RNA-binding protein

Overview
NameRNA-binding protein
Smed IDSMED30029150
Length (bp)1386
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RNA-binding protein (SMED30029150) t-SNE clustered cells

Violin plots show distribution of expression levels for RNA-binding protein (SMED30029150) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RNA-binding protein (SMED30029150) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RNA-binding protein (SMED30029150) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029150

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30029150SMESG000040788.1 SmedASXL_014807SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30029150SMESG000040788.1 dd_Smed_v4_11304_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30029150SMESG000040788.1 dd_Smed_v4_11304_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029150SMESG000040788.1 dd_Smed_v4_11304_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30029150SMESG000040788.1 dd_Smed_v4_11304_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RNA-binding protein vs. Ensembl Human
Match: RBM24 (RNA binding motif protein 24 [Source:HGNC Symbol;Acc:HGNC:21539])

HSP 1 Score: 156.377 bits (394), Expect = 3.117e-44
Identity = 76/107 (71.03%), Postives = 81/107 (75.70%), Query Frame = 3
Query:  372 MSHLHKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAILGAKPRNV-PSMNSLVDNLH 689
            M    KDTTYTKIFVGGLPYHTTD +LR YFE FGE+EEAVVITDRQTGKSRGYGFVTM +   A +A  DPNP IDGRK NVNLA LGAKPR + P     V  LH
Sbjct:    1 MHTTQKDTTYTKIFVGGLPYHTTDASLRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPIIDGRKANVNLAYLGAKPRIMQPGFAFGVQQLH 107          
BLAST of RNA-binding protein vs. Ensembl Human
Match: RBM38 (RNA binding motif protein 38 [Source:HGNC Symbol;Acc:HGNC:15818])

HSP 1 Score: 152.14 bits (383), Expect = 4.769e-44
Identity = 73/107 (68.22%), Postives = 84/107 (78.50%), Query Frame = 3
Query:  372 MSHLHKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAILGAKPRNVPSMNSL-VDNLH 689
            M    KDTT+TKIFVGGLPYHTTD +LR YFE FG++EEAVVITDRQTGKSRGYGFVTM +   A +A  DPNP IDGRK NVNLA LGAKPR++ +  ++ V  LH
Sbjct:    1 MHGSQKDTTFTKIFVGGLPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPIIDGRKANVNLAYLGAKPRSLQTGFAIGVQQLH 107          
BLAST of RNA-binding protein vs. Ensembl Human
Match: RBM38 (RNA binding motif protein 38 [Source:HGNC Symbol;Acc:HGNC:15818])

HSP 1 Score: 150.599 bits (379), Expect = 1.411e-43
Identity = 69/93 (74.19%), Postives = 78/93 (83.87%), Query Frame = 3
Query:  384 HKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAILGAKPRNVPS 662
             KDTT+TKIFVGGLPYHTTD +LR YFE FG++EEAVVITDRQTGKSRGYGFVTM +   A +A  DPNP IDGRK NVNLA LGAKPR++ +
Sbjct:   28 QKDTTFTKIFVGGLPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPIIDGRKANVNLAYLGAKPRSLQT 120          
BLAST of RNA-binding protein vs. Ensembl Human
Match: RBM38 (RNA binding motif protein 38 [Source:HGNC Symbol;Acc:HGNC:15818])

HSP 1 Score: 154.836 bits (390), Expect = 1.516e-43
Identity = 73/107 (68.22%), Postives = 84/107 (78.50%), Query Frame = 3
Query:  372 MSHLHKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAILGAKPRNVPSMNSL-VDNLH 689
            M    KDTT+TKIFVGGLPYHTTD +LR YFE FG++EEAVVITDRQTGKSRGYGFVTM +   A +A  DPNP IDGRK NVNLA LGAKPR++ +  ++ V  LH
Sbjct:   24 MHGSQKDTTFTKIFVGGLPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPIIDGRKANVNLAYLGAKPRSLQTGFAIGVQQLH 130          
BLAST of RNA-binding protein vs. Ensembl Human
Match: RBM24 (RNA binding motif protein 24 [Source:HGNC Symbol;Acc:HGNC:21539])

HSP 1 Score: 87.0409 bits (214), Expect = 1.588e-20
Identity = 44/66 (66.67%), Postives = 47/66 (71.21%), Query Frame = 3
Query:  495 VITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAILGAKPRNV-PSMNSLVDNLH 689
            VITDRQTGKSRGYGFVTM +   A +A  DPNP IDGRK NVNLA LGAKPR + P     V  LH
Sbjct:    1 VITDRQTGKSRGYGFVTMADRAAAERACKDPNPIIDGRKANVNLAYLGAKPRIMQPGFAFGVQQLH 66          
BLAST of RNA-binding protein vs. Ensembl Celegans
Match: sup-12 (SUPpressor [Source:UniProtKB/TrEMBL;Acc:O45189])

HSP 1 Score: 142.51 bits (358), Expect = 1.511e-40
Identity = 65/88 (73.86%), Postives = 73/88 (82.95%), Query Frame = 3
Query:  387 KDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAILGAKPR 650
            +DT +TKIFVGGLPYHT+D+TL  YFE FG++EEAVVITDR T KSRGYGFVTMK+   A +A  DPNP IDGRK NVNLA LGAKPR
Sbjct:   30 RDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPR 117          
BLAST of RNA-binding protein vs. Ensembl Celegans
Match: sup-12 (SUPpressor [Source:UniProtKB/TrEMBL;Acc:O45189])

HSP 1 Score: 144.05 bits (362), Expect = 6.815e-40
Identity = 72/139 (51.80%), Postives = 90/139 (64.75%), Query Frame = 3
Query:  387 KDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAILGAKPRNVPSMNSLVDNLHNIDQANRFNTILSSSYSNPLLNILYPTLQNNALLQPVL 803
            +DT +TKIFVGGLPYHT+D+TL  YFE FG++EEAVVITDR T KSRGYGFVTMK+   A +A  DPNP IDGRK NVNLA LGAKPR    + +L      +    +   +       P   + YPT+    L+ P++
Sbjct:   30 RDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQLAALAAGQVQLPLTTQLQALFQPRMGLP--QMYYPTV--TGLVNPLM 164          
BLAST of RNA-binding protein vs. Ensembl Celegans
Match: msi-1 (MuSashI (Fly neural) family; Neural RNA-binding protein MSI-1 [Source:UniProtKB/TrEMBL;Acc:G5EFS2])

HSP 1 Score: 65.4698 bits (158), Expect = 1.791e-11
Identity = 29/76 (38.16%), Postives = 47/76 (61.84%), Query Frame = 3
Query:  405 KIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAI 632
            K+F+GGL + TT E LR+YF  FGE+ E +V+ D  T ++RG+GF+T  +     K + +    +DG+K +  +A 
Sbjct:   46 KMFIGGLSWQTTAENLRDYFGRFGEVNECMVMRDPATKRARGFGFITFVDPSSVDKVLNNREHELDGKKIDPKVAF 121          

HSP 2 Score: 58.5362 bits (140), Expect = 3.444e-9
Identity = 25/60 (41.67%), Postives = 41/60 (68.33%), Query Frame = 3
Query:  393 TTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATK 572
            T   K+F+GGL   +T E ++ YFE +G++E+A+++ D+ T + RG+GFVT  + E A K
Sbjct:  131 TKTKKVFIGGLSATSTLEDMKQYFETYGKVEDAMLMFDKATQRHRGFGFVTFDSDEVADK 190          
BLAST of RNA-binding protein vs. Ensembl Celegans
Match: tiar-1 (TIA-1/TIAL RNA binding protein homolog [Source:UniProtKB/TrEMBL;Acc:Q95QV8])

HSP 1 Score: 64.6994 bits (156), Expect = 2.609e-11
Identity = 41/102 (40.20%), Postives = 57/102 (55.88%), Query Frame = 3
Query:  324 KRLLKNNEIPAN----PEHQMSHLHKDTT-YTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKT 614
            KRLL + E+  N    P  Q S +  DTT +  +FVG L     ++ LR  F+ FG++ +A VI D  T KS+GYGFV+    E+A +AI   N    GR+T
Sbjct:    3 KRLLLDREMKVNWAVEPGQQQSKI--DTTRHFHVFVGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGYGFVSYPKREEAERAIEQMNGQWLGRRT 102          
BLAST of RNA-binding protein vs. Ensembl Celegans
Match: tiar-1 (TIA-1/TIAL RNA binding protein homolog [Source:UniProtKB/TrEMBL;Acc:Q95QV8])

HSP 1 Score: 64.3142 bits (155), Expect = 5.630e-11
Identity = 41/102 (40.20%), Postives = 57/102 (55.88%), Query Frame = 3
Query:  324 KRLLKNNEIPAN----PEHQMSHLHKDTT-YTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKT 614
            KRLL + E+  N    P  Q S +  DTT +  +FVG L     ++ LR  F+ FG++ +A VI D  T KS+GYGFV+    E+A +AI   N    GR+T
Sbjct:  106 KRLLLDREMKVNWAVEPGQQQSKI--DTTRHFHVFVGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGYGFVSYPKREEAERAIEQMNGQWLGRRT 205          
BLAST of RNA-binding protein vs. Ensembl Fly
Match: Rbp6 (gene:FBgn0260943 transcript:FBtr0113427)

