SMED30029152

Overview
NameSMED30029152
Smed IDSMED30029152
Length (bp)3754
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30029152 (SMED30029152) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30029152 (SMED30029152) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30029152 (SMED30029152) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30029152 (SMED30029152) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029152

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30029152SMESG000017036.1 SmedASXL_013759SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30029152SMESG000017036.1 dd_Smed_v4_17066_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30029152SMESG000017036.1 dd_Smed_v4_12630_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30029152SMESG000017036.1 dd_Smed_v4_12630_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30029152SMESG000017036.1 dd_Smed_v6_12630_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30029152SMESG000017036.1 dd_Smed_v6_17066_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30029152SMESG000017036.1 dd_Smed_v4_12630_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30029152SMESG000017036.1 dd_Smed_v4_12630_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30029152 vs. Ensembl Xenopus
Match: CEP152 (centrosomal protein 152kDa [Source:NCBI gene;Acc:100380166])

HSP 1 Score: 55.0694 bits (131), Expect = 9.782e-7
Identity = 119/548 (21.72%), Postives = 259/548 (47.26%), Query Frame = 2
Query:  773 LELLYSARGKRIXXXXXXXXXXREKRMKETRISNHKVMLMESELKSQSNVVSRSLXXXXXXRQTAIDNQQIISHQTDQIAQLNRNIEELQEKSQSSKIVIDSLNEQISELTSSNLISKSNQKQSDLLDCINRQFDSDSQRLRSEIHRLSGRLDEKIQEIDRLETLLDEKSELQRNEKENWKVE----FKRIQEELESERKYCKELEKCQSQKKIEELNKEIGDLNLKQSLEEDLTNLLKEQVQDLSHQLFVYEKSMNLLDISDVGFHLNGSDYQQENKNYHRSSCPVL----STVGRMEMENGDRESSAEHYKILELQKQL--FLLTNRTH-----SLTNRLLDVRKINLDSKCSGKKFQKLAEDYRQSKENLEVKITEMEKRLKEILSEEETTAEKHLKISIESLKTINSSLEQECKSLQTQLKQATSSMAESHRHYKQLEGEFEAFKQFAHEDKETSIEHIKQVCNNHYDNLR----EQLEQSWMSEREVLLEEANSQREKILRDLSDAINEVDRVKNLYIQLSQQKSNEESERTNWNEWLDKKLQ 2359
            L++LY ARG+++E+    L    E+  ++ R  NH++ +++ +    +  +  S +  +  R+  I  +  ++     +  +  N E L+++   +K+ ++S+ +Q+ +L  S  I ++ ++   ++  + ++ +     L+ ++  ++  L+E+ +   RLE  L    +L    +E  K+E      R+ + LE  +K C  L +  S ++   L  ++  +   + + + +   L+E+V++L  Q+ +YE +  L      G  +NG + QQ + +Y       +    S +GR+   NG +   +    ILEL+ +L   L +N+T      +L   L      N + K S ++ ++ A D +   ENL  K+   +K   + LS +E   E      ++ L++    L+QE +     +K+ T++  +     ++L  E     Q    DK+ +IE  ++    H ++++    ++L + + SE+E L ++   +  ++   +++  NE+  V+  YI L ++K   E    N  E L K+LQ
Sbjct:  267 LQVLYKARGRQLEEQNNNL----EECERQIRYLNHQLAIVKDQKDGLTISLQESQKLLQNSREMEIQLKGQLTALQKTVESVTTNEEHLRKELNVAKVAMESMQQQLLDLRRSESIQRAREQHETVVSMLKKKNEEQVLVLQQKLDDINAALNEEKELCRRLEDRL----KLSERNQEESKLEKTDIINRLSKSLEESQKQCANLLQSGSIQEASHLRLQLQQVQSSKIITDGMNKALQEEVRELQEQITMYESAARL------GVFVNGGEEQQLSDSYVELGIKKVNWQKSQLGRVVSHNGVKNDLSSEEIILELKSELERCLNSNKTKRKQIVTLQADLKGHVSKNEELKKSLEEAERTARDNQIRAENLANKV---DKSPFQYLSSDEFREE------LQKLQSEKQILQQENEKYLLHIKELTANEEKLKVANQELCNEMRGMIQDFDRDKKEAIERCERTYEQHNEDIKVHLLKELYEKFESEKEQLSQDYEEKMTRLQTQMNEMHNEMTAVQECYITLCKEKDALED---NTKEHLKKQLQ 788          
BLAST of SMED30029152 vs. Ensembl Xenopus
Match: CEP152 (centrosomal protein 152kDa [Source:NCBI gene;Acc:100380166])

HSP 1 Score: 53.9138 bits (128), Expect = 2.193e-6
Identity = 119/548 (21.72%), Postives = 259/548 (47.26%), Query Frame = 2
Query:  773 LELLYSARGKRIXXXXXXXXXXREKRMKETRISNHKVMLMESELKSQSNVVSRSLXXXXXXRQTAIDNQQIISHQTDQIAQLNRNIEELQEKSQSSKIVIDSLNEQISELTSSNLISKSNQKQSDLLDCINRQFDSDSQRLRSEIHRLSGRLDEKIQEIDRLETLLDEKSELQRNEKENWKVE----FKRIQEELESERKYCKELEKCQSQKKIEELNKEIGDLNLKQSLEEDLTNLLKEQVQDLSHQLFVYEKSMNLLDISDVGFHLNGSDYQQENKNYHRSSCPVL----STVGRMEMENGDRESSAEHYKILELQKQL--FLLTNRTH-----SLTNRLLDVRKINLDSKCSGKKFQKLAEDYRQSKENLEVKITEMEKRLKEILSEEETTAEKHLKISIESLKTINSSLEQECKSLQTQLKQATSSMAESHRHYKQLEGEFEAFKQFAHEDKETSIEHIKQVCNNHYDNLR----EQLEQSWMSEREVLLEEANSQREKILRDLSDAINEVDRVKNLYIQLSQQKSNEESERTNWNEWLDKKLQ 2359
