Coiled-coil domain-containing protein 178

Overview
NameCoiled-coil domain-containing protein 178
Smed IDSMED30029166
Length (bp)2784
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Coiled-coil domain-containing protein 178 (SMED30029166) t-SNE clustered cells

Violin plots show distribution of expression levels for Coiled-coil domain-containing protein 178 (SMED30029166) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Coiled-coil domain-containing protein 178 (SMED30029166) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Coiled-coil domain-containing protein 178 (SMED30029166) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029166

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30029166SMESG000021560.1 SmedASXL_015606SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30029166SMESG000021560.1 dd_Smed_v4_8905_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30029166SMESG000021560.1 dd_Smed_v4_8905_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30029166SMESG000021560.1 dd_Smed_v4_8905_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30029166SMESG000021560.1 dd_Smed_v4_8905_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30029166SMESG000021560.1 dd_Smed_v4_8905_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30029166SMESG000021560.1 dd_Smed_v6_8905_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30029166SMESG000021560.1 dd_Smed_v4_8905_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30029166SMESG000021560.1 dd_Smed_v4_8905_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30029166SMESG000021560.1 dd_Smed_v4_8905_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30029166SMESG000021560.1 dd_Smed_v4_8905_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Coiled-coil domain-containing protein 178 vs. Ensembl Human
Match: CCDC178 (coiled-coil domain containing 178 [Source:HGNC Symbol;Acc:HGNC:29588])

HSP 1 Score: 65.4698 bits (158), Expect = 8.748e-11
Identity = 37/115 (32.17%), Postives = 67/115 (58.26%), Query Frame = 2
Query:  455 LLSDTCMLISRLEFDRSNVDREITKQKLKVEKLLENINNISYFRMEMLPSAVQKEHEACANDISELHWHIKHRTQIEKKLRQKRNKAAEINEEFLSEIKSIKEHIPLVQEKLNLE 799
            LLS+   LI  LE DR++ +  + +Q+ +   +   I++ S ++++ LP AVQKEHEA  +D+ EL WH++ +    +   +++ +  E N +  ++I  + EH PL+  K N E
Sbjct:  166 LLSEAIRLIKSLETDRADAEEALKQQRSRKNMINMKIDSWSVWKLQELPLAVQKEHEAYLSDVIELQWHLEDKANQLQHFEKQKTELEEANAKIQADIDYMNEHGPLLDSKQNQE 280          
BLAST of Coiled-coil domain-containing protein 178 vs. Ensembl Human
Match: CCDC178 (coiled-coil domain containing 178 [Source:HGNC Symbol;Acc:HGNC:29588])

HSP 1 Score: 65.4698 bits (158), Expect = 3.874e-10
Identity = 37/115 (32.17%), Postives = 67/115 (58.26%), Query Frame = 2
Query:  455 LLSDTCMLISRLEFDRSNVDREITKQKLKVEKLLENINNISYFRMEMLPSAVQKEHEACANDISELHWHIKHRTQIEKKLRQKRNKAAEINEEFLSEIKSIKEHIPLVQEKLNLE 799
            LLS+   LI  LE DR++ +  + +Q+ +   +   I++ S ++++ LP AVQKEHEA  +D+ EL WH++ +    +   +++ +  E N +  ++I  + EH PL+  K N E
Sbjct:  166 LLSEAIRLIKSLETDRADAEEALKQQRSRKNMINMKIDSWSVWKLQELPLAVQKEHEAYLSDVIELQWHLEDKANQLQHFEKQKTELEEANAKIQADIDYMNEHGPLLDSKQNQE 280          
BLAST of Coiled-coil domain-containing protein 178 vs. Ensembl Human
Match: CCDC178 (coiled-coil domain containing 178 [Source:HGNC Symbol;Acc:HGNC:29588])

HSP 1 Score: 65.4698 bits (158), Expect = 4.265e-10
Identity = 37/115 (32.17%), Postives = 67/115 (58.26%), Query Frame = 2
Query:  455 LLSDTCMLISRLEFDRSNVDREITKQKLKVEKLLENINNISYFRMEMLPSAVQKEHEACANDISELHWHIKHRTQIEKKLRQKRNKAAEINEEFLSEIKSIKEHIPLVQEKLNLE 799
            LLS+   LI  LE DR++ +  + +Q+ +   +   I++ S ++++ LP AVQKEHEA  +D+ EL WH++ +    +   +++ +  E N +  ++I  + EH PL+  K N E
Sbjct:  166 LLSEAIRLIKSLETDRADAEEALKQQRSRKNMINMKIDSWSVWKLQELPLAVQKEHEAYLSDVIELQWHLEDKANQLQHFEKQKTELEEANAKIQADIDYMNEHGPLLDSKQNQE 280          
BLAST of Coiled-coil domain-containing protein 178 vs. Ensembl Human
Match: CCDC178 (coiled-coil domain containing 178 [Source:HGNC Symbol;Acc:HGNC:29588])

HSP 1 Score: 65.4698 bits (158), Expect = 4.585e-10
Identity = 37/115 (32.17%), Postives = 67/115 (58.26%), Query Frame = 2
Query:  455 LLSDTCMLISRLEFDRSNVDREITKQKLKVEKLLENINNISYFRMEMLPSAVQKEHEACANDISELHWHIKHRTQIEKKLRQKRNKAAEINEEFLSEIKSIKEHIPLVQEKLNLE 799
            LLS+   LI  LE DR++ +  + +Q+ +   +   I++ S ++++ LP AVQKEHEA  +D+ EL WH++ +    +   +++ +  E N +  ++I  + EH PL+  K N E
Sbjct:  166 LLSEAIRLIKSLETDRADAEEALKQQRSRKNMINMKIDSWSVWKLQELPLAVQKEHEAYLSDVIELQWHLEDKANQLQHFEKQKTELEEANAKIQADIDYMNEHGPLLDSKQNQE 280          
BLAST of Coiled-coil domain-containing protein 178 vs. Ensembl Human
Match: CCDC178 (coiled-coil domain containing 178 [Source:HGNC Symbol;Acc:HGNC:29588])

HSP 1 Score: 65.4698 bits (158), Expect = 4.585e-10
Identity = 37/115 (32.17%), Postives = 67/115 (58.26%), Query Frame = 2
Query:  455 LLSDTCMLISRLEFDRSNVDREITKQKLKVEKLLENINNISYFRMEMLPSAVQKEHEACANDISELHWHIKHRTQIEKKLRQKRNKAAEINEEFLSEIKSIKEHIPLVQEKLNLE 799
            LLS+   LI  LE DR++ +  + +Q+ +   +   I++ S ++++ LP AVQKEHEA  +D+ EL WH++ +    +   +++ +  E N +  ++I  + EH PL+  K N E
Sbjct:  166 LLSEAIRLIKSLETDRADAEEALKQQRSRKNMINMKIDSWSVWKLQELPLAVQKEHEAYLSDVIELQWHLEDKANQLQHFEKQKTELEEANAKIQADIDYMNEHGPLLDSKQNQE 280          
BLAST of Coiled-coil domain-containing protein 178 vs. Ensembl Zebrafish
Match: si:dkeyp-7a3.1 (si:dkeyp-7a3.1 [Source:ZFIN;Acc:ZDB-GENE-091204-119])

