Sorting nexin-25-like protein

Overview
NameSorting nexin-25-like protein
Smed IDSMED30029142
Length (bp)4155
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Sorting nexin-25-like protein (SMED30029142) t-SNE clustered cells

Violin plots show distribution of expression levels for Sorting nexin-25-like protein (SMED30029142) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Sorting nexin-25-like protein (SMED30029142) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Sorting nexin-25-like protein (SMED30029142) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029142

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30029142SMESG000002020.1 dd_Smed_v4_1891_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30029142SMESG000002020.1 dd_Smed_v4_1891_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
lateral region of the whole animalSMED30029142SMESG000002020.1 dd_Smed_v4_1891_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30029142SMESG000002020.1 dd_Smed_v4_1891_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029142SMESG000002020.1 dd_Smed_v4_1891_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Sorting nexin-25-like protein vs. Ensembl Human
Match: SNX25 (sorting nexin 25 [Source:HGNC Symbol;Acc:HGNC:21883])

HSP 1 Score: 81.2629 bits (199), Expect = 8.807e-15
Identity = 93/395 (23.54%), Postives = 166/395 (42.03%), Query Frame = 2
Query: 2360 KIQKLNKKIDVKEKAYKAGVAVSNQMPLSKKEKSKMKIDLNSVKEDLNRLYEKRNKCQYNLSRVDKWILSLGNWNAVVYDVILPEPKRGTSLDLGYLPTLAESKSGTMAIEKDDMSTEDDTKQI-VIFIMVSLASTLDQYNSREDNGWLVKHTLKDFQALKRELTPQCPPIDRISLPKVPQRLF--IRRKYTDNDLSHIKDSLNKFIQFLMKTPILAKSESVFKFFCSSLESQMSNEDTL-MGPLSLFANTLSDASAKVMLMAKIPTKFVQKVLAPRKHSGSVTSLDSESTDSKSD---RKNTXXXXXXXXXXXXXXXXXXXXXXXXXDISMSAFELLEELIQLRKSLTLTRRSMITFVQSFFGKNLTQILTEKVAWIKSESTVFVCLQKYRDSF 3523
            K+++LN+K++ K +A  +   + N     KK  SK+K ++  ++++       R   Q +++R D W  +LG W A +                          SG +        TE++ +Q+   F+MVSL     +    E   W V   L +FQ L R+L+   P + ++ LP + +  F  I +K+ +      K+ LNKF+Q L+    L +SE+++ F   S        D L +  +    N+ S +S     + ++P  F         H    T  DS+ +D   D   RK+                           ++   F L+ E+ +LR      RR++I  VQ  FG+ + + + + V+WI SE  +   +  +RD+F
Sbjct:  447 KLRELNEKLEYKRQALNS---IQNAPKPDKKIVSKLKDEIILIEKE-------RTDLQLHMARTDWWCENLGMWKASI-------------------------TSGEV--------TEENGEQLPCYFVMVSL----QEVGGVETKNWTVPRRLSEFQNLHRKLSECVPSLKKVQLPSLSKLPFKSIDQKFMEKS----KNQLNKFLQNLLSDERLCQSEALYAFLSPS-------PDYLKVIDVQGKKNSFSLSS----FLERLPRDFF-------SHQEEETEEDSDLSDYGDDVDGRKDA--------------------------LAEPCFMLIGEIFELRGMFKWVRRTLIALVQVTFGRTINKQIRDTVSWIFSEQMLVYYINIFRDAF 746          
BLAST of Sorting nexin-25-like protein vs. Ensembl Human
Match: SNX25 (sorting nexin 25 [Source:HGNC Symbol;Acc:HGNC:21883])