            L++LY ARG+++E+    L    E+  ++ R  NH++ +++ +    +  +  S +  +  R+  I  +  ++     +  +  N E L+++   +K+ ++S+ +Q+ +L  S  I ++ ++   ++  + ++ +     L+ ++  ++  L+E+ +   RLE  L    +L    +E  K+E      R+ + LE  +K C  L +  S ++   L  ++  +   + + + +   L+E+V++L  Q+ +YE +  L      G  +NG + QQ + +Y       +    S +GR+   NG +   +    ILEL+ +L   L +N+T      +L   L      N + K S ++ ++ A D +   ENL  K+   +K   + LS +E   E      ++ L++    L+QE +     +K+ T++  +     ++L  E     Q    DK+ +IE  ++    H ++++    ++L + + SE+E L ++   +  ++   +++  NE+  V+  YI L ++K   E    N  E L K+LQ
Sbjct:  267 LQVLYKARGRQLEEQNNNL----EECERQIRYLNHQLAIVKDQKDGLTISLQESQKLLQNSREMEIQLKGQLTALQKTVESVTTNEEHLRKELNVAKVAMESMQQQLLDLRRSESIQRAREQHETVVSMLKKKNEEQVLVLQQKLDDINAALNEEKELCRRLEDRL----KLSERNQEESKLEKTDIINRLSKSLEESQKQCANLLQSGSIQEASHLRLQLQQVQSSKIITDGMNKALQEEVRELQEQITMYESAARL------GVFVNGGEEQQLSDSYVELGIKKVNWQKSQLGRVVSHNGVKNDLSSEEIILELKSELERCLNSNKTKRKQIVTLQADLKGHVSKNEELKKSLEEAERTARDNQIRAENLANKV---DKSPFQYLSSDEFREE------LQKLQSEKQILQQENEKYLLHIKELTANEEKLKVANQELCNEMRGMIQDFDRDKKEAIERCERTYEQHNEDIKVHLLKELYEKFESEKEQLSQDYEEKMTRLQTQMNEMHNEMTAVQECYITLCKEKDALED---NTKEHLKKQLQ 788          
BLAST of SMED30029152 vs. Ensembl Xenopus
Match: CEP152 (centrosomal protein 152kDa [Source:NCBI gene;Acc:100380166])

HSP 1 Score: 53.9138 bits (128), Expect = 2.260e-6
Identity = 119/548 (21.72%), Postives = 259/548 (47.26%), Query Frame = 2
Query:  773 LELLYSARGKRIXXXXXXXXXXREKRMKETRISNHKVMLMESELKSQSNVVSRSLXXXXXXRQTAIDNQQIISHQTDQIAQLNRNIEELQEKSQSSKIVIDSLNEQISELTSSNLISKSNQKQSDLLDCINRQFDSDSQRLRSEIHRLSGRLDEKIQEIDRLETLLDEKSELQRNEKENWKVE----FKRIQEELESERKYCKELEKCQSQKKIEELNKEIGDLNLKQSLEEDLTNLLKEQVQDLSHQLFVYEKSMNLLDISDVGFHLNGSDYQQENKNYHRSSCPVL----STVGRMEMENGDRESSAEHYKILELQKQL--FLLTNRTH-----SLTNRLLDVRKINLDSKCSGKKFQKLAEDYRQSKENLEVKITEMEKRLKEILSEEETTAEKHLKISIESLKTINSSLEQECKSLQTQLKQATSSMAESHRHYKQLEGEFEAFKQFAHEDKETSIEHIKQVCNNHYDNLR----EQLEQSWMSEREVLLEEANSQREKILRDLSDAINEVDRVKNLYIQLSQQKSNEESERTNWNEWLDKKLQ 2359
            L++LY ARG+++E+    L    E+  ++ R  NH++ +++ +    +  +  S +  +  R+  I  +  ++     +  +  N E L+++   +K+ ++S+ +Q+ +L  S  I ++ ++   ++  + ++ +     L+ ++  ++  L+E+ +   RLE  L    +L    +E  K+E      R+ + LE  +K C  L +  S ++   L  ++  +   + + + +   L+E+V++L  Q+ +YE +  L      G  +NG + QQ + +Y       +    S +GR+   NG +   +    ILEL+ +L   L +N+T      +L   L      N + K S ++ ++ A D +   ENL  K+   +K   + LS +E   E      ++ L++    L+QE +     +K+ T++  +     ++L  E     Q    DK+ +IE  ++    H ++++    ++L + + SE+E L ++   +  ++   +++  NE+  V+  YI L ++K   E    N  E L K+LQ
Sbjct:  267 LQVLYKARGRQLEEQNNNL----EECERQIRYLNHQLAIVKDQKDGLTISLQESQKLLQNSREMEIQLKGQLTALQKTVESVTTNEEHLRKELNVAKVAMESMQQQLLDLRRSESIQRAREQHETVVSMLKKKNEEQVLVLQQKLDDINAALNEEKELCRRLEDRL----KLSERNQEESKLEKTDIINRLSKSLEESQKQCANLLQSGSIQEASHLRLQLQQVQSSKIITDGMNKALQEEVRELQEQITMYESAARL------GVFVNGGEEQQLSDSYVELGIKKVNWQKSQLGRVVSHNGVKNDLSSEEIILELKSELERCLNSNKTKRKQIVTLQADLKGHVSKNEELKKSLEEAERTARDNQIRAENLANKV---DKSPFQYLSSDEFREE------LQKLQSEKQILQQENEKYLLHIKELTANEEKLKVANQELCNEMRGMIQDFDRDKKEAIERCERTYEQHNEDIKVHLLKELYEKFESEKEQLSQDYEEKMTRLQTQMNEMHNEMTAVQECYITLCKEKDALED---NTKEHLKKQLQ 788          
BLAST of SMED30029152 vs. TrEMBL
Match: A0A193GS51 (Cep152 OS=Patiria miniata OX=46514 PE=2 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 2.866e-15
Identity = 125/540 (23.15%), Postives = 256/540 (47.41%), Query Frame = 2
Query:  758 RELDNLELLYSARGKRIXXXXXXXXXXREKRMKETRISNHKVMLMESELKSQSNVVSRSLXXXXXXRQTAIDNQQIISHQTDQIAQLNRNIEELQEKSQSSKIVIDSLNEQISELTSSNLISKSNQKQSDLLDCINRQFDSDSQRLRSEIHRLSGRLDEKIQEIDRLE---TLLDEKSELQRNEKENWKVEFKRIQEELESERKYCKELEKCQSQKKIEELNKEIGDLNLKQSLEEDLTNLLKEQVQDLSHQLFVYEKSMNL---LDISDVGFH---------LNGSDYQ-QENKNYHRSSCPVLSTVG-----RMEMENGDRESSAEHYKILELQKQLFLLTNRTHSLTNRLLDVRKINLDSKCSGKKFQKLAEDYRQSKENLEVKITEMEKRLKEILSEEETTAEKHLKISIESLKTINSSLEQECKSLQTQLKQATSSMAESHRHYKQLEGEFEAFKQFAHEDKETSIEHIKQVC-NNHYD---NLREQLEQSWMSEREVLLEEANSQREKILRDLSDAINEVDRVKNLYIQLSQQK 2302