HSP 1 Score: 59.3066 bits (142), Expect = 1.730e-8
Identity = 41/126 (32.54%), Postives = 71/126 (56.35%), Query Frame = 2
Query:  446 VSDLLSDTCMLISRLEFDRSNVDREITKQKLKVEKLLENINNISYFRMEMLPSAVQKEHEACANDISELHWHIKHRTQIEKKLRQKRNKAAEINEEFLSEIKSIKEHIPLVQEKLNLEESIMNKIQ 823
             +D+L D   L+ RLE DR + ++ I ++K K +KLLE +N++  ++    P  ++KE EAC+ D++EL   +K       ++R +   A  +N     EI  +++H PL   +L LE  I+ +IQ
Sbjct:  116 TADVLMDVMSLVERLEQDRRDAEKAILEEKEKAKKLLEKLNSLCVWKQNEFPVEMKKEREACSTDLAELTLQLKMSRDQLPQVRDRLTLAEVLNPRLKEEIDFMRKHGPLAHHRLQLEREIIQQIQ 241          
BLAST of Coiled-coil domain-containing protein 178 vs. UniProt/SwissProt
Match: sp|Q5BJE1|CC178_HUMAN (Coiled-coil domain-containing protein 178 OS=Homo sapiens OX=9606 GN=CCDC178 PE=2 SV=3)