HSP 1 Score: 81.2629 bits (199), Expect = 8.807e-15
Identity = 93/395 (23.54%), Postives = 166/395 (42.03%), Query Frame = 2
Query: 2360 KIQKLNKKIDVKEKAYKAGVAVSNQMPLSKKEKSKMKIDLNSVKEDLNRLYEKRNKCQYNLSRVDKWILSLGNWNAVVYDVILPEPKRGTSLDLGYLPTLAESKSGTMAIEKDDMSTEDDTKQI-VIFIMVSLASTLDQYNSREDNGWLVKHTLKDFQALKRELTPQCPPIDRISLPKVPQRLF--IRRKYTDNDLSHIKDSLNKFIQFLMKTPILAKSESVFKFFCSSLESQMSNEDTL-MGPLSLFANTLSDASAKVMLMAKIPTKFVQKVLAPRKHSGSVTSLDSESTDSKSD---RKNTXXXXXXXXXXXXXXXXXXXXXXXXXDISMSAFELLEELIQLRKSLTLTRRSMITFVQSFFGKNLTQILTEKVAWIKSESTVFVCLQKYRDSF 3523
            K+++LN+K++ K +A  +   + N     KK  SK+K ++  ++++       R   Q +++R D W  +LG W A +                          SG +        TE++ +Q+   F+MVSL     +    E   W V   L +FQ L R+L+   P + ++ LP + +  F  I +K+ +      K+ LNKF+Q L+    L +SE+++ F   S        D L +  +    N+ S +S     + ++P  F         H    T  DS+ +D   D   RK+                           ++   F L+ E+ +LR      RR++I  VQ  FG+ + + + + V+WI SE  +   +  +RD+F
Sbjct:  447 KLRELNEKLEYKRQALNS---IQNAPKPDKKIVSKLKDEIILIEKE-------RTDLQLHMARTDWWCENLGMWKASI-------------------------TSGEV--------TEENGEQLPCYFVMVSL----QEVGGVETKNWTVPRRLSEFQNLHRKLSECVPSLKKVQLPSLSKLPFKSIDQKFMEKS----KNQLNKFLQNLLSDERLCQSEALYAFLSPS-------PDYLKVIDVQGKKNSFSLSS----FLERLPRDFF-------SHQEEETEEDSDLSDYGDDVDGRKDA--------------------------LAEPCFMLIGEIFELRGMFKWVRRTLIALVQVTFGRTINKQIRDTVSWIFSEQMLVYYINIFRDAF 746          
BLAST of Sorting nexin-25-like protein vs. Ensembl Human
Match: SNX25 (sorting nexin 25 [Source:HGNC Symbol;Acc:HGNC:21883])

HSP 1 Score: 80.8777 bits (198), Expect = 1.309e-14
Identity = 93/395 (23.54%), Postives = 166/395 (42.03%), Query Frame = 2
Query: 2360 KIQKLNKKIDVKEKAYKAGVAVSNQMPLSKKEKSKMKIDLNSVKEDLNRLYEKRNKCQYNLSRVDKWILSLGNWNAVVYDVILPEPKRGTSLDLGYLPTLAESKSGTMAIEKDDMSTEDDTKQI-VIFIMVSLASTLDQYNSREDNGWLVKHTLKDFQALKRELTPQCPPIDRISLPKVPQRLF--IRRKYTDNDLSHIKDSLNKFIQFLMKTPILAKSESVFKFFCSSLESQMSNEDTL-MGPLSLFANTLSDASAKVMLMAKIPTKFVQKVLAPRKHSGSVTSLDSESTDSKSD---RKNTXXXXXXXXXXXXXXXXXXXXXXXXXDISMSAFELLEELIQLRKSLTLTRRSMITFVQSFFGKNLTQILTEKVAWIKSESTVFVCLQKYRDSF 3523
            K+++LN+K++ K +A  +   + N     KK  SK+K ++  ++++       R   Q +++R D W  +LG W A +                          SG +        TE++ +Q+   F+MVSL     +    E   W V   L +FQ L R+L+   P + ++ LP + +  F  I +K+ +      K+ LNKF+Q L+    L +SE+++ F   S        D L +  +    N+ S +S     + ++P  F         H    T  DS+ +D   D   RK+                           ++   F L+ E+ +LR      RR++I  VQ  FG+ + + + + V+WI SE  +   +  +RD+F
Sbjct:  611 KLRELNEKLEYKRQALNS---IQNAPKPDKKIVSKLKDEIILIEKE-------RTDLQLHMARTDWWCENLGMWKASI-------------------------TSGEV--------TEENGEQLPCYFVMVSL----QEVGGVETKNWTVPRRLSEFQNLHRKLSECVPSLKKVQLPSLSKLPFKSIDQKFMEKS----KNQLNKFLQNLLSDERLCQSEALYAFLSPS-------PDYLKVIDVQGKKNSFSLSS----FLERLPRDFF-------SHQEEETEEDSDLSDYGDDVDGRKDA--------------------------LAEPCFMLIGEIFELRGMFKWVRRTLIALVQVTFGRTINKQIRDTVSWIFSEQMLVYYINIFRDAF 910          
BLAST of Sorting nexin-25-like protein vs. Ensembl Zebrafish
Match: snx25 (sorting nexin 25 [Source:ZFIN;Acc:ZDB-GENE-121105-11])