            R++  L++LY ARG+ ++QL  +L + +E+  ++ RI NH++ L + E    +    +  Q   E +Q     +  +     QI  LN    E++EK Q+++  I+SL  Q+SEL  S  ++++ ++Q  LL  +  +++ +  RL+ ++      L+EK  +I+ L    + + + +EL + E+ N       +  +L++ +K C++L +  S ++I  L  ++ +    ++  +D+T+ L+E++ ++  QL +YE +M L      S    H         L  SD++  ++      S P LS        R E+E   + +  +  ++ +LQ  L        +   RLL +     D                   + +  K+ E +    +     E T  +HL+  I+ L+T    + +  ++L+T+  +   + ++  +   Q+  E++       +DK+  +E +++ C   H D   +LRE+L   + SER++L E    Q +++  +L  A  E+D VK LYI + ++K
Sbjct:  389 RQMAQLQILYKARGRELDQLGNQLQVLKEESGRDKRILNHQLALAQGERAGATASYEQCQQLLGESQQENSKLKGQLQAAQVQIQALNAAKHEVEEKLQATESAIESLTGQLSELQRSQPLARAREQQDGLLKSLQERYEQEVTRLKEKVDNGERNLEEKSADIESLRRELSRVSKAAELAKLEQGN---TINTLTSQLQNSQKQCRDLLETGSLQEINLLRVQLQEATAARTFSQDMTSALQEELTEMKEQLQMYESAMELGVMASKSPESIHTSKSFAVRNLAKSDWKTPQSSRSSSDSAPKLSPEDLVQGLRKELERSLQSNRTKRAQVSKLQADLRTAKTDLEAGKTRLLGMETTAKD-------------------KEVRFKVLEAQLETTKASPTAERTTFRHLQDEIDKLRTEKEDMSKTLEALKTEEGRLNEANSDLKKQMVQMVTEWD-------QDKKIDMERVQKTCLQLHEDSSRHLREELVTEFQSERDMLKEAHQHQLQELRSELEQAQKELDAVKGLYIDVCEEK 899          
BLAST of SMED30029152 vs. TrEMBL
Match: A0A5K4F1C5 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 2.214e-14
Identity = 84/316 (26.58%), Postives = 168/316 (53.16%), Query Frame = 2
Query:  767 DNLELLYSARGKRIXXXXXXXXXXREKRMKETRISNHKVMLMESE---LKSQSNVVSRSLXXXXXXRQTAIDNQQIISHQTDQIAQLNRNIEELQEKSQSSKIVIDSLNEQIS----ELTSSNLISKSNQKQSDLLDCINRQFDSDSQRLRSEIHRLSGRLDEKIQEIDRLETLLD-EKSELQRNEKENWKVEFKRIQEELESERKYCKELEKCQSQKKIEELNKEIGDLNLKQSLEEDLTNLLKEQVQDLSHQLFVYEKSMNLLDISDVGFHLNGSDYQQENKNYHRSSCPVLSTVGRMEMENGDRESSAEHYKI 1690
            D  ELLY+ARG ++++LQ E+   RE   KE R+SNH+++L E +   L+S+ + +  ++    ++      N +++        QL RN EE Q+K     I + S NE +S    ELT+ N + ++ ++++ L++ + ++F S ++ +++E++     L EK  E+  L   L+  K+E+ + ++ + K+      ++LE  +K+C++L       ++  L +++ +L   + + ED+  +L+++++D   Q+ +YE  + L    D  FH NG+D  Q   +Y  S    + T GR   ++     + EH  I
Sbjct:  311 DRRELLYAARGYQLQELQTEIIQLREDIAKEKRLSNHRLLLAEGDKETLRSKLSAMEDTVNSLRKELVAKQGNSEVLQ------KQLKRN-EEFQKKLNEELIALRSTNESLSSQLVELTTGNALKRAEEREAQLIESLEQRFISKTEEIKAELNTTQRNLTEKEVEVTGLRRQLEISKAEIIKAQQTHHKM-INEANKQLEEAQKHCQQLASSALCSEVTSLRQKVIELETSKKITEDVNKILQDELRDFRDQVSIYESVLKL----DAYFHNNGNDENQ--FSYESSEFTPIGTKGRHSGKSVAFADTIEHSHI 612          
BLAST of SMED30029152 vs. TrEMBL
Match: A0A183M104 (Uncharacterized protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS9729 PE=4 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 5.558e-14
Identity = 73/277 (26.35%), Postives = 156/277 (56.32%), Query Frame = 2
Query:  767 DNLELLYSARGKRIXXXXXXXXXXREKRMKETRISNHKVMLMESE---LKSQSNVVSRSLXXXXXXRQTAIDNQQIISHQTDQIAQLNRNIEELQEKSQSSKIVIDSLNEQISELTSSNLISKSNQKQSDLLDCINRQFDSDSQRLRSEIHRLSGRLDEKIQEIDRLETLLD-EKSELQRNEKENWKVEFKRIQEELESERKYCKELEKCQSQKKIEELNKEIGDLNLKQSLEEDLTNLLKEQVQDLSHQLFVYEKSMNLLDISDVGFHLNGSDYQQ 1585
            D  ELLY+ARG +++ LQ E    RE   KE R+SNH+++L E +   L+S+ + +  +++   E+     +N +++  Q  Q  +L + ++E     +S+    +SL+ Q+ ELT+ N + ++ ++++ L + + ++F S ++ +R+E++     L +K  E+  L   L+  K+E+ + ++ + K+      ++LE  +K+C++L       ++  L +++ +L   + + ED+  +L+++++D   Q+ +YE  + L    DV FH NG+D  Q
Sbjct:  105 DRRELLYAARGHQLQVLQTENVQLREDIAKEKRLSNHRLLLAEGDKEILRSKLSAMEDTVKSLREELVAKQENSEVLQKQLKQNEELQKKLDEELRALRSTN---ESLSSQLVELTTGNALKRAEEREAQLTEHLEQRFISKTEEIRAELNTTQRHLTQKEVEVTDLRRQLEISKAEIIKAQQTHNKM-INEANKQLEEAQKHCQQLASSALCSEVTSLRQKVIELETSKKITEDVNKILQDELRDFRDQVSIYESVLKL----DVYFHNNGNDENQ 373          
BLAST of SMED30029152 vs. TrEMBL
Match: G4VAR3 (Putative cation efflux protein/ zinc transporter OS=Schistosoma mansoni OX=6183 GN=Smp_170590 PE=4 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 6.721e-14
Identity = 84/316 (26.58%), Postives = 168/316 (53.16%), Query Frame = 2