HSP 1 Score: 68.9366 bits (167), Expect = 3.603e-12
Identity = 29/76 (38.16%), Postives = 48/76 (63.16%), Query Frame = 3
Query:  405 KIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAI 632
            K+F+GGL + T+ E+LR+YF  +G++ EA+V+ D  T +SRG+GFVT  +     K +      +DG+K +  +A 
Sbjct:   30 KMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVLTQGTHELDGKKVDPKVAF 105          

HSP 2 Score: 63.929 bits (154), Expect = 1.334e-10
Identity = 31/70 (44.29%), Postives = 46/70 (65.71%), Query Frame = 3
Query:  375 SHLHKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILD 584
            +H    T   KIFVGGL   TT E +++YFE FG +E+A+++ D+QT + RG+GFVT + SED    + +
Sbjct:  109 AHPKMVTRTKKIFVGGLSAPTTLEDVKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQ-SEDVVDKVCE 177          
BLAST of RNA-binding protein vs. Ensembl Fly
Match: Rbp6 (gene:FBgn0260943 transcript:FBtr0075285)

HSP 1 Score: 68.1662 bits (165), Expect = 3.720e-12
Identity = 29/76 (38.16%), Postives = 48/76 (63.16%), Query Frame = 3
Query:  405 KIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAI 632
            K+F+GGL + T+ E+LR+YF  +G++ EA+V+ D  T +SRG+GFVT  +     K +      +DG+K +  +A 
Sbjct:   30 KMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVLTQGTHELDGKKVDPKVAF 105          

HSP 2 Score: 63.5438 bits (153), Expect = 1.240e-10
Identity = 31/70 (44.29%), Postives = 46/70 (65.71%), Query Frame = 3
Query:  375 SHLHKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILD 584
            +H    T   KIFVGGL   TT E +++YFE FG +E+A+++ D+QT + RG+GFVT + SED    + +
Sbjct:  109 AHPKMVTRTKKIFVGGLSAPTTLEDVKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQ-SEDVVDKVCE 177          
BLAST of RNA-binding protein vs. Ensembl Fly
Match: Rbp6 (gene:FBgn0260943 transcript:FBtr0333861)

HSP 1 Score: 68.1662 bits (165), Expect = 4.422e-12
Identity = 29/76 (38.16%), Postives = 48/76 (63.16%), Query Frame = 3
Query:  405 KIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAI 632
            K+F+GGL + T+ E+LR+YF  +G++ EA+V+ D  T +SRG+GFVT  +     K +      +DG+K +  +A 
Sbjct:   30 KMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVLTQGTHELDGKKVDPKVAF 105          

HSP 2 Score: 63.1586 bits (152), Expect = 1.580e-10
Identity = 31/72 (43.06%), Postives = 47/72 (65.28%), Query Frame = 3
Query:  369 QMSHLHKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILD 584
            + +H    T   KIFVGGL   TT E +++YFE FG +E+A+++ D+QT + RG+GFVT + SED    + +
Sbjct:  107 RRAHPKMVTRTKKIFVGGLSAPTTLEDVKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQ-SEDVVDKVCE 177          
BLAST of RNA-binding protein vs. Ensembl Fly
Match: Rbp6 (gene:FBgn0260943 transcript:FBtr0290066)

HSP 1 Score: 61.6178 bits (148), Expect = 4.801e-11
Identity = 30/64 (46.88%), Postives = 44/64 (68.75%), Query Frame = 3
Query:  393 TTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILD 584
            T   KIFVGGL   TT E +++YFE FG +E+A+++ D+QT + RG+GFVT + SED    + +
Sbjct:    3 TRTKKIFVGGLSAPTTLEDVKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQ-SEDVVDKVCE 65          
BLAST of RNA-binding protein vs. Ensembl Fly
Match: Rbp6 (gene:FBgn0260943 transcript:FBtr0113428)

HSP 1 Score: 63.1586 bits (152), Expect = 6.261e-11
Identity = 29/60 (48.33%), Postives = 43/60 (71.67%), Query Frame = 3
Query:  405 KIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILD 584
            KIFVGGL   TT E +++YFE FG +E+A+++ D+QT + RG+GFVT + SED    + +
Sbjct:    7 KIFVGGLSAPTTLEDVKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQ-SEDVVDKVCE 65          
BLAST of RNA-binding protein vs. Ensembl Zebrafish
Match: rbm24a (RNA binding motif protein 24a [Source:NCBI gene;Acc:405801])

HSP 1 Score: 153.295 bits (386), Expect = 7.423e-45
Identity = 72/93 (77.42%), Postives = 76/93 (81.72%), Query Frame = 3
Query:  372 MSHLHKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAILGAKPR 650
            M    KDTTYTKIFVGGLPYHTTD +LR YFE FGE+EEAVVITDRQTGKSRGYGFVTM +   A +A  DPNP IDGRK NVNLA LGAKPR
Sbjct:    1 MHTTQKDTTYTKIFVGGLPYHTTDSSLRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRSAADRACKDPNPIIDGRKANVNLAYLGAKPR 93          
BLAST of RNA-binding protein vs. Ensembl Zebrafish
Match: rbm24a (RNA binding motif protein 24a [Source:NCBI gene;Acc:405801])

HSP 1 Score: 156.377 bits (394), Expect = 1.762e-44
Identity = 75/107 (70.09%), Postives = 81/107 (75.70%), Query Frame = 3
Query:  372 MSHLHKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAILGAKPRNV-PSMNSLVDNLH 689
            M    KDTTYTKIFVGGLPYHTTD +LR YFE FGE+EEAVVITDRQTGKSRGYGFVTM +   A +A  DPNP IDGRK NVNLA LGAKPR + P     V  +H
Sbjct:    1 MHTTQKDTTYTKIFVGGLPYHTTDSSLRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRSAADRACKDPNPIIDGRKANVNLAYLGAKPRVMQPGFTFGVPQIH 107          
BLAST of RNA-binding protein vs. Ensembl Zebrafish
Match: rbm24b (RNA binding motif protein 24b [Source:ZFIN;Acc:ZDB-GENE-060312-43])

HSP 1 Score: 155.221 bits (391), Expect = 7.199e-44
Identity = 75/107 (70.09%), Postives = 82/107 (76.64%), Query Frame = 3
Query:  372 MSHLHKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAILGAKPRNV-PSMNSLVDNLH 689
            M    KDTTYTKIFVGGLPYHTTD +LR YFE FGE+EEAVVITDRQTGKSRGYGFVTM +   A +A  DPNP IDGRK NVNLA LGAKPR + P  +  V  +H
Sbjct:    1 MHSSQKDTTYTKIFVGGLPYHTTDSSLRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRSAAERACKDPNPIIDGRKANVNLAYLGAKPRILQPGFSFGVPQIH 107          
BLAST of RNA-binding protein vs. Ensembl Zebrafish
Match: rbm24b (RNA binding motif protein 24b [Source:ZFIN;Acc:ZDB-GENE-060312-43])

HSP 1 Score: 150.214 bits (378), Expect = 2.705e-43
Identity = 72/93 (77.42%), Postives = 76/93 (81.72%), Query Frame = 3
Query:  372 MSHLHKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAILGAKPR 650
            M    KDTTYTKIFVGGLPYHTTD +LR YFE FGE+EEAVVITDRQTGKSRGYGFVTM +   A +A  DPNP IDGRK NVNLA LGAKPR
Sbjct:    1 MHSSQKDTTYTKIFVGGLPYHTTDSSLRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRSAAERACKDPNPIIDGRKANVNLAYLGAKPR 93          
BLAST of RNA-binding protein vs. Ensembl Zebrafish
Match: rbm24b (RNA binding motif protein 24b [Source:ZFIN;Acc:ZDB-GENE-060312-43])

HSP 1 Score: 149.443 bits (376), Expect = 5.527e-43
Identity = 72/93 (77.42%), Postives = 76/93 (81.72%), Query Frame = 3
Query:  372 MSHLHKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAILGAKPR 650
            M    KDTTYTKIFVGGLPYHTTD +LR YFE FGE+EEAVVITDRQTGKSRGYGFVTM +   A +A  DPNP IDGRK NVNLA LGAKPR
Sbjct:    1 MHSSQKDTTYTKIFVGGLPYHTTDCSLRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRSAAERACKDPNPIIDGRKANVNLAYLGAKPR 93          
BLAST of RNA-binding protein vs. Ensembl Xenopus
Match: nxph2 (neurexophilin 2 [Source:Xenbase;Acc:XB-GENE-951506])

HSP 1 Score: 157.147 bits (396), Expect = 9.246e-45
Identity = 74/107 (69.16%), Postives = 85/107 (79.44%), Query Frame = 3
Query:  372 MSHLHKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAILGAKPRNVPSMNSL-VDNLH 689
            M  + KDTT+TKIFVGGLPYHTTD +LR YFE FG+++EAVVITDRQTGKSRGYGFVTM +   A +A  DPNP IDGRK NVNLA LGAKPRN+ S  ++ V  LH
Sbjct:    1 MHTVQKDTTFTKIFVGGLPYHTTDASLRKYFEVFGDIDEAVVITDRQTGKSRGYGFVTMSDRAAAERACKDPNPIIDGRKANVNLAYLGAKPRNLQSAFTIGVQQLH 107          
BLAST of RNA-binding protein vs. Ensembl Xenopus
Match: rbm24 (RNA binding motif protein 24 [Source:NCBI gene;Acc:394612])