HSP 1 Score: 65.4698 bits (158), Expect = 2.214e-9
Identity = 37/115 (32.17%), Postives = 67/115 (58.26%), Query Frame = 2
Query:  455 LLSDTCMLISRLEFDRSNVDREITKQKLKVEKLLENINNISYFRMEMLPSAVQKEHEACANDISELHWHIKHRTQIEKKLRQKRNKAAEINEEFLSEIKSIKEHIPLVQEKLNLE 799
            LLS+   LI  LE DR++ +  + +Q+ +   +   I++ S ++++ LP AVQKEHEA  +D+ EL WH++ +    +   +++ +  E N +  ++I  + EH PL+  K N E
Sbjct:  166 LLSEAIRLIKSLETDRADAEEALKQQRSRKNMINMKIDSWSVWKLQELPLAVQKEHEAYLSDVIELQWHLEDKANQLQHFEKQKTELEEANAKIQADIDYMNEHGPLLDSKQNQE 280          
BLAST of Coiled-coil domain-containing protein 178 vs. TrEMBL
Match: K1QNA8 (Uncharacterized protein C18orf34 OS=Crassostrea gigas OX=29159 GN=CGI_10021824 PE=4 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 1.756e-52
Identity = 186/713 (26.09%), Postives = 361/713 (50.63%), Query Frame = 2
Query:  440 IPVSDLLSDTCMLISRLEFDRSNVDREITKQKLKVEKLLENINNISYFRMEMLPSAVQKEHEACANDISELHWHIKHRTQIEKKLRQKRNKAAEINEEFLSEIKSIKEHIPLVQEKLNLEESIMNKIQETKDKLIQDSANSEERQRVTKEKHDESNKKVTSERQHIKRDLHKANKALTIVQKSLQHGEKEYLKLIEFRARSEEKIRQNHIQITNLNADNESKKMEQSNLEEKVEKLDRNNRELQFDNKRL-NSTFLERMDFFANQVANQEKRRSEITKTK-KDLEQQLVELNRTNKQLEIEITEIKESQEKAINETVKLRTNTINSKEDIRESETRFEQAVEEFSITSRQHATVQQRLADETRKIHEMEEHLRKTLSDVEQAIKQEILTKANFQSKIVKDTQDLDNSRQESLDKQKQMQKSXXXXXXXXXXXXXXXXXXXSQHAESSAELKGLETEFDELEKLIEVTKFEKNKIIDNLTPVFNELKGALDTLIQKEEHVEWQVQTMNSQLVEVTHSEGLITKSKKKVQETLLDIERNYNNVALELDICRKRSSWTEATISQVTSQSNRYKV---THENYLQDRNQVVMSLEKELEDNLVLNKTLASQYRSLQTDYYTMLDGFLDVIQEQLWGENNIKSIKEVQRLQKFMHNNLEIFFALKLMYDDNLFFDLSQQSGKSEEKVKQIRLKYMAHIETMTEFLESNFSGEYQRLIA 2563
            +   D++ +   L++RLE DR   ++ +  +K +V +L   I+N+   RM  LP+ VQ+EHEAC  D++EL WH  +  +  ++++ K + A  +N+    +I+ +K+HIPLV+EKL LE+  M KI+  ++    +  N++ERQ  TK K  E+ KK  +ER HIK++L     ALT + +     +  Y   I      +++++ N  ++  L+  NE+ K+ +     KV  +     E +F++ RL N     + +  A +  N  + R    K K KD + + + L   N++ E+E+ +  +       + V    N    ++++ +   +    +EE++     + T++++L +E  K  +MEE L+ T   + + +K E+ T+    ++I  DT DL   + ++  K ++ +K  ++ +    E K KV ++ S   +   +   L+ +  E EK  E +K    + +D++ P    LK  +  L ++ +H+EW+ + M  Q+ +    +G + K     Q+ + ++      + L+L+  +K       T +Q     +R+K+    H  +  DR++ +   E E+E  L +NK LAS+YR  Q DY  + D  L+    ++  E  IK  +++Q LQK MH  +  +F  + +Y+ +    +  +S  + +KV +++ +    ++ +TEFLE+   G+  R IA
Sbjct:  165 LGAEDVIEEVITLLARLENDRIETEKGLKNEKDRVVRLNNKIDNLCLRRMTELPAIVQREHEACIMDLNELSWHCNYGGRNLQRVQNKTSAAELLNKRLKDDIEFVKKHIPLVEEKLELEKLAMEKIKNAQNSTTTELDNTKERQEKTKAKSSEAEKKAQTERGHIKKELDTVRDALTAISEEYSQAKMTYNAYIHQVNDMKQQLKDNDEELKVLDVKNENAKVAEEMQAAKVRDIQTKIAEAEFEHNRLENENIQLQQELVAKKQKNDSRIRDLENKVKAKDGKLRAILLK--NQEAEMEVQDFYDKITDCQRQKVADEKNIARIQKEMVKLGQQMAVTMEEYNKVLAINQTIREQLQNEEEKAFKMEESLKGTADTLRRQVKDEVHTRTVLVARISNDTTDLSKYKTDTQVKNQKAKKVADDVVNVVNEVKTKVEKLRSAKRDRLQKKVTLQEQLKETEKQEEESKQRFKEKLDSIEPHHKHLKDNVLALNKRLDHMEWKTEQMERQMGDWDREQGTMDKLTNNTQKAIDELTEVLEELTLQLEASQKIEEGLRGTYNQ---SQDRFKINEQNHRKFKDDRSKFLRQTEAEIESKLAVNKELASKYRQAQNDYLNLKDKLLNNFDNRVNQEAAIKDCRQLQSLQKRMHGAMLEYFKYRGLYNQSELGRMENESMSNTDKVVELQDEMNVALKKITEFLENQMDGQTARKIA 872          
BLAST of Coiled-coil domain-containing protein 178 vs. TrEMBL
Match: A0A1S3KDD2 (coiled-coil domain-containing protein 178 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106180972 PE=4 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 2.701e-50
Identity = 200/746 (26.81%), Postives = 381/746 (51.07%), Query Frame = 2
Query:  377 DRIALVPGDLQLNNLINTEQTIP---VSDLLSDTCMLISRLEFDRSNVDREITKQKLKVEKLLENINNISYFRMEMLPSAVQKEHEACANDISELHWHIKHRTQIEKKLRQKRNKAAEINEEFLSEIKSIKEHIPLVQEKLNLEESIMNKIQETKDKLIQDSANSEERQRVTKEKHDESNKKVTSERQHIKRDLHKANKALTIVQKSLQHGEKEYLKLIEFRARSEEKIRQNHIQITNLNADNESKKMEQSNLEEKVEKLDRNNRELQFDNKRLNSTFLERMDFFANQVANQEKRRSEITKTKKDLEQQ-------LVELNRTNKQLEIEITEIKESQEKAINETVKLRTNTINSKEDIRESETRFEQAVEEFSITSRQHATVQQRLADETRKIHEMEEHLRKTLSDVEQAIKQEILTKANFQSKIVKDTQDLDNSRQESLDKQKQMQKSXXXXXXXXXXXXXXXXXXXSQHAESSAELKGLETEFDELEKL---IEVTKFEKNKIIDNLTPVFNELKGALDTLIQKEEHVEWQVQTMNSQLVEVTHSEGLITKSKKKVQETLLDIERNYNNVALELDI----CRKRSSWTEATISQVTSQSNRYKVTHENYLQDRNQVVMSLEKELEDNLVLNKTLASQYRSLQTDYYTMLDGFLDVIQEQLWGENNIKSIKEVQRLQKFMHNNLEIFFALKLMYDDNLFFDLSQQSGKSEEKVKQIRLKYMAHIETMTEFLESNFSGEYQRLIA 2563
            DR  ++P  LQ +        IP     +++ +   LI+RLE DR + +  + K+K +V  L   I+ ++  R   LP+AVQ EHEAC+ DISEL WH+ ++ ++E++++ K   A  +N+    +I  +++H PLV+EKL+LE + M KI+E +D  + +   + +R++  + K  E+  K   ER HIK DL      L  V + L   +      I       +++  N  ++  LN  NE+ +  +     KV+ L+   RE  F++K+L     E  D      A +E ++++ T+   +LE Q       L +L R N + ++ I ++ +   +   + V    NT+   ++I  +E + E  +EE S     +  ++  L  E  K    EE LR T   +++ +K EI TK   Q++IV D  +L +S  E   K++++QK ++E +   +    KV ++ +++A+ +  ++GL+ E ++++ +   +E     +  ++D   P  NELK + + L  K E    + + + S+L ++  S  ++   K+  Q+T L I +  N  A ELDI     +K    T+ ++ + T++ N   + HE  ++DR +V      +L D L+LNK LAS+YR LQ  Y  + + +++    ++  E+ IK +K++  LQ  MH  L+ ++  +  Y++     +  ++  +  KV +++ +    +  + +FL+++  G+  R +A
Sbjct:  219 DRPDIMPQGLQAD--------IPYLGAEEVVDEVMTLIARLEKDRIDTEDMLKKEKERVRTLNHKIDMLAEKRSVDLPAAVQGEHEACSMDISELAWHVAYKERLEERIQHKVGVAEVMNKRLKEDIAFVQKHCPLVEEKLSLERNAMAKIKEAQDDTVDELQVTIDRKQSCEAKSAEAFSKAEKERMHIKSDLDGVRTDLNHVSEDLAEAKMNNNTYIHQMNDCRQQLHDNDQEMIVLNVKNENSRAAEEIQARKVKDLEGRIREQTFEHKKLE----ENNDRL---TAWKESKQAKFTEQISELENQRELKEETLKQLLRKNDERDMMIADMTQKIHQCQKQKVIDEKNTVRIHKEIARTEKQIEVTMEELSKVQTINRAIRDTLMSEENKASLEEEKLRITAESLKKQVKDEIHTKTVMQARIVSDNTELVSSHDEFKAKREKVQKVVDELMENLRVILGKVEKLRAEYAKRAKAIEGLDKELNQVQTMHQELETKLMGRKNVLD---PQNNELKASNNELDNKIEKANKRTEMILSKLEDIDKSNNMM---KRVWQKTELAI-KQANEKAEELDIKLAYAQKVDQETKESLLRTTTRMNTLDMQHEQLMKDRREVHEKTMTDLTDKLILNKELASRYRQLQLLYVKVKNEYMNEYDGRVNMESTIKDLKQLHSLQVRMHAALQEYYKCRGAYNEYELNRMESETADNAHKVSELQGQLDGALSKIGQFLKTHLDGDAARRMA 942          
BLAST of Coiled-coil domain-containing protein 178 vs. TrEMBL
Match: A0A1S3KDU6 (coiled-coil domain-containing protein 178 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106180972 PE=4 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 1.099e-49
Identity = 198/746 (26.54%), Postives = 381/746 (51.07%), Query Frame = 2
Query:  377 DRIALVPGDLQLNNLINTEQTIP---VSDLLSDTCMLISRLEFDRSNVDREITKQKLKVEKLLENINNISYFRMEMLPSAVQKEHEACANDISELHWHIKHRTQIEKKLRQKRNKAAEINEEFLSEIKSIKEHIPLVQEKLNLEESIMNKIQETKDKLIQDSANSEERQRVTKEKHDESNKKVTSERQHIKRDLHKANKALTIVQKSLQHGEKEYLKLIEFRARSEEKIRQNHIQITNLNADNESKKMEQSNLEEKVEKLDRNNRELQFDNKRLNSTFLERMDFFANQVANQEKRRSEITKTKKDLEQQ-------LVELNRTNKQLEIEITEIKESQEKAINETVKLRTNTINSKEDIRESETRFEQAVEEFSITSRQHATVQQRLADETRKIHEMEEHLRKTLSDVEQAIKQEILTKANFQSKIVKDTQDLDNSRQESLDKQKQMQKSXXXXXXXXXXXXXXXXXXXSQHAESSAELKGLETEFDELEKL---IEVTKFEKNKIIDNLTPVFNELKGALDTLIQKEEHVEWQVQTMNSQLVEVTHSEGLITKSKKKVQETLLDIERNYNNVALELDI----CRKRSSWTEATISQVTSQSNRYKVTHENYLQDRNQVVMSLEKELEDNLVLNKTLASQYRSLQTDYYTMLDGFLDVIQEQLWGENNIKSIKEVQRLQKFMHNNLEIFFALKLMYDDNLFFDLSQQSGKSEEKVKQIRLKYMAHIETMTEFLESNFSGEYQRLIA 2563