HSP 1 Score: 74.7146 bits (182), Expect = 7.578e-13
Identity = 89/410 (21.71%), Postives = 164/410 (40.00%), Query Frame = 2
Query: 2312 NVPLTSGT----ETMEYYHQKIQKLNKKIDVKEKAYKAGVAVSNQMPLSKKEKSKMKIDLNSVKEDLNRLYEKRNKCQYNLSRVDKWILSLGNWNAVVYDVILPEPKRGTSLDLGYLPTLAESKSGTMAIEKDDMSTEDDTKQIVIFIMVSLASTLDQYNSREDNGWLVKHTLKDFQALKRELTPQCPPIDRISLPKVPQRLF--IRRKYTDNDLSHIKDSLNKFIQFLMKTPILAKSESVFKFFCSSLESQMSNEDTLMGPLSLFANTLSDASAKVMLMAKIPTKFVQKVLAPRKHSGSVTSLDSESTDSKSDRKNTXXXXXXXXXXXXXXXXXXXXXXXXXDISMSAFELLEELIQLRKSLTLTRRSMITFVQSFFGKNLTQILTEKVAWIKSESTVFVCLQKYRDSF 3523
            +V L  G+    E   Y   K+ +L ++++ K +A  +   + N     KK  S +K ++++++++ + L       + ++SR D W  +LG W AVV                    + AE+            S E+  +    F+ VSL+   D  N    N W V   L +FQAL R+LT   P + ++ LP + +  F  I +K+ D      K+ LN F+Q ++    + +SE+++ F   S E            L +       + +    + ++P  F         H       DS+ +D   +                              ++   F L+ E+ +LR      R+++I  VQ  FG+ + + + + V WI SE  +   +  +RD+F
Sbjct:  554 DVALDEGSKGINEQASYAATKLHQLYERLEYKRQALGS---IQNAPRPDKKIVSLLKDEISAMEKEHSDL-------ELHISRTDCWCENLGTWRAVV--------------------STAEA------------SEENGEQMACYFVAVSLSEEDDCKN----NHWTVSRKLIEFQALHRKLTECFPSLKKVQLPSLSKLPFKSIDQKFLDKS----KNQLNAFLQKVLTDERMCQSEALYAFLSPSPEH-----------LKVIDIQKKSSFSLASFLERLPGDFF-------SHQEDEAEDDSDLSDYGDEPDGKKDA-----------------------LAEPCFMLIGEIFELRGMFKWVRKTLIALVQVTFGRTINKQIRDTVNWIFSEQMMVYYINVFRDTF 872          
BLAST of Sorting nexin-25-like protein vs. Ensembl Mouse
Match: Snx25 (sorting nexin 25 [Source:MGI Symbol;Acc:MGI:2142610])