HSP 1 Score: 154.451 bits (389), Expect = 1.288e-43
Identity = 74/107 (69.16%), Postives = 81/107 (75.70%), Query Frame = 3
Query:  372 MSHLHKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAILGAKPRNV-PSMNSLVDNLH 689
            M    KDTTYTKIFVGGLPYHTTD +LR YFE FG++EEAVVITDRQTGKSRGYGFVTM +   A +A  DPNP IDGRK NVNLA LGAKPR + P     V  +H
Sbjct:    1 MHTTQKDTTYTKIFVGGLPYHTTDSSLRKYFEVFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPIIDGRKANVNLAYLGAKPRIMQPGFAFGVQQIH 107          
BLAST of RNA-binding protein vs. Ensembl Xenopus
Match: cirbp (cold inducible RNA binding protein [Source:NCBI gene;Acc:549982])

HSP 1 Score: 77.0258 bits (188), Expect = 6.020e-16
Identity = 35/76 (46.05%), Postives = 53/76 (69.74%), Query Frame = 3
Query:  405 KIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPN-PCIDGRKTNVNLA 629
            K+FVGGL + TT+E+L   F  +G++ E VV+ DR++ +SRG+GFVT +N EDA  A++  N   +DGR+  V+ A
Sbjct:   19 KLFVGGLNFETTEESLEQVFSKYGQVAEVVVVKDRESKRSRGFGFVTFENPEDAKDAMMAMNGKSVDGRQIRVDQA 94          
BLAST of RNA-binding protein vs. Ensembl Xenopus
Match: cirbp (cold inducible RNA binding protein [Source:NCBI gene;Acc:549982])

HSP 1 Score: 77.0258 bits (188), Expect = 6.496e-16
Identity = 35/76 (46.05%), Postives = 53/76 (69.74%), Query Frame = 3
Query:  405 KIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPN-PCIDGRKTNVNLA 629
            K+FVGGL + TT+E+L   F  +G++ E VV+ DR++ +SRG+GFVT +N EDA  A++  N   +DGR+  V+ A
Sbjct:   19 KLFVGGLNFETTEESLEQVFSKYGQVAEVVVVKDRESKRSRGFGFVTFENPEDAKDAMMAMNGKSVDGRQIRVDQA 94          
BLAST of RNA-binding protein vs. Ensembl Xenopus
Match: cirbp (cold inducible RNA binding protein [Source:NCBI gene;Acc:549982])

HSP 1 Score: 77.0258 bits (188), Expect = 6.547e-16
Identity = 35/76 (46.05%), Postives = 53/76 (69.74%), Query Frame = 3
Query:  405 KIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPN-PCIDGRKTNVNLA 629
            K+FVGGL + TT+E+L   F  +G++ E VV+ DR++ +SRG+GFVT +N EDA  A++  N   +DGR+  V+ A
Sbjct:    7 KLFVGGLNFETTEESLEQVFSKYGQVAEVVVVKDRESKRSRGFGFVTFENPEDAKDAMMAMNGKSVDGRQIRVDQA 82          
BLAST of RNA-binding protein vs. Ensembl Mouse
Match: Rbm24 (RNA binding motif protein 24 [Source:MGI Symbol;Acc:MGI:3610364])

HSP 1 Score: 154.836 bits (390), Expect = 7.923e-44
Identity = 75/107 (70.09%), Postives = 81/107 (75.70%), Query Frame = 3
Query:  372 MSHLHKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAILGAKPRNV-PSMNSLVDNLH 689
            M    KDTTYTKIFVGGLPYHTTD +LR YFE FG++EEAVVITDRQTGKSRGYGFVTM +   A +A  DPNP IDGRK NVNLA LGAKPR + P     V  LH
Sbjct:    1 MHTTQKDTTYTKIFVGGLPYHTTDASLRKYFEVFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPIIDGRKANVNLAYLGAKPRIMQPGFAFGVQQLH 107          
BLAST of RNA-binding protein vs. Ensembl Mouse
Match: Rbm38 (RNA binding motif protein 38 [Source:MGI Symbol;Acc:MGI:1889294])

HSP 1 Score: 147.517 bits (371), Expect = 4.327e-41
Identity = 74/114 (64.91%), Postives = 86/114 (75.44%), Query Frame = 3
Query:  351 PANPEHQMSHLHKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAILGAKPRNVPSMNSL-VDNLH 689
            P+     M    KDTT+TKIFVGGLPYHTTD +LR YFE FG++EEAVVITDRQTGKSRGYGFVTM +   A +A  DPNP IDGRK NVNLA LGAKPR++ +  ++ V  LH
Sbjct:   15 PSAAPSAMHGSQKDTTFTKIFVGGLPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAADRACKDPNPIIDGRKANVNLAYLGAKPRSLQTGFAVGVQQLH 128          
BLAST of RNA-binding protein vs. Ensembl Mouse
Match: Rbm38 (RNA binding motif protein 38 [Source:MGI Symbol;Acc:MGI:1889294])

HSP 1 Score: 147.517 bits (371), Expect = 4.327e-41
Identity = 74/114 (64.91%), Postives = 86/114 (75.44%), Query Frame = 3
Query:  351 PANPEHQMSHLHKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAILGAKPRNVPSMNSL-VDNLH 689
            P+     M    KDTT+TKIFVGGLPYHTTD +LR YFE FG++EEAVVITDRQTGKSRGYGFVTM +   A +A  DPNP IDGRK NVNLA LGAKPR++ +  ++ V  LH
Sbjct:   15 PSAAPSAMHGSQKDTTFTKIFVGGLPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAADRACKDPNPIIDGRKANVNLAYLGAKPRSLQTGFAVGVQQLH 128          
BLAST of RNA-binding protein vs. Ensembl Mouse
Match: Rbm38 (RNA binding motif protein 38 [Source:MGI Symbol;Acc:MGI:1889294])

HSP 1 Score: 104.76 bits (260), Expect = 1.074e-26
Identity = 47/70 (67.14%), Postives = 56/70 (80.00%), Query Frame = 3
Query:  384 HKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNP 593
             KDTT+TKIFVGGLPYHTTD +LR YFE FG++EEAVVITDRQTGKSRGYGFV+ + +    +    P+P
Sbjct:    3 QKDTTFTKIFVGGLPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVSARGARTCRR----PSP 68          
BLAST of RNA-binding protein vs. Ensembl Mouse
Match: Rbm38 (RNA binding motif protein 38 [Source:MGI Symbol;Acc:MGI:1889294])