            DR  ++P  LQ +        IP     +++ +   LI+RLE DR + +  + K+K +V  L   I+ ++  R   LP+AVQ EHEAC+ DISEL WH+ ++ ++E++++ K   A  +N+    +I  +++H PLV+EKL+LE + M KI+E +D  + +   + +R++  + K  E+  K   ER HIK DL      L  V + L   +      I       +++  N  ++  LN  NE+ +  +     KV+ L+   RE  F++K+L     +R+  +      + K +++ T+   +LE Q       L +L R N + ++ I ++ +   +   + V    NT+   ++I  +E + E  +EE S     +  ++  L  E  K    EE LR T   +++ +K EI TK   Q++IV D  +L +S  E   K++++QK ++E +   +    KV ++ +++A+ +  ++GL+ E ++++ +   +E     +  ++D   P  NELK + + L  K E    + + + S+L ++  S  ++   K+  Q+T L I +  N  A ELDI     +K    T+ ++ + T++ N   + HE  ++DR +V      +L D L+LNK LAS+YR LQ  Y  + + +++    ++  E+ IK +K++  LQ  MH  L+ ++  +  Y++     +  ++  +  KV +++ +    +  + +FL+++  G+  R +A
Sbjct:  219 DRPDIMPQGLQAD--------IPYLGAEEVVDEVMTLIARLEKDRIDTEDMLKKEKERVRTLNHKIDMLAEKRSVDLPAAVQGEHEACSMDISELAWHVAYKERLEERIQHKVGVAEVMNKRLKEDIAFVQKHCPLVEEKLSLERNAMAKIKEAQDDTVDELQVTIDRKQSCEAKSAEAFSKAEKERMHIKSDLDGVRTDLNHVSEDLAEAKMNNNTYIHQMNDCRQQLHDNDQEMIVLNVKNENSRAAEEIQARKVKDLEGRIREQTFEHKKLEENN-DRLTAW-----KESKPQAKFTEQISELENQRELKEETLKQLLRKNDERDMMIADMTQKIHQCQKQKVIDEKNTVRIHKEIARTEKQIEVTMEELSKVQTINRAIRDTLMSEENKASLEEEKLRITAESLKKQVKDEIHTKTVMQARIVSDNTELVSSHDEFKAKREKVQKVVDELMENLRVILGKVEKLRAEYAKRAKAIEGLDKELNQVQTMHQELETKLMGRKNVLD---PQNNELKASNNELDNKIEKANKRTEMILSKLEDIDKSNNMM---KRVWQKTELAI-KQANEKAEELDIKLAYAQKVDQETKESLLRTTTRMNTLDMQHEQLMKDRREVHEKTMTDLTDKLILNKELASRYRQLQLLYVKVKNEYMNEYDGRVNMESTIKDLKQLHSLQVRMHAALQEYYKCRGAYNEYELNRMESETADNAHKVSELQGQLDGALSKIGQFLKTHLDGDAARRMA 943          
BLAST of Coiled-coil domain-containing protein 178 vs. TrEMBL
Match: A0A267E194 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015820g2 PE=4 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 8.235e-42
Identity = 165/659 (25.04%), Postives = 335/659 (50.83%), Query Frame = 2
Query:  440 IPVSDLLSDTCMLISRLEFDRSNVDREITKQKLKVEKLLENINNISYFRMEMLPSAVQKEHEACANDISELHWHIKHRTQIEKKLRQKRNKAAEINEEFLSEIKSIKEHIPLVQEKLNLEESIMNKIQETKD---KLIQDSANSEER-QRVTKEKHDESNKKVTSERQHIKRDLHKANKALTIVQKSLQHGEKEYLKLIEFRARSEEKIRQNHIQITNLNADNESKKMEQSNLEEKVEKLDRNNRELQFDNKRLNSTFLERMDFFANQVANQEKRRSEITKTKKDLEQQLVELNRTNKQLEIEITEIKESQEKAINETVKLRTNTINSKEDIRESETRFEQAVEEFSITSRQHATVQQRLADETRKIHEMEEHLRKTLSDVEQAIKQEILTKANFQSKIVKDTQDLDNSRQESLDKQKQMQKSXXXXXXXXXXXXXXXXXXXSQHAESSAELKGLETEFDELEKLIEVTKFEKNKIIDNLTPVFNELKGALDTLIQKEEHVEWQVQTMNSQLVEVTHSEGLITKSKKKVQETLLDIERNYNNVALELDICRKRSSWTEATISQVTSQSNRYKVTHENYLQDRNQVVMSLEKELEDNLVLNKTLASQYRSLQTDYYTMLDGFLDVIQEQLWGENNIKSIKEVQRLQKFMHNNLEIFFALK 2404
            +   +++ +   L+ +LE DR   + +I  ++ KV +L   I+ +S  ++  +P AVQ EHEAC  DI+EL+WH++ + +   K R++  K+  +NEE   E+  I+ H PLV+EKL LE S ++ I+E      K +QD+    +R ++  K+ H  +N+    ER  +K ++ KA   L   + ++Q  E+++++L E    S+EK R N  +I  L   N +   +Q+ L+  V++L +  R  +   + L+    +  D      ANQ+ +++E+       E + + L R   +   E+ ++++  +    + V    N    + ++  ++   E+ +EEF   +++H+ V ++L  E +K+  +E+ L+ T++ +++ ++ EI T+     +I  DT+DL  S+ E+  K+ +++K   +  +   + ++KVA++ ++ AE  A    L+ E D+L +    T+   +  I  L P     K  +D L+ +   +  Q++ MN ++ ++    G+I +++ K  + +  +E     +  EL    +     +A ++ V ++       H    ++R +    LE E    L  N+ LA  YR+ Q + + M +  LD++ E L  E  ++ +K+ +RLQ+  H  L+ +   K
Sbjct:  176 LGAEEVVQEVMQLMVKLENDRLQAEEDIRLERGKVIELASRIDRLSEAKLLQMPVAVQAEHEACIEDIAELNWHVQSKRKNLDKSRRRHAKSVRMNEEIKEEMAYIRVHDPLVREKLQLELSKIDTIKEEGSDTRKEMQDTKKKLDRVEKKNKDAHGVANQ----ERARMKGEVDKATDNLQKARDAVQKSEEQFVELCERIVNSKEKNRSNKQEIEELRVKNAAAYKQQNELQATVDELTKTLRYEEHQTRLLDEELYQTQDNHEKLKANQDAQKAEMQAAVDHSEDRYIFLRREADEHATELQDMQDRLKDCERQKVDDEKNLARMEAELERTQEEMERILEEFGKVAQEHSNVAKKLESEEKKVMFVEDSLKATITQLQKQVEDEIATRERLIVRIETDTRDLGKSKVEAKVKKAKLKKMSEKMEVLVSQMRQKVAKLRAESAEKCAVADALQRELDDLLEERRQTEARLDGRIGELRPKHEAEKAEVDRLVARLAEIGEQIEMMNKKIRDIYDQTGMIKRTQMKFTDAIRMLEDQMQQLTHELSKSTRSDDSLKAQLAAVQARMASRADEHRRLQENRRETQRQLESEYRAALEENRRLAGDYRARQNEVFRMKEDLLDLLNEILRREEAVRDLKQGKRLQEKTHFALKTYLRYK 830          
BLAST of Coiled-coil domain-containing protein 178 vs. TrEMBL
Match: A0A267DMT7 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015820g3 PE=4 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 9.930e-42
Identity = 165/659 (25.04%), Postives = 335/659 (50.83%), Query Frame = 2
Query:  440 IPVSDLLSDTCMLISRLEFDRSNVDREITKQKLKVEKLLENINNISYFRMEMLPSAVQKEHEACANDISELHWHIKHRTQIEKKLRQKRNKAAEINEEFLSEIKSIKEHIPLVQEKLNLEESIMNKIQETKD---KLIQDSANSEER-QRVTKEKHDESNKKVTSERQHIKRDLHKANKALTIVQKSLQHGEKEYLKLIEFRARSEEKIRQNHIQITNLNADNESKKMEQSNLEEKVEKLDRNNRELQFDNKRLNSTFLERMDFFANQVANQEKRRSEITKTKKDLEQQLVELNRTNKQLEIEITEIKESQEKAINETVKLRTNTINSKEDIRESETRFEQAVEEFSITSRQHATVQQRLADETRKIHEMEEHLRKTLSDVEQAIKQEILTKANFQSKIVKDTQDLDNSRQESLDKQKQMQKSXXXXXXXXXXXXXXXXXXXSQHAESSAELKGLETEFDELEKLIEVTKFEKNKIIDNLTPVFNELKGALDTLIQKEEHVEWQVQTMNSQLVEVTHSEGLITKSKKKVQETLLDIERNYNNVALELDICRKRSSWTEATISQVTSQSNRYKVTHENYLQDRNQVVMSLEKELEDNLVLNKTLASQYRSLQTDYYTMLDGFLDVIQEQLWGENNIKSIKEVQRLQKFMHNNLEIFFALK 2404
            +   +++ +   L+ +LE DR   + +I  ++ KV +L   I+ +S  ++  +P AVQ EHEAC  DI+EL+WH++ + +  +K R++  K+  +NEE   E+  I+ H PLV+EKL LE S ++ I+E      K +QD+    +R ++  K+ H  +N+    ER  +K ++ KA   L   + ++Q  E+++++L E    S+EK R N  +I  L   N +    Q+ L+  V++L +  R  +   + L+    +  D      ANQ+ +++E+       E + + L R   +   E+ ++++  +    + V    N    + ++  ++   E+ +EEF   +++H+ V ++L  E +K+  +E+ L+ T++ +++ ++ EI T+     +I  DT+DL  S+ E+  K+ +++K   +  +   + ++KVA++ ++ AE  A    L+ E D+L +    T+   +  I  L P     K  +D L+ +   +  Q++ MN ++ ++    G+I +++ K  + +  +E     +  EL    +     +A ++ V ++       H    ++R +    LE E    L  N+ LA  YR+ Q + + M +  LD++ E L  E  ++ +K+ +RLQ+  H  L+ +   K
Sbjct:  176 LGAEEVVQEVMQLMVKLENDRLQAEEDIRLERGKVIELASRIDRLSEAKLLQMPVAVQAEHEACIEDIAELNWHVQSKRKNLEKSRRRHAKSVRMNEEIKEEMAYIRVHDPLVREKLQLELSKIDTIKEEGSDTRKEMQDTKKKLDRVEKKNKDAHGVANQ----ERARMKGEVDKATDNLQKARDAVQKSEEQFVELCERIVNSKEKNRSNKQEIEELRVKNAAAYKRQNELQATVDELTKTLRYEEHQTRLLDEELYQTQDNHEKLKANQDAQKAEMQAAVDHSEDRYIFLRREADEHATELQDMQDRLKDCERQKVDDEKNLARMEAELERTQEEMERILEEFGKVAQEHSNVAKKLESEEKKVMFVEDSLKATITQLQKQVEDEIATRERLIVRIETDTRDLGKSKVEAKVKKAKLKKMSEKMEVLVSQMRQKVAKLRAESAEKCAVADALQRELDDLLEERRQTEARLDGRIGELRPKHEAEKAEVDRLVARLAEIGEQIEMMNKKIRDIYDQTGMIKRTQMKFTDAIRMLEDQMQQLTHELSKSTRSDDSLKAQLAAVQARMASRADEHRRLQENRRETQRQLESEYRAALEENRRLAGDYRARQNEVFRMKEDLLDLLNEILRREEAVRDLKQGKRLQEKTHFALKTYLRYK 830          
BLAST of Coiled-coil domain-containing protein 178 vs. Ensembl Nematostella
Match: EDO47419 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM02])

