E-68
score: 228.5
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 17..289
score: 48.372
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 110..295
e-value: 2.8E-90
score: 305.3
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 296..335
e-value: 2.8E-90
score: 305.3
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 17..109
e-value: 2.8E-90
score: 305.3
NoneNo IPR availablePANTHERPTHR24347SERINE/THREONINE-PROTEIN KINASEcoord: 7..300
NoneNo IPR availableCDDcd05117STKc_CAMKcoord: 16..288
e-value: 1.82665E-112
score: 325.2
NoneNo IPR availableTMHMMTMhelixcoord: 210..232
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 146..158
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 13..307