HSP 1 Score: 86.6557 bits (213), Expect = 1.186e-20
Identity = 39/56 (69.64%), Postives = 44/56 (78.57%), Query Frame = 3
Query:  351 PANPEHQMSHLHKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTG 518
            P+     M    KDTT+TKIFVGGLPYHTTD +LR YFE FG++EEAVVITDRQTG
Sbjct:   15 PSAAPSAMHGSQKDTTFTKIFVGGLPYHTTDASLRKYFEGFGDIEEAVVITDRQTG 70          
BLAST of RNA-binding protein vs. UniProt/SwissProt
Match: sp|Q6DIV4|RBM38_XENTR (RNA-binding protein 38 OS=Xenopus tropicalis OX=8364 GN=rbm38 PE=2 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 4.898e-44
Identity = 74/107 (69.16%), Postives = 85/107 (79.44%), Query Frame = 3
Query:  372 MSHLHKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAILGAKPRNVPSMNSL-VDNLH 689
            M  + KDTT+TKIFVGGLPYHTTD +LR YFE FG+++EAVVITDRQTGKSRGYGFVTM +   A +A  DPNP IDGRK NVNLA LGAKPRN+ S  ++ V  LH
Sbjct:    1 MHTVQKDTTFTKIFVGGLPYHTTDASLRKYFEVFGDIDEAVVITDRQTGKSRGYGFVTMSDRAAAERACKDPNPIIDGRKANVNLAYLGAKPRNLQSAFTIGVQQLH 107          
BLAST of RNA-binding protein vs. UniProt/SwissProt
Match: sp|Q5ZJX4|RBM38_CHICK (RNA-binding protein 38 OS=Gallus gallus OX=9031 GN=RBM38 PE=2 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 8.183e-44
Identity = 73/107 (68.22%), Postives = 85/107 (79.44%), Query Frame = 3
Query:  372 MSHLHKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAILGAKPRNVPSMNSL-VDNLH 689
            M  + KDTT+TKIFVGGLPYHTTD +LR YFE FG++EEAVVITDRQTGKSRGYGFVTM +   A +A  DPNP IDGRK NVNLA LGAKPR++ +  ++ V  LH
Sbjct:    1 MHTVQKDTTFTKIFVGGLPYHTTDSSLRKYFEVFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPIIDGRKANVNLAYLGAKPRSIQTGFTIGVQQLH 107          
BLAST of RNA-binding protein vs. UniProt/SwissProt
Match: sp|Q76LC6|RBM24_DANRE (RNA-binding protein 24 OS=Danio rerio OX=7955 GN=rbm24 PE=2 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 1.330e-43
Identity = 75/107 (70.09%), Postives = 81/107 (75.70%), Query Frame = 3
Query:  372 MSHLHKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAILGAKPRNV-PSMNSLVDNLH 689
            M    KDTTYTKIFVGGLPYHTTD +LR YFE FGE+EEAVVITDRQTGKSRGYGFVTM +   A +A  DPNP IDGRK NVNLA LGAKPR + P     V  +H
Sbjct:    1 MHTTQKDTTYTKIFVGGLPYHTTDSSLRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRSAADRACKDPNPIIDGRKANVNLAYLGAKPRVMQPGFTFGVPQIH 107          
BLAST of RNA-binding protein vs. UniProt/SwissProt
Match: sp|Q9BX46|RBM24_HUMAN (RNA-binding protein 24 OS=Homo sapiens OX=9606 GN=RBM24 PE=1 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 1.497e-43
Identity = 76/107 (71.03%), Postives = 81/107 (75.70%), Query Frame = 3
Query:  372 MSHLHKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAILGAKPRNV-PSMNSLVDNLH 689
            M    KDTTYTKIFVGGLPYHTTD +LR YFE FGE+EEAVVITDRQTGKSRGYGFVTM +   A +A  DPNP IDGRK NVNLA LGAKPR + P     V  LH
Sbjct:    1 MHTTQKDTTYTKIFVGGLPYHTTDASLRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPIIDGRKANVNLAYLGAKPRIMQPGFAFGVQQLH 107          
BLAST of RNA-binding protein vs. UniProt/SwissProt
Match: sp|Q9I8B3|RB24B_XENLA (RNA-binding protein 24-B OS=Xenopus laevis OX=8355 GN=rbm24-b PE=2 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 3.510e-43
Identity = 74/107 (69.16%), Postives = 81/107 (75.70%), Query Frame = 3
Query:  372 MSHLHKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAILGAKPRNV-PSMNSLVDNLH 689
            M    KDTTYTKIFVGGLPYHTTD +LR YFE FG++EEAVVITDRQTGKSRGYGFVTM +   A +A  DPNP IDGRK NVNLA LGAKPR + P     V  +H
Sbjct:    1 MHTTQKDTTYTKIFVGGLPYHTTDSSLRKYFEVFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPIIDGRKANVNLAYLGAKPRIMQPGFAFGVQQIH 107          
BLAST of RNA-binding protein vs. TrEMBL
Match: A0A1I8FVG7 (RRM domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029889g3 PE=4 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 1.463e-46
Identity = 76/92 (82.61%), Postives = 83/92 (90.22%), Query Frame = 3
Query:  384 HKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAILGAKPRNVP 659
             KDTTYTKIFVGGLPYHT+DETLR+YFE FGELEEAVVITDR T KSRGYGFVTMK  EDA KAI +PNPCIDGRK NVNLA++GAKPR++P
Sbjct:   13 QKDTTYTKIFVGGLPYHTSDETLRSYFEQFGELEEAVVITDRNTNKSRGYGFVTMKRPEDAFKAIQEPNPCIDGRKANVNLAVIGAKPRSIP 104          
BLAST of RNA-binding protein vs. TrEMBL
Match: A0A183AEQ8 (RRM domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS5443 PE=4 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 2.119e-46
Identity = 80/107 (74.77%), Postives = 89/107 (83.18%), Query Frame = 3
Query:  369 QMSHLHKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAILGAKPRNVPSMN-SLVDNL 686
             +SHL KDTT TKIFVGGLPYHTTD++LR +FE FG +EEAVVITDRQTGKSRGYGFVTM  SEDA  AI DPNPCIDGRK NVNLA+LGAKPR +P    S +DN+
Sbjct:   48 SVSHLQKDTTLTKIFVGGLPYHTTDDSLRCFFEQFGPIEEAVVITDRQTGKSRGYGFVTMVRSEDALLAIRDPNPCIDGRKANVNLAVLGAKPRLMPGGGYSAIDNM 154          
BLAST of RNA-binding protein vs. TrEMBL
Match: A0A267EVC2 (RRM domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029889g1 PE=4 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 2.173e-46
Identity = 76/92 (82.61%), Postives = 83/92 (90.22%), Query Frame = 3
Query:  384 HKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAILGAKPRNVP 659
             KDTTYTKIFVGGLPYHT+DETLR+YFE FGELEEAVVITDR T KSRGYGFVTMK  EDA KAI +PNPCIDGRK NVNLA++GAKPR++P
Sbjct:   13 QKDTTYTKIFVGGLPYHTSDETLRSYFEQFGELEEAVVITDRNTNKSRGYGFVTMKRPEDAFKAIQEPNPCIDGRKANVNLAVIGAKPRSIP 104          
BLAST of RNA-binding protein vs. TrEMBL
Match: A0A3R7CXU2 (RNA-binding protein 24 (Fragment) OS=Clonorchis sinensis OX=79923 GN=rbm24 PE=4 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 5.453e-46
Identity = 77/101 (76.24%), Postives = 85/101 (84.16%), Query Frame = 3
Query:  375 SHLHKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAILGAKPRNVPSMNSLV 677
             HL KDTT TKIFVGGLPYHTTD++LR +FE FG +EEAVVITDRQTGKSRGYGFVTM  SEDA  AI DPNPCIDGRK NVNLA+LGAKPR +P   S++
Sbjct:   63 GHLQKDTTLTKIFVGGLPYHTTDDSLRCFFEQFGPIEEAVVITDRQTGKSRGYGFVTMVRSEDALLAIRDPNPCIDGRKANVNLAVLGAKPRLMPGATSVL 163          
BLAST of RNA-binding protein vs. TrEMBL
Match: A0A0R3X9T8 (RRM domain-containing protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS10298 PE=4 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 6.428e-46
Identity = 74/94 (78.72%), Postives = 82/94 (87.23%), Query Frame = 3
Query:  387 KDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAILGAKPRNVPSMN 668
            KDTT+TKIFVGGLPYHTTD +LR++FE FGE+EEAVVITDRQTGKSRGYGFVTM   EDA  AI+DPNPCIDGRK NVNLA+LGAKPR +   N
Sbjct:   25 KDTTFTKIFVGGLPYHTTDASLRSFFERFGEIEEAVVITDRQTGKSRGYGFVTMARYEDAINAIMDPNPCIDGRKANVNLAVLGAKPRTIAGGN 118          
BLAST of RNA-binding protein vs. Ensembl Cavefish
Match: rbm24a (RNA binding motif protein 24 [Source:NCBI gene;Acc:103027480])

HSP 1 Score: 156.377 bits (394), Expect = 1.595e-44
Identity = 75/107 (70.09%), Postives = 81/107 (75.70%), Query Frame = 3
Query:  372 MSHLHKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAILGAKPRNV-PSMNSLVDNLH 689
            M    KDTTYTKIFVGGLPYHTTD +LR YFE FGE+EEAVVITDRQTGKSRGYGFVTM +   A +A  DPNP IDGRK NVNLA LGAKPR + P     V  +H
Sbjct:    1 MHTTQKDTTYTKIFVGGLPYHTTDSSLRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRSAADRACKDPNPIIDGRKANVNLAYLGAKPRVMQPGFTFGVPQIH 107          
BLAST of RNA-binding protein vs. Ensembl Cavefish
Match: rbm24a (RNA binding motif protein 24 [Source:NCBI gene;Acc:103027480])

HSP 1 Score: 156.377 bits (394), Expect = 2.852e-44
Identity = 75/107 (70.09%), Postives = 81/107 (75.70%), Query Frame = 3
Query:  372 MSHLHKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAILGAKPRNV-PSMNSLVDNLH 689
            M    KDTTYTKIFVGGLPYHTTD +LR YFE FGE+EEAVVITDRQTGKSRGYGFVTM +   A +A  DPNP IDGRK NVNLA LGAKPR + P     V  +H
Sbjct:   22 MHTTQKDTTYTKIFVGGLPYHTTDSSLRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRSAADRACKDPNPIIDGRKANVNLAYLGAKPRVMQPGFTFGVPQIH 128          
BLAST of RNA-binding protein vs. Ensembl Cavefish
Match: ENSAMXT00000016054.2 (RNA binding motif protein 38 [Source:NCBI gene;Acc:103039930])

HSP 1 Score: 147.132 bits (370), Expect = 4.534e-41
Identity = 66/92 (71.74%), Postives = 77/92 (83.70%), Query Frame = 3
Query:  381 LHKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAILGAKPRNV 656
            + KDTT+TKIFVGGLPYHT D +LR YFE +G+++EAVVITDRQTGKSRGYGFVTM +   A +A  DPNP IDGRK NVNLA LGAKPR++
Sbjct:   19 IQKDTTFTKIFVGGLPYHTNDASLRKYFEAYGDIDEAVVITDRQTGKSRGYGFVTMTDRVAAERACKDPNPIIDGRKANVNLAYLGAKPRSL 110          
BLAST of RNA-binding protein vs. Ensembl Cavefish
Match: rbm38 (RNA-binding protein 38-like [Source:NCBI gene;Acc:107196932])

HSP 1 Score: 145.206 bits (365), Expect = 3.120e-40
Identity = 77/141 (54.61%), Postives = 90/141 (63.83%), Query Frame = 3
Query:  390 DTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAILGAKPRNVPSMNSL-VDNLHNIDQANRFNTILSSSYSNPLL--NILYPTLQNNALLQPVL 803
            DTT+TKIFVGGLPYH TD +LR YF  FGE+ EAVVITDRQTGKSRGYGFVTM     A +A  DPNP IDGRK NVNLA LGAKPR+  +  S  +  +H      ++       Y   LL   +L+PT    A+  P L
Sbjct:   21 DTTFTKIFVGGLPYHATDASLREYFGSFGEISEAVVITDRQTGKSRGYGFVTMIEKAAAEQACKDPNPIIDGRKANVNLAYLGAKPRSPQTGYSTGMQQIHPALFQRQYELAQQFVYPQALLQPGLLFPTQVTTAVSSPYL 161          
BLAST of RNA-binding protein vs. Ensembl Cavefish
Match: ENSAMXT00000056649.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002006.1:25715:26129:1 gene:ENSAMXG00000042924.1 transcript:ENSAMXT00000056649.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 104.375 bits (259), Expect = 4.892e-27
Identity = 49/69 (71.01%), Postives = 55/69 (79.71%), Query Frame = 3
Query:  351 PANPEH----QMSHLHKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVT 545
            PA P      +M    KDTT+TKIFVGGLPYHTTD +LR YFE FGE++EAVVITDRQTGKSRGYGFV+
Sbjct:    7 PAVPAEGLRVRMHSSQKDTTFTKIFVGGLPYHTTDCSLRKYFEVFGEIDEAVVITDRQTGKSRGYGFVS 75          
BLAST of RNA-binding protein vs. Ensembl Sea Lamprey
Match: rbm24a (RNA binding motif protein 24a [Source:NCBI gene;Acc:405801])