HSP 1 Score: 48.1358 bits (113), Expect = 6.088e-6
Identity = 41/209 (19.62%), Postives = 99/209 (47.37%), Query Frame = 2
Query: 1907 LIQKEEHVEWQVQTMNSQLVEVTHSEGLITKSKKKVQETLLDIERNYNNVALELDICRKRSSWTEATISQVTSQSNRYKVTHENYLQDRNQVVMSLEKELEDNLVLNKTLASQYRSLQTDYYTMLDGFLDVIQEQLWGENNIKSIKEVQRLQKFMHNNLEIFFALKLMYDDNLFFDLSQQSGKSEEKVKQIRLKYMAHIETMTEFLESN 2533
            L ++ +H+ W+ + M  ++ ++  S  ++ K      +++ D+      + ++L+   +       +++Q   +    +  H  Y+  R  ++ +    +E +L  NK LA +Y  LQ  +       L   + +++ E+N+K  +E+  LQ+ MH  LE ++ L+ + +         ++ ++  K+  ++ + M  IE +  FLE+N
Sbjct:    3 LAKRIDHMTWKSEMMEKKMQDMASSSLMMNKVITTTTDSINDLNEEMTELKIQLETGFETEQDLRTSLNQAEGRIKLGEEDHNRYMAQRESILQTNLGGVESSLEENKRLAEKYTILQQQFLNNKAALLREFERRVFREHNLKDHRELSVLQERMHEALEYYYRLRGLQNRAGIAHFELRAAENGGKLVYLQSEMMRVIEHINRFLEAN 211          
BLAST of Coiled-coil domain-containing protein 178 vs. Planmine SMEST
Match: SMESG000021560.1 (SMESG000021560.1)