Query:  767 DNLELLYSARGKRIXXXXXXXXXXREKRMKETRISNHKVMLMESE---LKSQSNVVSRSLXXXXXXRQTAIDNQQIISHQTDQIAQLNRNIEELQEKSQSSKIVIDSLNE----QISELTSSNLISKSNQKQSDLLDCINRQFDSDSQRLRSEIHRLSGRLDEKIQEIDRLETLLD-EKSELQRNEKENWKVEFKRIQEELESERKYCKELEKCQSQKKIEELNKEIGDLNLKQSLEEDLTNLLKEQVQDLSHQLFVYEKSMNLLDISDVGFHLNGSDYQQENKNYHRSSCPVLSTVGRMEMENGDRESSAEHYKI 1690
            D  ELLY+ARG ++++LQ E+   RE   KE R+SNH+++L E +   L+S+ + +  ++    ++      N +++        QL RN EE Q+K     I + S NE    Q+ ELT+ N + ++ ++++ L++ + ++F S ++ +++E++     L EK  E+  L   L+  K+E+ + ++ + K+      ++LE  +K+C++L       ++  L +++ +L   + + ED+  +L+++++D   Q+ +YE  + L    D  FH NG+D  Q   +Y  S    + T GR   ++     + EH  I
Sbjct:  311 DRRELLYAARGYQLQELQTEIIQLREDIAKEKRLSNHRLLLAEGDKETLRSKLSAMEDTVNSLRKELVAKQGNSEVLQ------KQLKRN-EEFQKKLNEELIALRSTNESLSSQLVELTTGNALKRAEEREAQLIESLEQRFISKTEEIKAELNTTQRNLTEKEVEVTGLRRQLEISKAEIIKAQQTHHKM-INEANKQLEEAQKHCQQLASSALCSEVTSLRQKVIELETSKKITEDVNKILQDELRDFRDQVSIYESVLKL----DAYFHNNGNDENQ--FSYESSEFTPIGTKGRHSGKSVAFADTIEHSHI 612          
BLAST of SMED30029152 vs. TrEMBL
Match: A0A267H660 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032283g1 PE=4 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 2.706e-13
Identity = 119/531 (22.41%), Postives = 240/531 (45.20%), Query Frame = 2
Query:  656 NAVPSVPQHLKSSLNTGIKLTTRDVAIECIPATQRELDNLELLYSARGKRIXXXXXXXXXXREKRMKETRISNHKVMLMESELKSQSNVVS-------------RSLXXXXXXRQTAIDNQQIISHQTDQIAQLNRNIEELQEKSQSSKIVIDSLNEQISELTSSNLISKSNQKQSDLLDCINRQFDSDSQRLRSEIHRLSGRLDEKIQEIDRLETLLDEKSELQRNEKENWKVEFKRIQEELESERKYCKELEKCQSQKKI-EELNKEIGDLNLKQSLEEDLTNLLKEQVQDLSHQLFVYEKSMNLLDISDVGFHLNGSDYQQENKNYHRSSCPVLSTVGRMEMENGDRESS-----AEHYKILELQKQLFLLTNRTHSLTNRLLDVRKINLDSKCSGKKFQKLAEDYRQSKENLEVKI-TEMEKR---LKEILSEEETTAEKHLKISIESLKTINSSLEQECKSLQTQLKQATSSMAESHRHYKQLEGEFEAFKQFAHEDKETSIEHIKQVCNNHYDNLREQLEQSWMS 2179
            N +P   +H + +   G+     DV +  +P  QR+LD L++LY ARG+ IE+L+ +L   +E   KE R+  HK+ L E+  +S   V S             RSL+E+  +RQ             +  A+L    E+LQ +   +    ++L  Q++E+T++  I +   +Q + +  +  + D +   L+  I RL    +++  ++D    L  +    Q  +  +   +   + ++L   ++ C++L    +  +I   L  ++   +L +S+ E++ + L+E++ DL  QL +YE +  LL  S        +   +  +    +S P +         + DR+ S     AE  +  +L KQ      +   L   L+ ++K + +S+   ++ +    D R+    +E +I +E +K+          +    E  L+  + + +   + LE    S+Q++L Q++ +        +QL+ EF A    A +DK    E I++ C  H+D  RE++ +  ++
Sbjct:  239 NILPPSMRHSQLTRPRGV-----DVGVSVVPENQRDLDQLDILYRARGRHIEELKAQLTELQESSAKEARLLKHKLALTEANRESAEKVASSTEDRLKEALEQIRSLKEESAKRQ-------------ELTAKLLAENEQLQRQLTEAGCQNEALTAQLTEMTTAGTIGRVRDQQENFIQSLRNKKDEEIFYLKDRIDRLQSEAEQRQADLDAARALATKLGSQQSQQVVDANKQVAAMAQQLHEAQQRCQDLLAGGADSEIVGNLRHQLAQRDLAKSITEEMNSALQEEIADLREQLAMYETAERLLPTSLRSPAAGTAGATEGGREATSTSMPGVGA-------STDRDKSVACLRAELLRCQDLYKQ---KREKVSELQKELIQLKKSSHESRLRCERAELALNDQREQSVAMETRIRSEAQKQQEEAVAAAVAKLKAEEDQLRKQLAAAEERAAELESRLSSVQSELSQSSEAQRSLSAQCEQLQSEFAAAWDRAEQDKAAEFERIQRTCQAHFDLCREKMREELLA 741          
BLAST of SMED30029152 vs. Ensembl Nematostella
Match: EDO46525 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPK0])

HSP 1 Score: 74.3294 bits (181), Expect = 3.145e-13
Identity = 67/275 (24.36%), Postives = 145/275 (52.73%), Query Frame = 2
Query:  773 LELLYSARGKRIXXXXXXXXXXREKRMKETRISNHKVMLMESELKSQSNVVSRSLXXXXXXRQTAIDNQQIISHQTDQIAQLNRNIEELQ-EKSQSSKIV------IDSLNEQISELTSSNLISKSNQKQSDLLDCINRQFDSDSQRLRSEIHRLSGRLDEKIQEIDRLETLLDEKSELQRNEKENWKVEFKRIQEELESERKYCKELEKCQSQKKIEELNKEIGDLNLKQSLEEDLTNLLKEQVQDLSHQLFVYEKSMNLLDISDVGFHLNGSD 1576
            L++LY ARG++IE+L  +L  + E+  ++ R+ NH++M+++ E    ++ + ++       +Q A  ++Q IS   D++    + I ++Q EK Q+ +++      IDSLNEQ+S++T ++ ++K+ ++   +L+   ++ + +  RL+ ++      LD K +E +RL   + EK ++             R+ + L+  ++ C+EL +  +  ++  L  ++ D    ++  E   +  K +V DL  QL VY+ ++        GF  + +D
Sbjct:  413 LQVLYQARGRKIEELNNKLQKQEEELGRQIRVLNHQLMMVKDEHAGMASSLEQA-------QQIAQQSKQDISRVEDKLEASQKKISQIQQEKQQTEEMLHTANSTIDSLNEQLSQMTRADALTKAREQHESILNAARKRQEEEILRLKQKLDESRLSLDWKTEESNRLRDEVLEKGDI-----------INRLTKTLDDTQRQCQELVRTGTVAEVTSLRSQLRDALGARATAEKSVSSFKNEVTDLQEQLSVYQNALKY------GFGGDAAD 663          