HSP 1 Score: 150.599 bits (379), Expect = 5.547e-43
Identity = 78/143 (54.55%), Postives = 93/143 (65.03%), Query Frame = 3
Query:  372 MSHLHKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAILGAKPRNV-PSMNSLVDNLHNIDQANRFNTILSSSYSNPLLNILYPTLQNNALLQP 797
            M  + KDTT+TKIFVGGLPYHTTD +LR +FE FGE++EAVVITDRQ+GKSRGYGFVTM +   A +A  DPNP IDGRK NVNLA +GAKPR + P     V  +          T +   Y  P    +YP     AL+QP
Sbjct:    2 MLSMQKDTTFTKIFVGGLPYHTTDASLRAFFEAFGEIDEAVVITDRQSGKSRGYGFVTMADRASAERACKDPNPIIDGRKANVNLAYIGAKPRVIQPGFAFGVQQIQ--------PTFIQRPYGIP-AQYVYP----QALMQP 131          
BLAST of RNA-binding protein vs. Ensembl Sea Lamprey
Match: HNRNPA0 (heterogeneous nuclear ribonucleoprotein A0 [Source:HGNC Symbol;Acc:HGNC:5030])

HSP 1 Score: 71.633 bits (174), Expect = 1.139e-14
Identity = 33/76 (43.42%), Postives = 47/76 (61.84%), Query Frame = 3
Query:  405 KIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAI 632
            KIFVGG+   T ++ LR YF+ +G++E A V+ DR TGK RG+GFVT  + +   K I+     I+G K  V  A+
Sbjct:  101 KIFVGGIRDDTDEQHLREYFQVYGDVEAAEVMEDRSTGKKRGFGFVTFSDHDTVDKVIVQKYHTINGHKAEVRKAL 176          

HSP 2 Score: 61.6178 bits (148), Expect = 3.299e-11
Identity = 32/82 (39.02%), Postives = 48/82 (58.54%), Query Frame = 3
Query:  390 DTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNP-CIDGRKTNVNLAI 632
            D    K+F+GGL + TT++++R +FE +G L + VV+ D  T +SRG+GFVT    E+   A +D  P  +D R      AI
Sbjct:    5 DEQQRKLFIGGLSFETTEDSMRKHFEQWGTLTDCVVMRDPHTKRSRGFGFVTYTCPEEVD-AAMDARPHHLDNRVVEAKRAI 85          
BLAST of RNA-binding protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004893.1 (pep scaffold:Pmarinus_7.0:GL479484:4:2056:-1 gene:ENSPMAG00000004449.1 transcript:ENSPMAT00000004893.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.633 bits (174), Expect = 1.603e-14
Identity = 36/87 (41.38%), Postives = 51/87 (58.62%), Query Frame = 3
Query:  381 LHKDTT---YTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAI 632
            +HKD     + K+FVGGL + TT+E LR YFE +G L + VV+ D Q+ +SRG+GFVT  +  +   A+      IDGR      A+
Sbjct:    1 MHKDREPEQFRKLFVGGLSFETTEEGLRQYFEQWGSLTDCVVMKDTQSKRSRGFGFVTFSSMSEVDAAMSARPHKIDGRMVEPKRAV 87          

HSP 2 Score: 62.7734 bits (151), Expect = 1.829e-11
Identity = 29/76 (38.16%), Postives = 46/76 (60.53%), Query Frame = 3
Query:  405 KIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAI 632
            KIFVGG+   T +E LR+YFE +G +E   V+T+R++GK RG+ FVT  + +   K ++     I+G    +  A+
Sbjct:  103 KIFVGGIKDDTDEEHLRDYFEKYGRIEIVEVMTERESGKKRGFAFVTFNDHDPVDKIVVQKYHTINGHNCEIRKAL 178          
BLAST of RNA-binding protein vs. Ensembl Sea Lamprey
Match: HNRNPA0 (heterogeneous nuclear ribonucleoprotein A0 [Source:HGNC Symbol;Acc:HGNC:5030])

HSP 1 Score: 70.0922 bits (170), Expect = 1.782e-13
Identity = 35/89 (39.33%), Postives = 51/89 (57.30%), Query Frame = 3
Query:  405 KIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAI-------LGAKPR 650
            KIFVGG+  +T ++ LR+YF  +G +E   V+ DRQ+GK RG+GFVT  + +   K ++     I+G K  V  A+       LG  PR
Sbjct:  125 KIFVGGIKDNTDEDHLRDYFSEYGMVESVDVMEDRQSGKKRGFGFVTFSDHDAVDKVVVQKYHTINGHKAEVRKALSKQEMNSLGGDPR 213          

HSP 2 Score: 66.6254 bits (161), Expect = 3.039e-12
Identity = 32/85 (37.65%), Postives = 50/85 (58.82%), Query Frame = 3
Query:  378 HLHKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAI 632
            H   D    K+F+GGL + TT+E+++ +FE +G L + VV+ D  T +SRG+GFVT  ++E+   A+      +DGR      AI
Sbjct:   25 HYSPDEQQRKLFIGGLSFETTEESMQKHFEQWGTLTDCVVMRDPHTKRSRGFGFVTYMSAEEVDAAMEVRPHHLDGRVVEAKRAI 109          
BLAST of RNA-binding protein vs. Ensembl Sea Lamprey
Match: HNRNPA2B1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:HGNC Symbol;Acc:HGNC:5033])

HSP 1 Score: 64.3142 bits (155), Expect = 6.283e-12
Identity = 30/83 (36.14%), Postives = 49/83 (59.04%), Query Frame = 3
Query:  405 KIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAILGAKPRN 653
            K+F+GGL + TT+E+LR Y+E +G + + VV+ D  + +SRG+GF+T    E+   A+      +DGR      A+    PR+
Sbjct:   15 KLFIGGLSFETTEESLREYYEQWGTIVDCVVMKDPSSKRSRGFGFITYSVMEEVNSAMQARPHTVDGRVVEAKRAV----PRD 93          

HSP 2 Score: 60.4622 bits (145), Expect = 1.168e-10
Identity = 29/79 (36.71%), Postives = 45/79 (56.96%), Query Frame = 3
Query:  396 TYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAI 632
            T  K+FVGG+  +T +  LR+YF  FG +E   ++TD+QTGK RG+ FVT  + +   + +      I+  K  V  A+
Sbjct:  102 TVKKLFVGGIKDNTDESHLRDYFSKFGRVESVDMVTDKQTGKKRGFAFVTFDDYDPVDQIVFQKFHTINCHKLEVRKAL 180          
BLAST of RNA-binding protein vs. Ensembl Yeast
Match: PUB1 (Poly (A)+ RNA-binding protein; abundant mRNP-component protein that binds mRNA and is required for stability of many mRNAs; component of glucose deprivation induced stress granules, involved in P-body-dependent granule assembly; implicated in regulation of translation; carries Q/N-rich domain at C- terminus, identified as candidate prion; human homolog Tia1 is critical for normal synaptic plasticity; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004961])

HSP 1 Score: 60.077 bits (144), Expect = 2.591e-10
Identity = 37/102 (36.27%), Postives = 53/102 (51.96%), Query Frame = 3
Query:  327 RLLKNNEIPANPEHQMSHLHKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILD-PNPCIDGRKTNVNLA 629
            + ++NN +  N   Q      D T+  +FVG L  +  DETLRN F+ F       V+ D QTG SRGYGFV+  + +DA  A+       ++GR   +N A
Sbjct:  138 KQIENNIVKINWAFQSQQSSSDDTFN-LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRINWA 238          
BLAST of RNA-binding protein vs. Ensembl Yeast
Match: NSR1 (Nucleolar protein that binds nuclear localization sequences; required for pre-rRNA processing and ribosome biogenesis; binds to single stranded telomeric DNA and mRNA; methylated by Hmt1p; interaction with Top1p and nucleolar localization are negatively regulated by polyphosphorylation [Source:SGD;Acc:S000003391])

HSP 1 Score: 57.7658 bits (138), Expect = 1.396e-9
Identity = 32/75 (42.67%), Postives = 44/75 (58.67%), Query Frame = 3
Query:  408 IFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILD-PNPCIDGRKTNVNLA 629
            IFVG L +   DE L+  FE+ G +  A VI +R T +SRGYG+V  +N   A KAI +     IDGR  N +++
Sbjct:  170 IFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQEMQGKEIDGRPINCDMS 244          
BLAST of RNA-binding protein vs. Ensembl Yeast
Match: SNP1 (Component of U1 snRNP required for mRNA splicing via spliceosome; substrate of the arginine methyltransferase Hmt1p; may interact with poly(A) polymerase to regulate polyadenylation; homolog of human U1 70K protein; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000001323])