HSP 1 Score: 71.2478 bits (173), Expect = 7.907e-12
Identity = 89/407 (21.87%), Postives = 164/407 (40.29%), Query Frame = 2
Query: 2309 ENVPLTSG-TETMEYYHQKIQKLNKKIDVKEKAYKAGVAVSNQMPLSKKEKSKMKIDLNSVKEDLNRLYEKRNKCQYNLSRVDKWILSLGNWNAVVYDVILPEPKRGTSLDLGYLPTLAESKSGTMAIEKDDMSTEDDTKQIVIFIMVSLASTLDQYNSREDNGWLVKHTLKDFQALKRELTPQCPPIDRISLPKVPQRLFIRRKYTDND-LSHIKDSLNKFIQFLMKTPILAKSESVFKFFCSSLESQMSNEDTLMGPLSLFANTLSDASAKVMLMAKIPTKFVQKVLAPRKHSGSVTSLDSESTDSKSDRKNTXXXXXXXXXXXXXXXXXXXXXXXXXDISMSAFELLEELIQLRKSLTLTRRSMITFVQSFFGKNLTQILTEKVAWIKSESTVFVCLQKYRDSF 3523
            E V  TSG ++   +   K+++LN+K++ K +A  +   + N     KK  SK+K ++  ++++   L       Q +++R D W  +LG W A                                +I   +++ E+  +    F+ V+L     +    E   W V   L +FQ L R+L+   P + ++ LP + +  F   K  D+  L   ++ LN F+Q L+    L +SE+++ F   S +     +  + G  + F  +LS        + K+P  F         H       DS+ +D   D                              ++   F L+ E+ +LR      RR++I  VQ  FG+ + + + + V+WI SE  +   +  +RD+F
Sbjct:  575 EAVEGTSGVSDPASFAVIKLRELNEKLEYKRQALSS---IQNAPKPDKKIISKLKDEILLIEKECTAL-------QLHMARTDWWCENLGLWRA--------------------------------SITSAEVTEENGEQMPCYFVRVNL----QEVGGVETKNWTVPRRLSEFQNLHRKLSECVPSLKKVQLPSLSKLPF---KSIDHKFLGKSRNQLNAFLQNLLSDERLFQSEALYAFLSPSPDYLKVID--VQGKKTSF--SLSS------FLEKLPRDFF-------SHQEEEIEEDSDLSDYGDDVDG-----------------------KKDSLAEPCFMLIGEIFELRGMFKWVRRTLIALVQVTFGRTINKQIRDTVSWISSEQMLVYYISAFRDAF 892          

HSP 2 Score: 55.8398 bits (133), Expect = 3.939e-7
Identity = 56/235 (23.83%), Postives = 115/235 (48.94%), Query Frame = 2
Query:  677 ISEVVHRMSVIEWNIFFCNTLLDNMKSHINFLKSRNNQNDE-------NMYFMGTKTENLFVEAISNRLLRSLLDCKYIQCELVYQFSLGILSHQVIKRAVEYYCEPVNHNQWLFQKLIEKKITRSKLNKQLPHFQYDMSFEDFFKMVESISDLNEVKQIKQKLLNELRMAEVLKFTQSNIDSKNANKKKIQDHNKIGRKTAC-KGHLLTQRDLKCYSNQLSTLLDTVNTKLKMM 1357
            + ++  R+S ++     CN ++  + +H   LK+   +++E       +     +  E  F++  S  L+  LL  K IQ   +      IL+ +V+K  VE    P   NQ L ++L E +   S+ +K+   + Y  S+EDF K++ S SD++ +KQ++ +++ E+  A  +           ++  +++ H   G+++A  K  LL  R++K Y NQL+        +++++
Sbjct:  189 VKQIRQRLSHVDVVKVVCNDIVKALLTHFCDLKAATARHEEQPRPFVLHACLKDSHDEVRFLQTCSQVLVLCLLPSKDIQSLSLRTMLAEILTTKVLKPVVELLSNPDYINQMLLRQL-EYREQMSEHHKRA--YTYAPSYEDFIKLINSNSDVDFLKQLRYQIVVEIIQATTI-----------SSFPQLKRHK--GKESAAMKTDLLRARNMKRYINQLTVAKKQCEKRIRIL 407          
BLAST of Sorting nexin-25-like protein vs. Ensembl Mouse
Match: Snx25 (sorting nexin 25 [Source:MGI Symbol;Acc:MGI:2142610])