BLAST of SMED30029152 vs. Planmine SMEST
Match: SMESG000017036.1 (SMESG000017036.1)

HSP 1 Score: 2154.79 bits (5582), Expect = 0.000e+0
Identity = 1166/1179 (98.90%), Postives = 1173/1179 (99.49%), Query Frame = 2
Query:  134 MEINYRNYVDLDEQEMRQDXXXXXXXXXXXXVNELDGIELDDNGYSNDESSGDFQEEDNNLLSKTLDEEASRYEIESPXXXXXXXXXXLYPYFNQLNTFVPNWPVNAFPQFCNIPISIGDXXXXXXXXXXXXXXXGIVDSSINWEISLYDEMGVSRVPHDGQFLSDKSEYSSSSNAVPSVPQHLKSSLNTGIKLTTRDVAIECIPATQRELDNLELLYSARGKRIXXXXXXXXXXREKRMKETRISNHKVMLMESELKSQSNVVSRSLXXXXXXRQTAIDNQQIISHQTDQIAQLNRNIEELQEKSQSSKIVIDSLNEQISELTSSNLISKSNQKQSDLLDCINRQFDSDSQRLRSEIHRLSGRLDEKIQEIDRLETLLDEKSELQRNEKENWKVEFKRIQEELESERKYCKELEKCQSQKKIEELNKEIGDLNLKQSLEEDLTNLLKEQVQDLSHQLFVYEKSMNLLDISDVGFHLNGSDYQQENKNYHRSSCPVLSTVGRMEMENGDRESSAEHYKILELQKQLFLLTNRTHSLTNRLLDVRKINLDSKCSGKKFQKLAEDYRQSKENLEVKITEMEKRLKEILSEEETTAEKHLKISIESLKTINSSLEQECKSLQTQLKQATSSMAESHRHYKQLEGEFEAFKQFAHEDKETSIEHIKQVCNNHYDNLREQLEQSWMSEREVLLEEANSQREKILRDLSDAINEVDRVKNLYIQLSQQKSNEESERTNWNEWLDKKLQEQKRSLNQQFKTDQDNXXXXXXXXXXXXXXXVRSEIDRRVPQHEKAVGTDKLEELSIATIETRDCSIQVDSLKDMRDLVDQLRSSNRNFETVVKDLEAENEKIRREYEMINSQKLAVENENLLLSSKVTFVKSPSTTDFEKFNFSTRNQQNVEVLNQMPNIIRSTTPQLILDSKRHNNSSSNPRISTTKIHQQFKRLKEDLITQLSKIPNSIPIVDYCSDDISYLNGSHSIMLSSIDSLSEREMNEVKQKLYNIVLDIQARAASTLQLELQKAHSLIRKSLLEKIRNVIPILLSVDGQLIDIPASKIKILSDRIILMLNHLETDDDGKLFXXXXXXXXXXXXXXXXXRNHKSPLSFHPDISIIKFTDACNGSCDDAINSNKARESLLQEKCIKLKDEISQLSEALYKSGSQNISSSQAFCPFQNVDKSILSDIRYSQ 3670
            MEINYRNYVDLDEQEMRQDEEKQIKEIQELLVNELDGIELDDNGYSNDESSGDFQEEDNNLLSKTLDEEASRYEIESPNNNYNGKDNNLYPYFNQ+NTFVPNWPVNAFPQFCNIPISIGDNKNNFQYTYQQTNNNGIVDSSINWEISLYDEMGVSRVPHDGQFLSDK EYSSSSNAVPSVPQHLKSS+NTG KLTTRDVAIECIPATQRELDNLELLYSARGKRIEQLQQELDLEREKRMKETRISNHKVMLMESELKSQSNVVSRSLQEQEEQRQTAIDNQQIISHQTDQIAQLNRNIEELQEKSQSSKIVIDSLNEQISELTSSNLISKSNQKQSDLLDCINRQFDSDSQRLRSEIHRLSGRLDEKIQEIDRLETLLDEKSELQRNEKENWKVEFKRIQEELESERKYCKELEKCQSQKKIEELNKEIGDLNLKQSLEEDLTNLLKEQVQDLSHQLFVYEKSMNLLDISD GFHLNGSDYQQENKNYHRSSCPVLSTVGRMEMENGDRESSAEHYKILELQKQLFLLTNRTHSLTNRLLDVRKINLDSKCSGKKFQKLAEDYRQSKENLEVKITEMEKRLKEILSEEETTAEKHLKISIESLKTINSSLEQECKSLQTQLKQATSSMAESHRHYKQLEGEFEAFKQFAHEDKETSIEHIKQVCNNHYDNLREQLEQSWMSER+VLLEEANSQREKILRDLSDAINEVDRVKNLYIQLSQQKSNEESERTNWNEWLDKKLQEQKRSLNQQFKTDQDNIIEEIRIQHREELEIVRSEIDRRVPQHEKAVGTDKLEELSIATIETRDCSIQVDSLKDMRDLVDQLRSSNRNFETVVKDLEAENEKIRREYEMINSQKLAVENENLLLSSKVTFVKSPSTTDFEK NFSTRNQQNVEVLNQMPNIIRSTTPQLILDSKRHNNSSSNPRISTTKIHQQFKRLKEDLITQLSKIPNSIPIVDYCSDDISYLNGSHSI+LSSIDSLSEREMNEVKQKLYNIVLDIQ+RAASTLQLELQKAHSLIRKSLLEKIRNVIPILLSVDGQLIDIPASKIKILSDRIILMLNHLETDDDGKLFIPNPINSSFPFSSTSTPRNHKSPLSFHPDISIIKF+D CNGSCD+ INSNKARESLLQEKCIKLKDEISQLSEALYKSGSQNISSSQAFCPFQNVDKSILSDIRYSQ
Sbjct:    1 MEINYRNYVDLDEQEMRQDEEKQIKEIQELLVNELDGIELDDNGYSNDESSGDFQEEDNNLLSKTLDEEASRYEIESPNNNYNGKDNNLYPYFNQINTFVPNWPVNAFPQFCNIPISIGDNKNNFQYTYQQTNNNGIVDSSINWEISLYDEMGVSRVPHDGQFLSDKGEYSSSSNAVPSVPQHLKSSINTGTKLTTRDVAIECIPATQRELDNLELLYSARGKRIEQLQQELDLEREKRMKETRISNHKVMLMESELKSQSNVVSRSLQEQEEQRQTAIDNQQIISHQTDQIAQLNRNIEELQEKSQSSKIVIDSLNEQISELTSSNLISKSNQKQSDLLDCINRQFDSDSQRLRSEIHRLSGRLDEKIQEIDRLETLLDEKSELQRNEKENWKVEFKRIQEELESERKYCKELEKCQSQKKIEELNKEIGDLNLKQSLEEDLTNLLKEQVQDLSHQLFVYEKSMNLLDISDAGFHLNGSDYQQENKNYHRSSCPVLSTVGRMEMENGDRESSAEHYKILELQKQLFLLTNRTHSLTNRLLDVRKINLDSKCSGKKFQKLAEDYRQSKENLEVKITEMEKRLKEILSEEETTAEKHLKISIESLKTINSSLEQECKSLQTQLKQATSSMAESHRHYKQLEGEFEAFKQFAHEDKETSIEHIKQVCNNHYDNLREQLEQSWMSERDVLLEEANSQREKILRDLSDAINEVDRVKNLYIQLSQQKSNEESERTNWNEWLDKKLQEQKRSLNQQFKTDQDNIIEEIRIQHREELEIVRSEIDRRVPQHEKAVGTDKLEELSIATIETRDCSIQVDSLKDMRDLVDQLRSSNRNFETVVKDLEAENEKIRREYEMINSQKLAVENENLLLSSKVTFVKSPSTTDFEKLNFSTRNQQNVEVLNQMPNIIRSTTPQLILDSKRHNNSSSNPRISTTKIHQQFKRLKEDLITQLSKIPNSIPIVDYCSDDISYLNGSHSILLSSIDSLSEREMNEVKQKLYNIVLDIQSRAASTLQLELQKAHSLIRKSLLEKIRNVIPILLSVDGQLIDIPASKIKILSDRIILMLNHLETDDDGKLFIPNPINSSFPFSSTSTPRNHKSPLSFHPDISIIKFSDVCNGSCDEKINSNKARESLLQEKCIKLKDEISQLSEALYKSGSQNISSSQAFCPFQNVDKSILSDIRYSQ 1179          