HSP 1 Score: 55.8398 bits (133), Expect = 3.943e-9
Identity = 23/59 (38.98%), Postives = 35/59 (59.32%), Query Frame = 3
Query:  378 HLHKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKN 554
            H+     Y  IF+G LPY   +  L+ YF  FGE+E+  ++ D+ T KS+GY F+  K+
Sbjct:   99 HIKDTDPYRTIFIGRLPYDLDEIELQKYFVKFGEIEKIRIVKDKITQKSKGYAFIVFKD 157          
BLAST of RNA-binding protein vs. Ensembl Yeast
Match: HRP1 (Subunit of cleavage factor I; cleavage factor I is a five-subunit complex required for the cleavage and polyadenylation of pre-mRNA 3' ends; RRM-containing heteronuclear RNA binding protein and hnRNPA/B family member that binds to poly (A) signal sequences; required for genome stability [Source:SGD;Acc:S000005483])

HSP 1 Score: 54.299 bits (129), Expect = 2.511e-8
Identity = 27/90 (30.00%), Postives = 51/90 (56.67%), Query Frame = 3
Query:  363 EHQMSHLHKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAI 632
            E   + L K++   K+F+GGL + TT++ LR YF  +G + +  ++ D  TG+SRG+GF++ +    +   ++     +DG+  +   AI
Sbjct:  148 ERSKADLSKESC--KMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPS-SVDEVVKTQHILDGKVIDPKRAI 234          

HSP 2 Score: 50.447 bits (119), Expect = 3.322e-7
Identity = 33/105 (31.43%), Postives = 57/105 (54.29%), Query Frame = 3
Query:  357 NPEHQMSHLHKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAILGAKPRNVPSMNS 671
            +P+  +    +D T  KIFVGG+      +    +F  +G + +A ++ D+ TG+SRG+GFVT  +S DA   +   N  ID +  +  + I  A+PR++   +S
Sbjct:  229 DPKRAIPRDEQDKT-GKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGQSRGFGFVTY-DSADAVDRVCQ-NKFIDFK--DRKIEIKRAEPRHMQQKSS 328          
BLAST of RNA-binding protein vs. Ensembl Yeast
Match: NOP13 (Nucleolar protein found in preribosomal complexes; contains an RNA recognition motif (RRM); relative distribution to the nucleolus increases upon DNA replication stress [Source:SGD;Acc:S000005119])

HSP 1 Score: 50.8322 bits (120), Expect = 2.415e-7
Identity = 25/69 (36.23%), Postives = 42/69 (60.87%), Query Frame = 3
Query:  408 IFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPC--IDGR 608
            +FVG L +  TD+ LR +F++ G++ +  + T   +GK +G+ F+  KN E +T A+ D + C  I GR
Sbjct:  241 LFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGSTNALKDKS-CRKIAGR 308          
BLAST of RNA-binding protein vs. Ensembl Nematostella
Match: EDO40104 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S851])

HSP 1 Score: 112.849 bits (281), Expect = 1.907e-30
Identity = 51/89 (57.30%), Postives = 66/89 (74.16%), Query Frame = 3
Query:  384 HKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAILGAKPR 650
            ++DT +TK+FVGG+PY + D+ LR +F  FGE+ EAVVI DR T KS+GYGFVTM  S+ A  A  +  P I+GR+ NVNLA LGAKP+
Sbjct:    4 NQDTKFTKLFVGGIPYESGDDALRKFFAQFGEIREAVVIKDRVTKKSKGYGFVTMATSDAAELACKNKRPMIEGRQANVNLAYLGAKPK 92          
BLAST of RNA-binding protein vs. Ensembl Nematostella
Match: EDO39879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8S5])

HSP 1 Score: 72.0182 bits (175), Expect = 8.682e-15
Identity = 37/87 (42.53%), Postives = 56/87 (64.37%), Query Frame = 3
Query:  405 KIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPC-IDGRKTNVNLAILGAKPRNVPS 662
            K+F+GGL + TT E LR +FE FGEL+E VV+ D  T +SRG+GF+T K+ + A   +L+     +DG+K +  LA+    P+  P+
Sbjct:    1 KMFIGGLSWQTTAEGLRQHFEKFGELKECVVMRDPVTKRSRGFGFLTFKDPK-AVDVVLNSGAQELDGKKIDPKLAV----PKRAPA 82          

HSP 2 Score: 62.003 bits (149), Expect = 2.674e-11
Identity = 30/79 (37.97%), Postives = 48/79 (60.76%), Query Frame = 3
Query:  393 TTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLA 629
            TT  KIF+GGL  +T++E ++ YF  FG++ E +++ D+ T + RG+GFVT ++   A KA       I+ +K  V  A
Sbjct:   86 TTTKKIFIGGLSTNTSEEDMKKYFSQFGKITETMLMFDKATQRHRGFGFVTFESENSADKACDTQYHLINNKKVEVKKA 164          
BLAST of RNA-binding protein vs. Ensembl Nematostella
Match: EDO36522 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIF0])

HSP 1 Score: 69.707 bits (169), Expect = 6.903e-14
Identity = 42/95 (44.21%), Postives = 55/95 (57.89%), Query Frame = 3
Query:  402 TKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNP-----CIDGRKTNVNLAILGAKPRNVPSMNS 671
             K+FVGGL   TT+ETLR YFE +GEL + VVI D  T KSRG+G+VT  + +  T+ +L          IDG++  V  AI    PR+  S  S
Sbjct:   14 AKLFVGGLNRETTNETLREYFEAYGELTDVVVICDSATKKSRGFGYVTFADYK-VTRNVLKDKVENGAHRIDGKEVEVKRAI----PRDDNSATS 103          
BLAST of RNA-binding protein vs. Ensembl Nematostella
Match: EDO29715 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2V2])

HSP 1 Score: 65.855 bits (159), Expect = 9.959e-14
Identity = 31/73 (42.47%), Postives = 47/73 (64.38%), Query Frame = 3
Query:  408 IFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPN-PCIDGRKTNVN 623
            IFVG LP+   +  LR +FE +G ++   +I+D+ TG+S+G+GFV M N  +A KAI + N   ++GR   VN
Sbjct:    3 IFVGSLPFSIEEADLRGFFEEYGAVDSVKIISDKFTGRSKGFGFVEMPNDAEAQKAIDELNGGTVEGRTIVVN 75          
BLAST of RNA-binding protein vs. Ensembl Nematostella
Match: EDO33402 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSE0])

HSP 1 Score: 64.3142 bits (155), Expect = 9.598e-13
Identity = 33/71 (46.48%), Postives = 46/71 (64.79%), Query Frame = 3
Query:  399 YTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCI-DGR 608
            + KIFVGGL   TT E L  YFE FGE+ + V++TD  T +SRG+GFVT ++     +++L   P I DG+
Sbjct:   13 FRKIFVGGLATSTTKEGLHQYFENFGEVTDCVLMTDPTTKRSRGFGFVTFRDPA-TIESVLAKKPHILDGK 82          
BLAST of RNA-binding protein vs. Ensembl Medaka
Match: rbm24a (RNA binding motif protein 24 [Source:NCBI gene;Acc:101163671])

HSP 1 Score: 154.836 bits (390), Expect = 5.240e-44
Identity = 75/107 (70.09%), Postives = 81/107 (75.70%), Query Frame = 3
Query:  372 MSHLHKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAILGAKPRNV-PSMNSLVDNLH 689
            M    KDTTYTKIFVGGLPYHTTD +LR YFE FGE+EEAVVITDRQTGKSRGYGFVTM +   A +A  DPNP IDGRK NVNLA LGAKPR + P     V  +H
Sbjct:    1 MHTTQKDTTYTKIFVGGLPYHTTDSSLRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRSAADRACKDPNPIIDGRKANVNLAYLGAKPRVMQPGFTFGVPQIH 107          
BLAST of RNA-binding protein vs. Ensembl Medaka
Match: rbm24b (RNA-binding protein 24 [Source:NCBI gene;Acc:101161576])

HSP 1 Score: 154.066 bits (388), Expect = 1.179e-43
Identity = 73/107 (68.22%), Postives = 81/107 (75.70%), Query Frame = 3
Query:  372 MSHLHKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAILGAKPRNV-PSMNSLVDNLH 689
            M    KDTT+TKIFVGGLPYHTTD +LR YFE FG++EEAVVITDRQTGKSRGYGFVTM +   A +A  DPNP IDGRK NVNLA LGAKPR + P     V  +H
Sbjct:    2 MHSAQKDTTFTKIFVGGLPYHTTDSSLRKYFEVFGDIEEAVVITDRQTGKSRGYGFVTMADRASADRACKDPNPIIDGRKANVNLAYLGAKPRVIQPGFAFGVPQIH 108          
BLAST of RNA-binding protein vs. Ensembl Medaka
Match: RBM38 (RNA-binding protein 38 [Source:NCBI gene;Acc:101160403])

HSP 1 Score: 150.214 bits (378), Expect = 5.056e-42
Identity = 70/98 (71.43%), Postives = 80/98 (81.63%), Query Frame = 3
Query:  381 LHKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAILGAKPRNVPSMNSL 674
            L KDTT+TKIFVGGLPYHT D +LR YFE FG+++EAVVITDRQTGKSRGYGFVTM +   A +A  DPNP IDGRK NVNLA LGAKPR++ +  SL
Sbjct:   19 LQKDTTFTKIFVGGLPYHTNDASLRKYFEAFGDIDEAVVITDRQTGKSRGYGFVTMTDRGAAERACKDPNPIIDGRKANVNLAYLGAKPRSIQTGISL 116          
BLAST of RNA-binding protein vs. Ensembl Medaka
Match: rbm38 (RNA-binding protein 38 [Source:NCBI gene;Acc:101156012])