HSP 1 Score: 1513.05 bits (3916), Expect = 0.000e+0
Identity = 792/810 (97.78%), Postives = 799/810 (98.64%), Query Frame = 2
Query:  140 MALTIENSTSQNLCEIVNEFNDFSQMIELTNVFQLRVNEVKYHXXXXXXXXXXXXXXXXXXXXXXXVCDSNDIASLNLKDRIALVPGDLQLNNLINTEQTIPVSDLLSDTCMLISRLEFDRSNVDREITKQKLKVEKLLENINNISYFRMEMLPSAVQKEHEACANDISELHWHIKHRTQIEKKLRQKRNKAAEINEEFLSEIKSIKEHIPLVQEKLNLEESIMNKIQETKDKLIQDSANSEERQRVTKEKHDESNKKVTSERQHIKRDLHKANKALTIVQKSLQHGEKEYLKLIEFRARSEEKIRQNHIQITNLNADNESKKMEQSNLEEKVEKLDRNNRELQFDNKRLNSTFLERMDFFANQVANQEKRRSEITKTKKDLEQQLVELNRTNKQLEIEITEIKESQEKAINETVKLRTNTINSKEDIRESETRFEQAVEEFSITSRQHATVQQRLADETRKIHEMEEHLRKTLSDVEQAIKQEILTKANFQSKIVKDTQDLDNSRQESLDKQKQMQKSXXXXXXXXXXXXXXXXXXXSQHAESSAELKGLETEFDELEKLIEVTKFEKNKIIDNLTPVFNELKGALDTLIQKEEHVEWQVQTMNSQLVEVTHSEGLITKSKKKVQETLLDIERNYNNVALELDICRKRSSWTEATISQVTSQSNRYKVTHENYLQDRNQVVMSLEKELEDNLVLNKTLASQYRSLQTDYYTMLDGFLDVIQEQLWGENNIKSIKEVQRLQKFMHNNLEIFFALKLMYDDNLFFDLSQQSGKSEEKVKQIRLKYMAHIETMTEFLESNFSGEYQRLIAEK 2569
            MALTIENST+QNLCEIVNEFNDFSQMIELTNVFQLRVNEVKYHLENLRKSL+S+SS++        VCDSNDIASLNLKDRIALVPGDLQLNNLINTEQTIPVSDLLSDTCMLISRLEFDRSNVDREITKQKLKVEKLLENINNISYFRMEMLPSAVQKEHEACANDISELHWHIKHR QIEKKLRQKRNKAAEINEE LSEIKSIKEHIPLVQEKLNLEESIMNKIQETKDKLIQDSANSEERQRVTKEKHDESNKKVTSERQHIKRDLHKANKALT VQKSLQHGEKEYLKLIEFRARSEEKIRQNHIQITNLNADNESKKMEQSNLEEKVEKLDRNNRELQFDNKRLNSTFLERMDFFANQVANQEKRRSEITKTKKDLEQQLVELNRTNKQLEIEITEIKESQEKAINETVKLRTNTINSKEDIRESETRFEQAVEEFSITSRQHATVQQRLADETRKIHEMEEHLRKTLSDVEQAIKQEILTKANFQSKIVKDTQDLDNSRQESLDKQKQMQKSLNEALLATKEAKKKVAEIESQHAESSAELKGLETEFDELEKLIEVTKFEKNKIIDNLTPV+NELKGALDTLIQKEEHVEWQVQTMNSQLVEVTHSEGLITKSKKKVQETLLDIERNYNNVALELDICRKRSSWTEATISQVTSQSNRY+VTHENYLQDRNQVVMSLEKELEDNLVLNKTLASQYRSLQTDYYTMLDGFLDVIQEQLWGENNIKSIKEVQRLQKFMHNNLEIFFALKLMYDDNLFFDLSQQSGKSEEKVKQIRLKYMAHIETMTEFLESNFSGEYQRLIAEK
Sbjct:    1 MALTIENSTNQNLCEIVNEFNDFSQMIELTNVFQLRVNEVKYHLENLRKSLMSSSSENGLLL----VCDSNDIASLNLKDRIALVPGDLQLNNLINTEQTIPVSDLLSDTCMLISRLEFDRSNVDREITKQKLKVEKLLENINNISYFRMEMLPSAVQKEHEACANDISELHWHIKHRAQIEKKLRQKRNKAAEINEELLSEIKSIKEHIPLVQEKLNLEESIMNKIQETKDKLIQDSANSEERQRVTKEKHDESNKKVTSERQHIKRDLHKANKALTSVQKSLQHGEKEYLKLIEFRARSEEKIRQNHIQITNLNADNESKKMEQSNLEEKVEKLDRNNRELQFDNKRLNSTFLERMDFFANQVANQEKRRSEITKTKKDLEQQLVELNRTNKQLEIEITEIKESQEKAINETVKLRTNTINSKEDIRESETRFEQAVEEFSITSRQHATVQQRLADETRKIHEMEEHLRKTLSDVEQAIKQEILTKANFQSKIVKDTQDLDNSRQESLDKQKQMQKSLNEALLATKEAKKKVAEIESQHAESSAELKGLETEFDELEKLIEVTKFEKNKIIDNLTPVYNELKGALDTLIQKEEHVEWQVQTMNSQLVEVTHSEGLITKSKKKVQETLLDIERNYNNVALELDICRKRSSWTEATISQVTSQSNRYRVTHENYLQDRNQVVMSLEKELEDNLVLNKTLASQYRSLQTDYYTMLDGFLDVIQEQLWGENNIKSIKEVQRLQKFMHNNLEIFFALKLMYDDNLFFDLSQQSGKSEEKVKQIRLKYMAHIETMTEFLESNFSGEYQRLIAEK 806          
BLAST of Coiled-coil domain-containing protein 178 vs. Planmine SMEST
Match: SMESG000021560.1 (SMESG000021560.1)