BLAST of SMED30029152 vs. Planmine SMEST
Match: SMESG000017036.1 (SMESG000017036.1)

HSP 1 Score: 2042.7 bits (5291), Expect = 0.000e+0
Identity = 1109/1122 (98.84%), Postives = 1116/1122 (99.47%), Query Frame = 2
Query:  134 MEINYRNYVDLDEQEMRQDXXXXXXXXXXXXVNELDGIELDDNGYSNDESSGDFQEEDNNLLSKTLDEEASRYEIESPXXXXXXXXXXLYPYFNQLNTFVPNWPVNAFPQFCNIPISIGDXXXXXXXXXXXXXXXGIVDSSINWEISLYDEMGVSRVPHDGQFLSDKSEYSSSSNAVPSVPQHLKSSLNTGIKLTTRDVAIECIPATQRELDNLELLYSARGKRIXXXXXXXXXXREKRMKETRISNHKVMLMESELKSQSNVVSRSLXXXXXXRQTAIDNQQIISHQTDQIAQLNRNIEELQEKSQSSKIVIDSLNEQISELTSSNLISKSNQKQSDLLDCINRQFDSDSQRLRSEIHRLSGRLDEKIQEIDRLETLLDEKSELQRNEKENWKVEFKRIQEELESERKYCKELEKCQSQKKIEELNKEIGDLNLKQSLEEDLTNLLKEQVQDLSHQLFVYEKSMNLLDISDVGFHLNGSDYQQENKNYHRSSCPVLSTVGRMEMENGDRESSAEHYKILELQKQLFLLTNRTHSLTNRLLDVRKINLDSKCSGKKFQKLAEDYRQSKENLEVKITEMEKRLKEILSEEETTAEKHLKISIESLKTINSSLEQECKSLQTQLKQATSSMAESHRHYKQLEGEFEAFKQFAHEDKETSIEHIKQVCNNHYDNLREQLEQSWMSEREVLLEEANSQREKILRDLSDAINEVDRVKNLYIQLSQQKSNEESERTNWNEWLDKKLQEQKRSLNQQFKTDQDNXXXXXXXXXXXXXXXVRSEIDRRVPQHEKAVGTDKLEELSIATIETRDCSIQVDSLKDMRDLVDQLRSSNRNFETVVKDLEAENEKIRREYEMINSQKLAVENENLLLSSKVTFVKSPSTTDFEKFNFSTRNQQNVEVLNQMPNIIRSTTPQLILDSKRHNNSSSNPRISTTKIHQQFKRLKEDLITQLSKIPNSIPIVDYCSDDISYLNGSHSIMLSSIDSLSEREMNEVKQKLYNIVLDIQARAASTLQLELQKAHSLIRKSLLEKIRNVIPILLSVDGQLIDIPASKIKILSDRIILMLNHLETDDDGKLFXXXXXXXXXXXXXXXXXRNHKSPLSFHPDISIIKFTDACNGSCDDAINSN 3499
            MEINYRNYVDLDEQEMRQDEEKQIKEIQELLVNELDGIELDDNGYSNDESSGDFQEEDNNLLSKTLDEEASRYEIESPNNNYNGKDNNLYPYFNQ+NTFVPNWPVNAFPQFCNIPISIGDNKNNFQYTYQQTNNNGIVDSSINWEISLYDEMGVSRVPHDGQFLSDK EYSSSSNAVPSVPQHLKSS+NTG KLTTRDVAIECIPATQRELDNLELLYSARGKRIEQLQQELDLEREKRMKETRISNHKVMLMESELKSQSNVVSRSLQEQEEQRQTAIDNQQIISHQTDQIAQLNRNIEELQEKSQSSKIVIDSLNEQISELTSSNLISKSNQKQSDLLDCINRQFDSDSQRLRSEIHRLSGRLDEKIQEIDRLETLLDEKSELQRNEKENWKVEFKRIQEELESERKYCKELEKCQSQKKIEELNKEIGDLNLKQSLEEDLTNLLKEQVQDLSHQLFVYEKSMNLLDISD GFHLNGSDYQQENKNYHRSSCPVLSTVGRMEMENGDRESSAEHYKILELQKQLFLLTNRTHSLTNRLLDVRKINLDSKCSGKKFQKLAEDYRQSKENLEVKITEMEKRLKEILSEEETTAEKHLKISIESLKTINSSLEQECKSLQTQLKQATSSMAESHRHYKQLEGEFEAFKQFAHEDKETSIEHIKQVCNNHYDNLREQLEQSWMSER+VLLEEANSQREKILRDLSDAINEVDRVKNLYIQLSQQKSNEESERTNWNEWLDKKLQEQKRSLNQQFKTDQDNIIEEIRIQHREELEIVRSEIDRRVPQHEKAVGTDKLEELSIATIETRDCSIQVDSLKDMRDLVDQLRSSNRNFETVVKDLEAENEKIRREYEMINSQKLAVENENLLLSSKVTFVKSPSTTDFEK NFSTRNQQNVEVLNQMPNIIRSTTPQLILDSKRHNNSSSNPRISTTKIHQQFKRLKEDLITQLSKIPNSIPIVDYCSDDISYLNGSHSI+LSSIDSLSEREMNEVKQKLYNIVLDIQ+RAASTLQLELQKAHSLIRKSLLEKIRNVIPILLSVDGQLIDIPASKIKILSDRIILMLNHLETDDDGKLFIPNPINSSFPFSSTSTPRNHKSPLSFHPDISIIKF+D CNGSCD+ INSN
Sbjct:    1 MEINYRNYVDLDEQEMRQDEEKQIKEIQELLVNELDGIELDDNGYSNDESSGDFQEEDNNLLSKTLDEEASRYEIESPNNNYNGKDNNLYPYFNQINTFVPNWPVNAFPQFCNIPISIGDNKNNFQYTYQQTNNNGIVDSSINWEISLYDEMGVSRVPHDGQFLSDKGEYSSSSNAVPSVPQHLKSSINTGTKLTTRDVAIECIPATQRELDNLELLYSARGKRIEQLQQELDLEREKRMKETRISNHKVMLMESELKSQSNVVSRSLQEQEEQRQTAIDNQQIISHQTDQIAQLNRNIEELQEKSQSSKIVIDSLNEQISELTSSNLISKSNQKQSDLLDCINRQFDSDSQRLRSEIHRLSGRLDEKIQEIDRLETLLDEKSELQRNEKENWKVEFKRIQEELESERKYCKELEKCQSQKKIEELNKEIGDLNLKQSLEEDLTNLLKEQVQDLSHQLFVYEKSMNLLDISDAGFHLNGSDYQQENKNYHRSSCPVLSTVGRMEMENGDRESSAEHYKILELQKQLFLLTNRTHSLTNRLLDVRKINLDSKCSGKKFQKLAEDYRQSKENLEVKITEMEKRLKEILSEEETTAEKHLKISIESLKTINSSLEQECKSLQTQLKQATSSMAESHRHYKQLEGEFEAFKQFAHEDKETSIEHIKQVCNNHYDNLREQLEQSWMSERDVLLEEANSQREKILRDLSDAINEVDRVKNLYIQLSQQKSNEESERTNWNEWLDKKLQEQKRSLNQQFKTDQDNIIEEIRIQHREELEIVRSEIDRRVPQHEKAVGTDKLEELSIATIETRDCSIQVDSLKDMRDLVDQLRSSNRNFETVVKDLEAENEKIRREYEMINSQKLAVENENLLLSSKVTFVKSPSTTDFEKLNFSTRNQQNVEVLNQMPNIIRSTTPQLILDSKRHNNSSSNPRISTTKIHQQFKRLKEDLITQLSKIPNSIPIVDYCSDDISYLNGSHSILLSSIDSLSEREMNEVKQKLYNIVLDIQSRAASTLQLELQKAHSLIRKSLLEKIRNVIPILLSVDGQLIDIPASKIKILSDRIILMLNHLETDDDGKLFIPNPINSSFPFSSTSTPRNHKSPLSFHPDISIIKFSDVCNGSCDEKINSN 1122          
The following BLAST results are available for this feature:
BLAST of SMED30029152 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029152 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029152 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029152 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029152 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CEP1529.782e-721.72centrosomal protein 152kDa [Source:NCBI gene;Acc:1... [more]
CEP1522.193e-621.72centrosomal protein 152kDa [Source:NCBI gene;Acc:1... [more]
CEP1522.260e-621.72centrosomal protein 152kDa [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of SMED30029152 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029152 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029152 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193GS512.866e-1523.15Cep152 OS=Patiria miniata OX=46514 PE=2 SV=1[more]
A0A5K4F1C52.214e-1426.58Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A183M1045.558e-1426.35Uncharacterized protein OS=Schistosoma margrebowie... [more]
G4VAR36.721e-1426.58Putative cation efflux protein/ zinc transporter O... [more]
A0A267H6602.706e-1322.41Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of SMED30029152 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029152 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029152 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029152 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO465253.145e-1324.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30029152 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029152 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000017036.10.000e+098.90SMESG000017036.1[more]
SMESG000017036.10.000e+098.84SMESG000017036.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029152 ID=SMED30029152|Name=SMED30029152|organism=Schmidtea mediterranea sexual|type=transcript|length=3754bp
CAACCGCAAAATTAGTGTTTTGAATTTTAGAAGAAAATTCTTCATTTCTT
TATTATAGCGAAATTAATTTATTACAAATTTCATTTAAGAAATCTTTTTT
GATTAAATATTTTCTATATTTGATTGAGATCTCATGGAAATAAATTATCG
CAATTATGTGGATTTAGACGAACAAGAAATGCGTCAAGATGAAGAAAAAC
AGATTAAAGAAATTCAAGAACTATTGGTGAATGAACTAGATGGAATTGAA
TTAGATGATAATGGTTATAGTAATGATGAATCATCTGGTGACTTTCAAGA
AGAAGACAATAATTTACTTAGTAAGACATTGGATGAGGAGGCGTCAAGAT
ATGAAATTGAAAGTCCAAATAATAATTATAATGGAAAAGATAATAATTTG
TATCCATATTTTAATCAATTAAATACGTTTGTTCCAAATTGGCCTGTAAA
TGCTTTTCCGCAATTTTGCAATATCCCAATATCAATTGGAGATAACAAAA
ATAATTTTCAGTACACTTACCAACAAACGAATAATAATGGAATAGTCGAT
TCATCAATAAACTGGGAAATTAGTTTATATGATGAAATGGGAGTTTCACG
AGTCCCACACGATGGCCAGTTTTTGTCCGACAAGAGTGAATACAGCTCGT
CTTCAAATGCTGTGCCGTCAGTACCTCAGCACCTGAAATCATCCCTAAAT
ACCGGCATAAAACTCACCACCAGAGATGTTGCCATTGAATGCATTCCTGC
CACTCAGAGAGAACTTGATAATTTGGAATTGCTTTACTCAGCGCGCGGAA
AGCGGATAGAGCAACTGCAGCAGGAACTTGACCTGGAACGTGAGAAACGG
ATGAAAGAAACACGAATTAGCAATCACAAAGTGATGTTGATGGAAAGTGA
ATTGAAATCGCAGTCAAATGTTGTGAGTCGATCGCTGCAGGAACAGGAGG
AGCAGCGCCAAACGGCAATTGATAACCAGCAAATCATATCGCACCAGACC
GATCAGATCGCCCAGCTCAATCGTAACATTGAAGAGTTGCAAGAGAAATC
GCAATCCAGCAAAATCGTAATCGACAGCCTGAATGAGCAAATCTCAGAAT
TGACATCGAGCAATCTCATATCGAAATCCAATCAGAAGCAATCGGATTTA
TTGGACTGCATCAATCGGCAATTCGACAGCGATTCCCAGAGATTGAGATC
GGAAATCCATCGGCTGTCAGGGCGGCTCGATGAGAAAATCCAGGAAATCG
ATAGATTGGAAACCTTACTCGATGAGAAATCGGAACTCCAGCGGAACGAG
AAAGAAAATTGGAAAGTGGAATTCAAAAGGATTCAGGAAGAACTGGAATC
GGAGCGGAAATATTGCAAGGAATTAGAGAAATGCCAAAGCCAAAAGAAAA
TTGAAGAATTGAATAAGGAAATCGGAGATTTGAATCTTAAACAATCATTG
GAAGAAGATTTGACAAATTTACTGAAGGAGCAAGTGCAAGATTTGAGCCA
TCAGCTATTTGTCTATGAGAAATCGATGAATTTATTGGACATTTCCGATG
TGGGTTTCCATCTGAACGGGAGCGATTATCAACAGGAAAACAAGAACTAC
CATCGAAGCAGTTGCCCGGTATTATCAACGGTAGGTCGTATGGAAATGGA
GAATGGAGATAGAGAATCATCAGCGGAACATTACAAAATATTGGAGCTAC
AGAAGCAGTTGTTTCTACTCACTAATAGAACTCATTCATTGACCAATCGG
TTGCTGGATGTTCGCAAAATTAATCTCGATTCTAAATGCAGCGGAAAGAA
ATTTCAAAAGTTAGCAGAAGATTATCGGCAGTCGAAGGAAAATCTAGAGG
TTAAAATAACAGAAATGGAAAAGCGACTGAAAGAAATTCTATCCGAAGAA
GAAACTACTGCTGAAAAGCATCTAAAAATTTCCATTGAATCTCTCAAGAC
AATTAATAGCAGTCTTGAGCAAGAATGCAAAAGTCTTCAAACCCAATTGA
AACAGGCCACGAGCTCCATGGCGGAGTCACATAGACACTATAAGCAGTTA
GAAGGGGAATTTGAAGCGTTTAAACAATTTGCACACGAAGACAAAGAAAC
ATCAATTGAGCACATCAAACAAGTCTGTAACAATCACTATGACAACTTAA