HSP 1 Score: 147.517 bits (371), Expect = 5.264e-41
Identity = 69/105 (65.71%), Postives = 82/105 (78.10%), Query Frame = 3
Query:  381 LHKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAILGAKPRNVPSMNSLVDNLHNI 695
            + KDTTYTKIFVGGLPYHT+D +LR YFE FG+++EAVVITD+QTGKSRGYGFVTM +   A +A  D NP IDGRK NVNLA LGAKPR+  S ++L   +  I
Sbjct:   22 MEKDTTYTKIFVGGLPYHTSDASLRKYFETFGDIDEAVVITDKQTGKSRGYGFVTMVDRAAAEQACKDANPIIDGRKANVNLAYLGAKPRS--SHSTLSGGVQQI 124          
BLAST of RNA-binding protein vs. Ensembl Medaka
Match: hnrnpaba (heterogeneous nuclear ribonucleoprotein A/B [Source:NCBI gene;Acc:101162934])

HSP 1 Score: 67.781 bits (164), Expect = 5.624e-12
Identity = 30/93 (32.26%), Postives = 52/93 (55.91%), Query Frame = 3
Query:  354 ANPEHQMSHLHKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAI 632
             N   Q+     +    K+FVGGL + T+ + L++YF  FGE+ +  +  D+QTG+SRG+GF+  K++    K +      +DGR+ +   A+
Sbjct:   71 GNEGGQIDASKGEEDAGKMFVGGLSWDTSKKDLKDYFSKFGEVTDCTIKMDQQTGRSRGFGFILFKDAASVDKVLEQKEHRLDGRQIDPKRAM 163          
BLAST of RNA-binding protein vs. Planmine SMEST
Match: SMESG000040788.1 (SMESG000040788.1)

HSP 1 Score: 485.337 bits (1248), Expect = 1.736e-172
Identity = 276/276 (100.00%), Postives = 276/276 (100.00%), Query Frame = 3
Query:  267 MNYXXXXXXXXXXXXXENLKRLLKNNEIPANPEHQMSHLHKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAILGAKPRNVPSMNSLVDNLHNIDQANRFNTILSSSYSNPLLNILYPTLQNNALLQPVLSQCPYTXXXXXXXXXXXXXXXXXXCYLNLLGNPSAEQYLTSNLAFNNCQKVPNSPQLVHINSNNKVFLKSEQSNPINFPIVQLQSPSIIYPKMPFHN 1094
            MNYSSSSSSPSPCKSSENLKRLLKNNEIPANPEHQMSHLHKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAILGAKPRNVPSMNSLVDNLHNIDQANRFNTILSSSYSNPLLNILYPTLQNNALLQPVLSQCPYTNPILNHSINIPIISPNNNCYLNLLGNPSAEQYLTSNLAFNNCQKVPNSPQLVHINSNNKVFLKSEQSNPINFPIVQLQSPSIIYPKMPFHN
Sbjct:    1 MNYSSSSSSPSPCKSSENLKRLLKNNEIPANPEHQMSHLHKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAILGAKPRNVPSMNSLVDNLHNIDQANRFNTILSSSYSNPLLNILYPTLQNNALLQPVLSQCPYTNPILNHSINIPIISPNNNCYLNLLGNPSAEQYLTSNLAFNNCQKVPNSPQLVHINSNNKVFLKSEQSNPINFPIVQLQSPSIIYPKMPFHN 276          
BLAST of RNA-binding protein vs. Planmine SMEST
Match: SMESG000006741.1 (SMESG000006741.1)

HSP 1 Score: 166.392 bits (420), Expect = 1.364e-49
Identity = 80/109 (73.39%), Postives = 89/109 (81.65%), Query Frame = 3
Query:  342 NEIPANPEHQMSHLHKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAILGAKPRNVPSMN 668
            N  P N +H     HKDTT TKIFVGGLPYHTTDE+LR +FE FG +EEAVVITDRQ+GKSRGYGFVTM N EDA +AI +PNPCIDGRK NVNLAILGAKPR +P +N
Sbjct:   19 NSKPTNNQH-----HKDTTLTKIFVGGLPYHTTDESLRVFFECFGPIEEAVVITDRQSGKSRGYGFVTMVNCEDAYRAISNPNPCIDGRKANVNLAILGAKPRILPGVN 122          
BLAST of RNA-binding protein vs. Planmine SMEST
Match: SMESG000006741.1 (SMESG000006741.1)

HSP 1 Score: 168.703 bits (426), Expect = 1.144e-48
Identity = 80/109 (73.39%), Postives = 89/109 (81.65%), Query Frame = 3
Query:  342 NEIPANPEHQMSHLHKDTTYTKIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAILGAKPRNVPSMN 668
            N  P N +H     HKDTT TKIFVGGLPYHTTDE+LR +FE FG +EEAVVITDRQ+GKSRGYGFVTM N EDA +AI +PNPCIDGRK NVNLAILGAKPR +P +N
Sbjct:   19 NSKPTNNQH-----HKDTTLTKIFVGGLPYHTTDESLRVFFECFGPIEEAVVITDRQSGKSRGYGFVTMVNCEDAYRAISNPNPCIDGRKANVNLAILGAKPRILPGVN 122          
BLAST of RNA-binding protein vs. Planmine SMEST
Match: SMESG000020492.1 (SMESG000020492.1)

HSP 1 Score: 75.8702 bits (185), Expect = 1.441e-14
Identity = 35/95 (36.84%), Postives = 58/95 (61.05%), Query Frame = 3
Query:  405 KIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNP-CIDGRKTNVNLAILGAKPRNVPSMNSLVDNL 686
            K+F+GGL   T D++LRNYF+ FG +E+ VV+ D +TG+SRG+G++   + E   + +L+  P  +DG+  +V    +  K RN  S+   V  +
Sbjct:   11 KVFIGGLSQATNDDSLRNYFDQFGSIEDCVVMMDNKTGRSRGFGYIKF-HEESTVRTVLEEGPHLLDGKIVDVKQCNIHMKGRNRRSLKIFVGGI 104          
BLAST of RNA-binding protein vs. Planmine SMEST
Match: SMESG000045507.1 (SMESG000045507.1)