HSP 1 Score: 1462.97 bits (3786), Expect = 0.000e+0
Identity = 768/785 (97.83%), Postives = 774/785 (98.60%), Query Frame = 2
Query:  215 MIELTNVFQLRVNEVKYHXXXXXXXXXXXXXXXXXXXXXXXVCDSNDIASLNLKDRIALVPGDLQLNNLINTEQTIPVSDLLSDTCMLISRLEFDRSNVDREITKQKLKVEKLLENINNISYFRMEMLPSAVQKEHEACANDISELHWHIKHRTQIEKKLRQKRNKAAEINEEFLSEIKSIKEHIPLVQEKLNLEESIMNKIQETKDKLIQDSANSEERQRVTKEKHDESNKKVTSERQHIKRDLHKANKALTIVQKSLQHGEKEYLKLIEFRARSEEKIRQNHIQITNLNADNESKKMEQSNLEEKVEKLDRNNRELQFDNKRLNSTFLERMDFFANQVANQEKRRSEITKTKKDLEQQLVELNRTNKQLEIEITEIKESQEKAINETVKLRTNTINSKEDIRESETRFEQAVEEFSITSRQHATVQQRLADETRKIHEMEEHLRKTLSDVEQAIKQEILTKANFQSKIVKDTQDLDNSRQESLDKQKQMQKSXXXXXXXXXXXXXXXXXXXSQHAESSAELKGLETEFDELEKLIEVTKFEKNKIIDNLTPVFNELKGALDTLIQKEEHVEWQVQTMNSQLVEVTHSEGLITKSKKKVQETLLDIERNYNNVALELDICRKRSSWTEATISQVTSQSNRYKVTHENYLQDRNQVVMSLEKELEDNLVLNKTLASQYRSLQTDYYTMLDGFLDVIQEQLWGENNIKSIKEVQRLQKFMHNNLEIFFALKLMYDDNLFFDLSQQSGKSEEKVKQIRLKYMAHIETMTEFLESNFSGEYQRLIAEK 2569
            MIELTNVFQLRVNEVKYHLENLRKSL+S+SS++        VCDSNDIASLNLKDRIALVPGDLQLNNLINTEQTIPVSDLLSDTCMLISRLEFDRSNVDREITKQKLKVEKLLENINNISYFRMEMLPSAVQKEHEACANDISELHWHIKHR QIEKKLRQKRNKAAEINEE LSEIKSIKEHIPLVQEKLNLEESIMNKIQETKDKLIQDSANSEERQRVTKEKHDESNKKVTSERQHIKRDLHKANKALT VQKSLQHGEKEYLKLIEFRARSEEKIRQNHIQITNLNADNESKKMEQSNLEEKVEKLDRNNRELQFDNKRLNSTFLERMDFFANQVANQEKRRSEITKTKKDLEQQLVELNRTNKQLEIEITEIKESQEKAINETVKLRTNTINSKEDIRESETRFEQAVEEFSITSRQHATVQQRLADETRKIHEMEEHLRKTLSDVEQAIKQEILTKANFQSKIVKDTQDLDNSRQESLDKQKQMQKSLNEALLATKEAKKKVAEIESQHAESSAELKGLETEFDELEKLIEVTKFEKNKIIDNLTPV+NELKGALDTLIQKEEHVEWQVQTMNSQLVEVTHSEGLITKSKKKVQETLLDIERNYNNVALELDICRKRSSWTEATISQVTSQSNRY+VTHENYLQDRNQVVMSLEKELEDNLVLNKTLASQYRSLQTDYYTMLDGFLDVIQEQLWGENNIKSIKEVQRLQKFMHNNLEIFFALKLMYDDNLFFDLSQQSGKSEEKVKQIRLKYMAHIETMTEFLESNFSGEYQRLIAEK
Sbjct:    1 MIELTNVFQLRVNEVKYHLENLRKSLMSSSSENGLLL----VCDSNDIASLNLKDRIALVPGDLQLNNLINTEQTIPVSDLLSDTCMLISRLEFDRSNVDREITKQKLKVEKLLENINNISYFRMEMLPSAVQKEHEACANDISELHWHIKHRAQIEKKLRQKRNKAAEINEELLSEIKSIKEHIPLVQEKLNLEESIMNKIQETKDKLIQDSANSEERQRVTKEKHDESNKKVTSERQHIKRDLHKANKALTSVQKSLQHGEKEYLKLIEFRARSEEKIRQNHIQITNLNADNESKKMEQSNLEEKVEKLDRNNRELQFDNKRLNSTFLERMDFFANQVANQEKRRSEITKTKKDLEQQLVELNRTNKQLEIEITEIKESQEKAINETVKLRTNTINSKEDIRESETRFEQAVEEFSITSRQHATVQQRLADETRKIHEMEEHLRKTLSDVEQAIKQEILTKANFQSKIVKDTQDLDNSRQESLDKQKQMQKSLNEALLATKEAKKKVAEIESQHAESSAELKGLETEFDELEKLIEVTKFEKNKIIDNLTPVYNELKGALDTLIQKEEHVEWQVQTMNSQLVEVTHSEGLITKSKKKVQETLLDIERNYNNVALELDICRKRSSWTEATISQVTSQSNRYRVTHENYLQDRNQVVMSLEKELEDNLVLNKTLASQYRSLQTDYYTMLDGFLDVIQEQLWGENNIKSIKEVQRLQKFMHNNLEIFFALKLMYDDNLFFDLSQQSGKSEEKVKQIRLKYMAHIETMTEFLESNFSGEYQRLIAEK 781          
The following BLAST results are available for this feature:
BLAST of Coiled-coil domain-containing protein 178 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CCDC1788.748e-1132.17coiled-coil domain containing 178 [Source:HGNC Sym... [more]
CCDC1783.874e-1032.17coiled-coil domain containing 178 [Source:HGNC Sym... [more]
CCDC1784.265e-1032.17coiled-coil domain containing 178 [Source:HGNC Sym... [more]
CCDC1784.585e-1032.17coiled-coil domain containing 178 [Source:HGNC Sym... [more]
CCDC1784.585e-1032.17coiled-coil domain containing 178 [Source:HGNC Sym... [more]
back to top
BLAST of Coiled-coil domain-containing protein 178 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain-containing protein 178 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain-containing protein 178 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:dkeyp-7a3.11.730e-832.54si:dkeyp-7a3.1 [Source:ZFIN;Acc:ZDB-GENE-091204-11... [more]
back to top
BLAST of Coiled-coil domain-containing protein 178 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain-containing protein 178 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain-containing protein 178 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q5BJE1|CC178_HUMAN2.214e-932.17Coiled-coil domain-containing protein 178 OS=Homo ... [more]
back to top
BLAST of Coiled-coil domain-containing protein 178 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1QNA81.756e-5226.09Uncharacterized protein C18orf34 OS=Crassostrea gi... [more]
A0A1S3KDD22.701e-5026.81coiled-coil domain-containing protein 178 isoform ... [more]
A0A1S3KDU61.099e-4926.54coiled-coil domain-containing protein 178 isoform ... [more]
A0A267E1948.235e-4225.04Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267DMT79.930e-4225.04Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of Coiled-coil domain-containing protein 178 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain-containing protein 178 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain-containing protein 178 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain-containing protein 178 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO474196.088e-619.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Coiled-coil domain-containing protein 178 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain-containing protein 178 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000021560.10.000e+097.78SMESG000021560.1[more]
SMESG000021560.10.000e+097.83SMESG000021560.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029166 ID=SMED30029166|Name=Coiled-coil domain-containing protein 178|organism=Schmidtea mediterranea sexual|type=transcript|length=2784bp
CTATGGAATAATTTTGATGTCAATTTTCAAATCATTTTGAACTTTATTTT
TACAAAATGCATACTTTTAGTTTTTAAGCGTAGTATATTGGCTGTACAAC
AAATGGAAATGATAAACTGCTATTAAAACAAATATTTTTATGGCACTAAC
AATTGAAAATTCTACAAGCCAAAATTTGTGCGAGATTGTGAATGAGTTTA
ATGATTTCTCTCAGATGATTGAGCTGACTAATGTGTTCCAATTGCGAGTC
AATGAGGTCAAATATCATTTAGAAAACCTGAGGAAATCCCTACTGTCGAA
CTCGAGTAAAAGCTCCGATGAAAATAGCTTACTGTTGGTGTGTGACTCAA
ACGATATCGCCAGTTTGAATCTTAAAGATCGAATAGCTTTAGTGCCTGGA
GACTTGCAGCTGAATAACCTGATAAACACAGAGCAAACCATTCCCGTGTC
GGATCTATTATCGGACACCTGTATGCTCATATCACGATTGGAATTCGACC
GTAGCAATGTTGATCGTGAAATTACGAAGCAGAAATTAAAAGTTGAAAAA
CTGCTAGAAAACATCAACAACATTTCGTATTTCCGAATGGAAATGTTGCC
ATCAGCCGTACAGAAAGAGCACGAAGCGTGTGCCAATGATATTTCCGAGC
TACATTGGCATATCAAGCATCGTACTCAGATAGAGAAGAAACTCCGTCAG
AAGCGAAACAAGGCGGCTGAAATAAATGAGGAGTTTCTGTCGGAAATCAA
ATCGATCAAGGAACACATACCACTTGTGCAGGAGAAACTTAATTTAGAAG
AGAGTATAATGAACAAAATTCAGGAGACAAAAGATAAATTGATTCAAGAT
TCAGCAAATAGCGAAGAACGACAAAGAGTAACAAAAGAGAAGCATGACGA
ATCCAATAAAAAGGTCACGTCAGAGCGGCAACATATCAAGCGAGACCTGC
ATAAAGCCAATAAGGCGTTGACTATTGTTCAGAAGTCTTTGCAACACGGA
GAAAAAGAATATCTGAAGCTAATAGAATTTCGCGCTAGAAGTGAAGAAAA
GATTAGACAAAATCACATTCAAATTACAAATTTGAATGCAGACAATGAAT
CTAAAAAAATGGAGCAGTCAAACCTTGAAGAGAAAGTAGAGAAGTTGGAC
AGAAATAATCGAGAGCTGCAGTTCGACAACAAACGACTAAATAGCACATT
TTTAGAACGAATGGACTTTTTTGCGAATCAAGTAGCAAACCAAGAGAAAA
GGAGATCGGAAATTACTAAAACGAAAAAAGATTTAGAACAACAATTGGTG
GAATTAAATCGAACGAATAAACAACTGGAAATTGAGATCACAGAAATCAA
AGAATCCCAAGAGAAAGCAATTAATGAAACCGTCAAATTGAGAACGAACA
CCATCAATTCGAAAGAAGATATCCGGGAATCTGAGACACGATTTGAACAA
GCTGTTGAGGAATTCAGTATTACGTCAAGGCAGCACGCAACTGTTCAACA
GAGATTGGCAGATGAGACTCGCAAAATCCATGAAATGGAAGAACATTTGA
GAAAAACTTTGTCTGATGTCGAACAAGCCATAAAACAAGAAATATTAACA
AAGGCAAATTTTCAAAGCAAAATTGTCAAAGATACCCAAGATCTTGATAA
TTCAAGACAGGAATCATTAGACAAACAGAAACAAATGCAAAAATCTCTCA
ATGAGGCCCTATTGGCAACGAAAGAAGCGAAAAAAAAAGTTGCAGAAATT
GAATCTCAACATGCAGAAAGTAGTGCAGAATTAAAGGGACTCGAAACTGA
ATTTGATGAGCTCGAGAAATTGATTGAAGTGACGAAATTTGAAAAGAACA
AAATCATAGATAATTTGACCCCGGTTTTCAATGAATTGAAAGGAGCATTA
GATACATTAATTCAAAAGGAAGAGCATGTCGAATGGCAAGTGCAGACAAT
GAACTCACAACTAGTTGAAGTGACCCATTCTGAAGGGTTGATTACAAAAT
CTAAGAAAAAGGTTCAAGAAACATTGCTAGATATAGAAAGGAATTATAAT
AACGTGGCGTTGGAGCTGGACATTTGCAGGAAACGCAGCAGTTGGACCGA
AGCGACCATTTCTCAAGTAACATCCCAATCAAACCGATATAAGGTCACCC
ACGAGAACTACCTTCAAGATCGCAACCAAGTTGTCATGAGCCTTGAAAAA
GAATTGGAGGACAATCTTGTACTTAATAAAACTCTTGCATCTCAATATCG
GTCCCTACAGACCGATTACTACACAATGTTGGATGGATTCCTCGATGTGA
TCCAGGAACAGTTATGGGGTGAAAACAACATCAAATCCATCAAAGAAGTC
CAGCGGTTACAGAAATTCATGCACAACAATTTGGAGATCTTTTTTGCGCT
GAAATTGATGTACGATGACAACCTGTTCTTTGATTTGAGCCAACAAAGTG
GAAAGAGTGAGGAAAAGGTGAAGCAGATTCGCCTTAAATATATGGCACAT
ATTGAGACGATGACCGAGTTCCTAGAGAGCAATTTTTCAGGTGAATATCA
AAGATTAATCGCGGAGAAATAGACTGCTGGGAAAATGCACGTTAATCTTT
ATTTTTATCTGATGTTTTCTTTTTCTATCTGTTTTATTATTTTCCATTGG
CAATAGCTGAGAATTTACTGCTGAGAATTTACCTGCTGATTTGCTAAATA
TAACTTCTATCGGTTTACAGAATTTTCAACTCTTAACATTACAAATTCTG
AGCCCCCCGGCTGTTTATATTGATCAACTTAGAC
back to top