HSP 1 Score: 70.8626 bits (172), Expect = 1.019e-11
Identity = 89/408 (21.81%), Postives = 164/408 (40.20%), Query Frame = 2
Query: 2309 ENVPLTSG-TETMEYYHQKIQKLNKKIDVKEKAYKAGVAVSNQMPLSKKEKSKMKIDLNSVKEDLNRLYEKRNKCQYNLSRVDKWILSLGNWNAVVYDVILPEPKRGTSLDLGYLPTLAESKSGTMAIEKDDMSTEDDTKQIVIFIMVSLASTLDQYNSREDNGWLVKHTLKDFQALKRELTPQCPPIDRISLPKVPQRLF--IRRKYTDNDLSHIKDSLNKFIQFLMKTPILAKSESVFKFFCSSLESQMSNEDTLMGPLSLFANTLSDASAKVMLMAKIPTKFVQKVLAPRKHSGSVTSLDSESTDSKSDRKNTXXXXXXXXXXXXXXXXXXXXXXXXXDISMSAFELLEELIQLRKSLTLTRRSMITFVQSFFGKNLTQILTEKVAWIKSESTVFVCLQKYRDSF 3523
            E V  TSG ++   +   K+++LN+K++ K +A  +   + N     KK  SK+K ++  ++++   L       Q +++R D W  +LG W A                                +I   +++ E+  +    F+ V+L     +    E   W V   L +FQ L R+L+   P + ++ LP + +  F  I  K+    L   ++ LN F+Q L+    L +SE+++ F   S +     +  + G  + F  +LS        + K+P  F         H       DS+ +D   D                              ++   F L+ E+ +LR      RR++I  VQ  FG+ + + + + V+WI SE  +   +  +RD+F
Sbjct:  429 EAVEGTSGVSDPASFAVIKLRELNEKLEYKRQALSS---IQNAPKPDKKIISKLKDEILLIEKECTAL-------QLHMARTDWWCENLGLWRA--------------------------------SITSAEVTEENGEQMPCYFVRVNL----QEVGGVETKNWTVPRRLSEFQNLHRKLSECVPSLKKVQLPSLSKLPFKSIDHKF----LGKSRNQLNAFLQNLLSDERLFQSEALYAFLSPSPDYLKVID--VQGKKTSF--SLSS------FLEKLPRDFF-------SHQEEEIEEDSDLSDYGDDVDG-----------------------KKDSLAEPCFMLIGEIFELRGMFKWVRRTLIALVQVTFGRTINKQIRDTVSWISSEQMLVYYISAFRDAF 746          

HSP 2 Score: 54.6842 bits (130), Expect = 9.841e-7
Identity = 56/235 (23.83%), Postives = 115/235 (48.94%), Query Frame = 2
Query:  677 ISEVVHRMSVIEWNIFFCNTLLDNMKSHINFLKSRNNQNDE-------NMYFMGTKTENLFVEAISNRLLRSLLDCKYIQCELVYQFSLGILSHQVIKRAVEYYCEPVNHNQWLFQKLIEKKITRSKLNKQLPHFQYDMSFEDFFKMVESISDLNEVKQIKQKLLNELRMAEVLKFTQSNIDSKNANKKKIQDHNKIGRKTAC-KGHLLTQRDLKCYSNQLSTLLDTVNTKLKMM 1357
            + ++  R+S ++     CN ++  + +H   LK+   +++E       +     +  E  F++  S  L+  LL  K IQ   +      IL+ +V+K  VE    P   NQ L ++L E +   S+ +K+   + Y  S+EDF K++ S SD++ +KQ++ +++ E+  A  +           ++  +++ H   G+++A  K  LL  R++K Y NQL+        +++++
Sbjct:   43 VKQIRQRLSHVDVVKVVCNDIVKALLTHFCDLKAATARHEEQPRPFVLHACLKDSHDEVRFLQTCSQVLVLCLLPSKDIQSLSLRTMLAEILTTKVLKPVVELLSNPDYINQMLLRQL-EYREQMSEHHKR--AYTYAPSYEDFIKLINSNSDVDFLKQLRYQIVVEIIQATTI-----------SSFPQLKRHK--GKESAAMKTDLLRARNMKRYINQLTVAKKQCEKRIRIL 261          
BLAST of Sorting nexin-25-like protein vs. Ensembl Mouse
Match: Snx25 (sorting nexin 25 [Source:MGI Symbol;Acc:MGI:2142610])