GGGAACAGTTGGAACAGAGTTGGATGTCAGAGAGAGAGGTTTTGCTGGAG
GAGGCTAATAGCCAGCGGGAGAAAATACTCCGAGATCTGTCAGACGCAAT
CAATGAAGTTGATCGGGTGAAAAATCTCTATATCCAATTGTCGCAACAGA
AATCCAATGAGGAATCAGAACGAACCAATTGGAATGAATGGCTGGATAAA
AAACTCCAAGAACAGAAACGGTCATTGAATCAGCAATTCAAAACCGATCA
AGATAACATCATCGAAGAAATACGAATCCAGCATCGGGAGGAGCTGGAAA
TTGTGAGATCCGAAATCGATCGGCGAGTTCCACAACACGAGAAAGCAGTT
GGAACAGATAAATTGGAAGAATTGTCGATTGCAACTATCGAAACACGAGA
TTGTTCAATACAAGTGGACAGTTTGAAAGATATGAGAGATCTGGTGGATC
AATTGCGTTCTAGCAATCGGAACTTTGAAACCGTTGTCAAGGATTTGGAA
GCGGAAAATGAGAAGATTCGAAGGGAATACGAAATGATAAACTCTCAGAA
ATTAGCCGTTGAAAATGAAAATCTCTTACTGTCATCGAAAGTCACTTTTG
TTAAATCGCCATCAACTACTGACTTTGAAAAGTTTAATTTCTCAACGAGG
AATCAACAAAATGTGGAGGTACTCAATCAAATGCCCAACATAATTAGGTC
AACCACTCCACAATTGATACTGGATTCTAAGAGGCATAATAATTCCTCAT
CAAATCCTCGTATTTCCACGACAAAAATACACCAACAATTCAAACGGCTG
AAAGAAGATTTAATAACACAATTATCCAAAATTCCAAATTCAATTCCTAT
TGTAGATTATTGTTCCGACGATATTTCATATTTAAATGGGTCACATAGTA
TAATGTTGTCCTCAATCGATTCATTGTCTGAGAGGGAAATGAATGAAGTC
AAACAAAAGCTCTATAATATTGTCCTTGACATCCAAGCAAGAGCAGCATC
AACATTGCAATTGGAATTGCAAAAAGCGCATTCACTCATACGTAAATCTC
TATTGGAAAAGATTCGGAATGTGATTCCGATCTTGCTGTCAGTTGATGGG
CAACTGATTGATATTCCAGCATCAAAGATCAAAATCCTTTCTGATCGGAT
CATTTTGATGCTTAATCACTTGGAAACTGATGATGATGGCAAACTTTTTA
TCCCGAATCCTATAAATTCTTCTTTTCCTTTCTCTTCGACATCTACGCCA
AGAAATCACAAATCTCCATTGAGTTTTCATCCTGATATATCGATTATCAA
GTTCACTGATGCTTGCAATGGTTCCTGTGACGACGCGATCAATTCAAATA
AGGCGCGTGAAAGTTTACTTCAAGAAAAATGCATAAAGTTAAAAGATGAA
ATATCTCAATTATCAGAGGCATTATATAAATCCGGTAGTCAAAATATATC
TTCATCTCAGGCGTTTTGTCCCTTCCAAAACGTTGACAAATCGATTCTTT
CCGACATCAGATATTCACAATAACCAACAGGAATCTGTGATAATGTACAG
CTTTCAATTAATTTTGTAAATGAATTAAAATTTGCTTTGATTTTTATTCA
AAAT
back to top

protein sequence of SMED30029152-orf-1

>SMED30029152-orf-1 ID=SMED30029152-orf-1|Name=SMED30029152-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1180bp
MEINYRNYVDLDEQEMRQDEEKQIKEIQELLVNELDGIELDDNGYSNDES
SGDFQEEDNNLLSKTLDEEASRYEIESPNNNYNGKDNNLYPYFNQLNTFV
PNWPVNAFPQFCNIPISIGDNKNNFQYTYQQTNNNGIVDSSINWEISLYD
EMGVSRVPHDGQFLSDKSEYSSSSNAVPSVPQHLKSSLNTGIKLTTRDVA
IECIPATQRELDNLELLYSARGKRIEQLQQELDLEREKRMKETRISNHKV
MLMESELKSQSNVVSRSLQEQEEQRQTAIDNQQIISHQTDQIAQLNRNIE
ELQEKSQSSKIVIDSLNEQISELTSSNLISKSNQKQSDLLDCINRQFDSD
SQRLRSEIHRLSGRLDEKIQEIDRLETLLDEKSELQRNEKENWKVEFKRI
QEELESERKYCKELEKCQSQKKIEELNKEIGDLNLKQSLEEDLTNLLKEQ
VQDLSHQLFVYEKSMNLLDISDVGFHLNGSDYQQENKNYHRSSCPVLSTV
GRMEMENGDRESSAEHYKILELQKQLFLLTNRTHSLTNRLLDVRKINLDS
KCSGKKFQKLAEDYRQSKENLEVKITEMEKRLKEILSEEETTAEKHLKIS
IESLKTINSSLEQECKSLQTQLKQATSSMAESHRHYKQLEGEFEAFKQFA
HEDKETSIEHIKQVCNNHYDNLREQLEQSWMSEREVLLEEANSQREKILR
DLSDAINEVDRVKNLYIQLSQQKSNEESERTNWNEWLDKKLQEQKRSLNQ
QFKTDQDNIIEEIRIQHREELEIVRSEIDRRVPQHEKAVGTDKLEELSIA
TIETRDCSIQVDSLKDMRDLVDQLRSSNRNFETVVKDLEAENEKIRREYE
MINSQKLAVENENLLLSSKVTFVKSPSTTDFEKFNFSTRNQQNVEVLNQM
PNIIRSTTPQLILDSKRHNNSSSNPRISTTKIHQQFKRLKEDLITQLSKI
PNSIPIVDYCSDDISYLNGSHSIMLSSIDSLSEREMNEVKQKLYNIVLDI
QARAASTLQLELQKAHSLIRKSLLEKIRNVIPILLSVDGQLIDIPASKIK
ILSDRIILMLNHLETDDDGKLFIPNPINSSFPFSSTSTPRNHKSPLSFHP
DISIIKFTDACNGSCDDAINSNKARESLLQEKCIKLKDEISQLSEALYKS
GSQNISSSQAFCPFQNVDKSILSDIRYSQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR029598Cep152
Vocabulary: cellular component
TermDefinition
GO:0005815microtubule organizing center
GO:0098536deuterosome
Vocabulary: biological process
TermDefinition
GO:0007099centriole replication
GO:0098535de novo centriole assembly involved in multi-ciliated epithelial cell differentiation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 211..245
NoneNo IPR availableCOILSCoilCoilcoord: 601..628
NoneNo IPR availableCOILSCoilCoilcoord: 561..588
NoneNo IPR availableCOILSCoilCoilcoord: 351..403
NoneNo IPR availableCOILSCoilCoilcoord: 821..862
NoneNo IPR availableCOILSCoilCoilcoord: 688..729
NoneNo IPR availableCOILSCoilCoilcoord: 285..319
NoneNo IPR availablePANTHERPTHR10337SHC TRANSFORMING PROTEINcoord: 5..841
IPR029598Centrosomal protein of 152kDaPANTHERPTHR10337:SF6CENTROSOMAL PROTEIN OF 152 KDAcoord: 5..841