protein sequence of SMED30029166-orf-1

>SMED30029166-orf-1 ID=SMED30029166-orf-1|Name=SMED30029166-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=811bp
MALTIENSTSQNLCEIVNEFNDFSQMIELTNVFQLRVNEVKYHLENLRKS
LLSNSSKSSDENSLLLVCDSNDIASLNLKDRIALVPGDLQLNNLINTEQT
IPVSDLLSDTCMLISRLEFDRSNVDREITKQKLKVEKLLENINNISYFRM
EMLPSAVQKEHEACANDISELHWHIKHRTQIEKKLRQKRNKAAEINEEFL
SEIKSIKEHIPLVQEKLNLEESIMNKIQETKDKLIQDSANSEERQRVTKE
KHDESNKKVTSERQHIKRDLHKANKALTIVQKSLQHGEKEYLKLIEFRAR
SEEKIRQNHIQITNLNADNESKKMEQSNLEEKVEKLDRNNRELQFDNKRL
NSTFLERMDFFANQVANQEKRRSEITKTKKDLEQQLVELNRTNKQLEIEI
TEIKESQEKAINETVKLRTNTINSKEDIRESETRFEQAVEEFSITSRQHA
TVQQRLADETRKIHEMEEHLRKTLSDVEQAIKQEILTKANFQSKIVKDTQ
DLDNSRQESLDKQKQMQKSLNEALLATKEAKKKVAEIESQHAESSAELKG
LETEFDELEKLIEVTKFEKNKIIDNLTPVFNELKGALDTLIQKEEHVEWQ
VQTMNSQLVEVTHSEGLITKSKKKVQETLLDIERNYNNVALELDICRKRS
SWTEATISQVTSQSNRYKVTHENYLQDRNQVVMSLEKELEDNLVLNKTLA
SQYRSLQTDYYTMLDGFLDVIQEQLWGENNIKSIKEVQRLQKFMHNNLEI
FFALKLMYDDNLFFDLSQQSGKSEEKVKQIRLKYMAHIETMTEFLESNFS
GEYQRLIAEK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR038826CCDC178
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 220..240
NoneNo IPR availableCOILSCoilCoilcoord: 174..198
NoneNo IPR availableCOILSCoilCoilcoord: 445..479
NoneNo IPR availableCOILSCoilCoilcoord: 516..564
NoneNo IPR availableCOILSCoilCoilcoord: 117..137
NoneNo IPR availableCOILSCoilCoilcoord: 361..409
NoneNo IPR availableCOILSCoilCoilcoord: 308..349
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 230..264
IPR038826Coiled-coil domain-containing protein 178PANTHERPTHR35088FAMILY NOT NAMEDcoord: 101..791