HSP 1 Score: 70.8626 bits (172), Expect = 1.019e-11
Identity = 89/408 (21.81%), Postives = 164/408 (40.20%), Query Frame = 2
Query: 2309 ENVPLTSG-TETMEYYHQKIQKLNKKIDVKEKAYKAGVAVSNQMPLSKKEKSKMKIDLNSVKEDLNRLYEKRNKCQYNLSRVDKWILSLGNWNAVVYDVILPEPKRGTSLDLGYLPTLAESKSGTMAIEKDDMSTEDDTKQIVIFIMVSLASTLDQYNSREDNGWLVKHTLKDFQALKRELTPQCPPIDRISLPKVPQRLF--IRRKYTDNDLSHIKDSLNKFIQFLMKTPILAKSESVFKFFCSSLESQMSNEDTLMGPLSLFANTLSDASAKVMLMAKIPTKFVQKVLAPRKHSGSVTSLDSESTDSKSDRKNTXXXXXXXXXXXXXXXXXXXXXXXXXDISMSAFELLEELIQLRKSLTLTRRSMITFVQSFFGKNLTQILTEKVAWIKSESTVFVCLQKYRDSF 3523
            E V  TSG ++   +   K+++LN+K++ K +A  +   + N     KK  SK+K ++  ++++   L       Q +++R D W  +LG W A                                +I   +++ E+  +    F+ V+L     +    E   W V   L +FQ L R+L+   P + ++ LP + +  F  I  K+    L   ++ LN F+Q L+    L +SE+++ F   S +     +  + G  + F  +LS        + K+P  F         H       DS+ +D   D                              ++   F L+ E+ +LR      RR++I  VQ  FG+ + + + + V+WI SE  +   +  +RD+F
Sbjct:  429 EAVEGTSGVSDPASFAVIKLRELNEKLEYKRQALSS---IQNAPKPDKKIISKLKDEILLIEKECTAL-------QLHMARTDWWCENLGLWRA--------------------------------SITSAEVTEENGEQMPCYFVRVNL----QEVGGVETKNWTVPRRLSEFQNLHRKLSECVPSLKKVQLPSLSKLPFKSIDHKF----LGKSRNQLNAFLQNLLSDERLFQSEALYAFLSPSPDYLKVID--VQGKKTSF--SLSS------FLEKLPRDFF-------SHQEEEIEEDSDLSDYGDDVDG-----------------------KKDSLAEPCFMLIGEIFELRGMFKWVRRTLIALVQVTFGRTINKQIRDTVSWISSEQMLVYYISAFRDAF 746          