HSP 1 Score: 67.3958 bits (163), Expect = 3.634e-13
Identity = 35/102 (34.31%), Postives = 59/102 (57.84%), Query Frame = 3
Query:  405 KIFVGGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDATKAILDPNPCIDGRKTNVNLAILGAKPRNVPSMNSLVDNLHNIDQANR 710
            K+F+GGL  HTT ETLRNYF+ +G++++ +++ D  T +SRG+GFVT  +     K +L+    +D +K +  +AI        P    L+D   N ++  +
Sbjct:   18 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSKKIDPKIAI--------PKKPELIDKAINTEKTRK 111          
The following BLAST results are available for this feature:
BLAST of RNA-binding protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RBM243.117e-4471.03RNA binding motif protein 24 [Source:HGNC Symbol;A... [more]
RBM384.769e-4468.22RNA binding motif protein 38 [Source:HGNC Symbol;A... [more]
RBM381.411e-4374.19RNA binding motif protein 38 [Source:HGNC Symbol;A... [more]
RBM381.516e-4368.22RNA binding motif protein 38 [Source:HGNC Symbol;A... [more]
RBM241.588e-2066.67RNA binding motif protein 24 [Source:HGNC Symbol;A... [more]
back to top
BLAST of RNA-binding protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sup-121.511e-4073.86SUPpressor [Source:UniProtKB/TrEMBL;Acc:O45189][more]
sup-126.815e-4051.80SUPpressor [Source:UniProtKB/TrEMBL;Acc:O45189][more]
msi-11.791e-1138.16MuSashI (Fly neural) family; Neural RNA-binding pr... [more]
tiar-12.609e-1140.20TIA-1/TIAL RNA binding protein homolog [Source:Un... [more]
tiar-15.630e-1140.20TIA-1/TIAL RNA binding protein homolog [Source:Un... [more]
back to top
BLAST of RNA-binding protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rbp63.603e-1238.16gene:FBgn0260943 transcript:FBtr0113427[more]
Rbp63.720e-1238.16gene:FBgn0260943 transcript:FBtr0075285[more]
Rbp64.422e-1238.16gene:FBgn0260943 transcript:FBtr0333861[more]
Rbp64.801e-1146.88gene:FBgn0260943 transcript:FBtr0290066[more]
Rbp66.261e-1148.33gene:FBgn0260943 transcript:FBtr0113428[more]
back to top
BLAST of RNA-binding protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbm24a7.423e-4577.42RNA binding motif protein 24a [Source:NCBI gene;Ac... [more]
rbm24a1.762e-4470.09RNA binding motif protein 24a [Source:NCBI gene;Ac... [more]
rbm24b7.199e-4470.09RNA binding motif protein 24b [Source:ZFIN;Acc:ZDB... [more]
rbm24b2.705e-4377.42RNA binding motif protein 24b [Source:ZFIN;Acc:ZDB... [more]
rbm24b5.527e-4377.42RNA binding motif protein 24b [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of RNA-binding protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nxph29.246e-4569.16neurexophilin 2 [Source:Xenbase;Acc:XB-GENE-951506... [more]
rbm241.288e-4369.16RNA binding motif protein 24 [Source:NCBI gene;Acc... [more]
cirbp6.020e-1646.05cold inducible RNA binding protein [Source:NCBI ge... [more]
cirbp6.496e-1646.05cold inducible RNA binding protein [Source:NCBI ge... [more]
cirbp6.547e-1646.05cold inducible RNA binding protein [Source:NCBI ge... [more]
back to top
BLAST of RNA-binding protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rbm247.923e-4470.09RNA binding motif protein 24 [Source:MGI Symbol;Ac... [more]
Rbm384.327e-4164.91RNA binding motif protein 38 [Source:MGI Symbol;Ac... [more]
Rbm384.327e-4164.91RNA binding motif protein 38 [Source:MGI Symbol;Ac... [more]
Rbm381.074e-2667.14RNA binding motif protein 38 [Source:MGI Symbol;Ac... [more]
Rbm381.186e-2069.64RNA binding motif protein 38 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of RNA-binding protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6DIV4|RBM38_XENTR4.898e-4469.16RNA-binding protein 38 OS=Xenopus tropicalis OX=83... [more]
sp|Q5ZJX4|RBM38_CHICK8.183e-4468.22RNA-binding protein 38 OS=Gallus gallus OX=9031 GN... [more]
sp|Q76LC6|RBM24_DANRE1.330e-4370.09RNA-binding protein 24 OS=Danio rerio OX=7955 GN=r... [more]
sp|Q9BX46|RBM24_HUMAN1.497e-4371.03RNA-binding protein 24 OS=Homo sapiens OX=9606 GN=... [more]
sp|Q9I8B3|RB24B_XENLA3.510e-4369.16RNA-binding protein 24-B OS=Xenopus laevis OX=8355... [more]
back to top
BLAST of RNA-binding protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8FVG71.463e-4682.61RRM domain-containing protein OS=Macrostomum ligna... [more]
A0A183AEQ82.119e-4674.77RRM domain-containing protein OS=Echinostoma capro... [more]
A0A267EVC22.173e-4682.61RRM domain-containing protein OS=Macrostomum ligna... [more]
A0A3R7CXU25.453e-4676.24RNA-binding protein 24 (Fragment) OS=Clonorchis si... [more]
A0A0R3X9T86.428e-4678.72RRM domain-containing protein OS=Hydatigena taenia... [more]
back to top
BLAST of RNA-binding protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbm24a1.595e-4470.09RNA binding motif protein 24 [Source:NCBI gene;Acc... [more]
rbm24a2.852e-4470.09RNA binding motif protein 24 [Source:NCBI gene;Acc... [more]
ENSAMXT00000016054.24.534e-4171.74RNA binding motif protein 38 [Source:NCBI gene;Acc... [more]
rbm383.120e-4054.61RNA-binding protein 38-like [Source:NCBI gene;Acc:... [more]
ENSAMXT00000056649.14.892e-2771.01pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of RNA-binding protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbm24a5.547e-4354.55RNA binding motif protein 24a [Source:NCBI gene;Ac... [more]
HNRNPA01.139e-1443.42heterogeneous nuclear ribonucleoprotein A0 [Source... [more]
ENSPMAT00000004893.11.603e-1441.38pep scaffold:Pmarinus_7.0:GL479484:4:2056:-1 gene:... [more]
HNRNPA01.782e-1339.33heterogeneous nuclear ribonucleoprotein A0 [Source... [more]
HNRNPA2B16.283e-1236.14heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
back to top
BLAST of RNA-binding protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PUB12.591e-1036.27Poly (A)+ RNA-binding protein; abundant mRNP-compo... [more]
NSR11.396e-942.67Nucleolar protein that binds nuclear localization ... [more]
SNP13.943e-938.98Component of U1 snRNP required for mRNA splicing v... [more]
HRP12.511e-830.00Subunit of cleavage factor I; cleavage factor I is... [more]
NOP132.415e-736.23Nucleolar protein found in preribosomal complexes;... [more]
back to top
BLAST of RNA-binding protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO401041.907e-3057.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO398798.682e-1542.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365226.903e-1444.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO297159.959e-1442.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO334029.598e-1346.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RNA-binding protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbm24a5.240e-4470.09RNA binding motif protein 24 [Source:NCBI gene;Acc... [more]
rbm24b1.179e-4368.22RNA-binding protein 24 [Source:NCBI gene;Acc:10116... [more]
RBM385.056e-4271.43RNA-binding protein 38 [Source:NCBI gene;Acc:10116... [more]
rbm385.264e-4165.71RNA-binding protein 38 [Source:NCBI gene;Acc:10115... [more]
hnrnpaba5.624e-1232.26heterogeneous nuclear ribonucleoprotein A/B [Sourc... [more]
back to top
BLAST of RNA-binding protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000040788.11.736e-172100.00SMESG000040788.1[more]
SMESG000006741.11.364e-4973.39SMESG000006741.1[more]
SMESG000006741.11.144e-4873.39SMESG000006741.1[more]
SMESG000020492.11.441e-1436.84SMESG000020492.1[more]
SMESG000045507.13.634e-1334.31SMESG000045507.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029150 ID=SMED30029150|Name=RNA-binding protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1386bp
GAGCATATATGAAGATAGCAGATAACAATAGTAAAACAAAACTTGTAAAT
GATTGGTGAATATCAGTCATTTTTGCTAGGTTTTACACAAGAGGTTTCTT
CAACTGAAACATTTATAACACACCGTTTTGCATCAACTTGACACAGTTGA
AATAATTCATCAAAAATAACGGTTGATAAAGACATACATATATAGATATA
TATACATATACAATATTTTTACAGAAAATTTCTGAATCAGTTTTTCAAAG
AAAGCCGTATTTAATCATGAATTATTCCTCCTCATCGTCGTCACCTAGTC
CGTGTAAATCCAGCGAAAATCTAAAACGACTTCTTAAAAACAACGAAATC
CCGGCGAATCCTGAACACCAAATGTCTCATTTGCATAAAGATACTACGTA
CACGAAGATTTTTGTTGGCGGTTTGCCTTATCATACGACAGACGAAACTT
TGAGAAATTATTTCGAATATTTCGGTGAGCTTGAAGAAGCAGTTGTCATT
ACCGATAGACAAACTGGAAAAAGTCGCGGATATGGTTTCGTAACCATGAA
AAATTCAGAAGACGCAACGAAAGCAATCTTAGATCCCAATCCTTGTATTG
ATGGAAGAAAAACAAATGTAAATTTAGCAATTCTTGGAGCCAAACCAAGA
AATGTCCCAAGTATGAATTCACTTGTGGATAATCTCCACAACATTGATCA
AGCTAATAGATTCAATACAATATTATCAAGCAGCTATTCAAATCCGTTAT
TAAACATTTTGTATCCGACATTGCAAAATAACGCATTGCTACAGCCGGTC
TTATCCCAATGTCCGTATACAAATCCAATCTTGAACCATTCAATAAATAT
CCCTATCATTTCTCCCAATAACAATTGTTACCTAAATTTACTTGGCAATC
CGTCTGCTGAACAATATTTGACCTCCAATTTGGCTTTTAATAACTGTCAA
AAAGTGCCAAATAGTCCACAATTAGTACATATCAATTCAAATAATAAAGT
GTTTTTAAAATCAGAGCAATCAAATCCTATAAATTTCCCAATTGTCCAGT
TGCAATCTCCCTCCATCATTTATCCGAAAATGCCATTCCATAATTGAATG
TTTTACTGAATTGAGGAATCTATTGATATTTTGTCCACGTTTCTGAAATA
CAAACTTATATTCATTTATTGAAGAGATTGACAGTTATTTTGTTGCATGA
ATTGTTTTAACCAATGTATTATTTGATATTTTGATAACTGTCTTACCGAA
TTTATGTGCAGGAGGGTTAAAGAAAGTGTTTATATTTTTTAAAAATTTTA
AATAATATTTGAATATGTTGGTGTACTGGGTGAAATTAGTTTGTTTAAAT
CGGTAGAAGATCCACTCTACCTACTCTATTCAACCG
back to top

protein sequence of SMED30029150-orf-1

>SMED30029150-orf-1 ID=SMED30029150-orf-1|Name=SMED30029150-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=277bp
MNYSSSSSSPSPCKSSENLKRLLKNNEIPANPEHQMSHLHKDTTYTKIFV
GGLPYHTTDETLRNYFEYFGELEEAVVITDRQTGKSRGYGFVTMKNSEDA
TKAILDPNPCIDGRKTNVNLAILGAKPRNVPSMNSLVDNLHNIDQANRFN
TILSSSYSNPLLNILYPTLQNNALLQPVLSQCPYTNPILNHSINIPIISP
NNNCYLNLLGNPSAEQYLTSNLAFNNCQKVPNSPQLVHINSNNKVFLKSE
QSNPINFPIVQLQSPSIIYPKMPFHN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003729mRNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR037366BOULE/DAZ
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 47..119
e-value: 4.9E-26
score: 102.5
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 48..104
e-value: 7.8E-19
score: 67.3
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 46..123
score: 18.189
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 12..129
e-value: 7.7E-27
score: 95.8
NoneNo IPR availablePANTHERPTHR11176:SF22coord: 38..134
NoneNo IPR availableCDDcd12384RRM_RBM24_RBM38_likecoord: 46..121
e-value: 1.15661E-47
score: 151.229
IPR037366BOULE/DAZ familyPANTHERPTHR11176BOULE-RELATEDcoord: 38..134
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 41..122