HSP 2 Score: 54.6842 bits (130), Expect = 9.841e-7
Identity = 56/235 (23.83%), Postives = 115/235 (48.94%), Query Frame = 2
Query:  677 ISEVVHRMSVIEWNIFFCNTLLDNMKSHINFLKSRNNQNDE-------NMYFMGTKTENLFVEAISNRLLRSLLDCKYIQCELVYQFSLGILSHQVIKRAVEYYCEPVNHNQWLFQKLIEKKITRSKLNKQLPHFQYDMSFEDFFKMVESISDLNEVKQIKQKLLNELRMAEVLKFTQSNIDSKNANKKKIQDHNKIGRKTAC-KGHLLTQRDLKCYSNQLSTLLDTVNTKLKMM 1357
            + ++  R+S ++     CN ++  + +H   LK+   +++E       +     +  E  F++  S  L+  LL  K IQ   +      IL+ +V+K  VE    P   NQ L ++L E +   S+ +K+   + Y  S+EDF K++ S SD++ +KQ++ +++ E+  A  +           ++  +++ H   G+++A  K  LL  R++K Y NQL+        +++++
Sbjct:   43 VKQIRQRLSHVDVVKVVCNDIVKALLTHFCDLKAATARHEEQPRPFVLHACLKDSHDEVRFLQTCSQVLVLCLLPSKDIQSLSLRTMLAEILTTKVLKPVVELLSNPDYINQMLLRQL-EYREQMSEHHKR--AYTYAPSYEDFIKLINSNSDVDFLKQLRYQIVVEIIQATTI-----------SSFPQLKRHK--GKESAAMKTDLLRARNMKRYINQLTVAKKQCEKRIRIL 261          
BLAST of Sorting nexin-25-like protein vs. UniProt/SwissProt
Match: sp|Q9H3E2|SNX25_HUMAN (Sorting nexin-25 OS=Homo sapiens OX=9606 GN=SNX25 PE=1 SV=2)

HSP 1 Score: 81.2629 bits (199), Expect = 4.229e-14
Identity = 93/395 (23.54%), Postives = 166/395 (42.03%), Query Frame = 2
Query: 2360 KIQKLNKKIDVKEKAYKAGVAVSNQMPLSKKEKSKMKIDLNSVKEDLNRLYEKRNKCQYNLSRVDKWILSLGNWNAVVYDVILPEPKRGTSLDLGYLPTLAESKSGTMAIEKDDMSTEDDTKQI-VIFIMVSLASTLDQYNSREDNGWLVKHTLKDFQALKRELTPQCPPIDRISLPKVPQRLF--IRRKYTDNDLSHIKDSLNKFIQFLMKTPILAKSESVFKFFCSSLESQMSNEDTL-MGPLSLFANTLSDASAKVMLMAKIPTKFVQKVLAPRKHSGSVTSLDSESTDSKSD---RKNTXXXXXXXXXXXXXXXXXXXXXXXXXDISMSAFELLEELIQLRKSLTLTRRSMITFVQSFFGKNLTQILTEKVAWIKSESTVFVCLQKYRDSF 3523
            K+++LN+K++ K +A  +   + N     KK  SK+K ++  ++++       R   Q +++R D W  +LG W A +                          SG +        TE++ +Q+   F+MVSL     +    E   W V   L +FQ L R+L+   P + ++ LP + +  F  I +K+ +      K+ LNKF+Q L+    L +SE+++ F   S        D L +  +    N+ S +S     + ++P  F         H    T  DS+ +D   D   RK+                           ++   F L+ E+ +LR      RR++I  VQ  FG+ + + + + V+WI SE  +   +  +RD+F
Sbjct:  447 KLRELNEKLEYKRQALNS---IQNAPKPDKKIVSKLKDEIILIEKE-------RTDLQLHMARTDWWCENLGMWKASI-------------------------TSGEV--------TEENGEQLPCYFVMVSL----QEVGGVETKNWTVPRRLSEFQNLHRKLSECVPSLKKVQLPSLSKLPFKSIDQKFMEKS----KNQLNKFLQNLLSDERLCQSEALYAFLSPS-------PDYLKVIDVQGKKNSFSLSS----FLERLPRDFF-------SHQEEETEEDSDLSDYGDDVDGRKDA--------------------------LAEPCFMLIGEIFELRGMFKWVRRTLIALVQVTFGRTINKQIRDTVSWIFSEQMLVYYINIFRDAF 746          
BLAST of Sorting nexin-25-like protein vs. UniProt/SwissProt
Match: sp|Q3ZT31|SNX25_MOUSE (Sorting nexin-25 OS=Mus musculus OX=10090 GN=Snx25 PE=1 SV=3)

HSP 1 Score: 70.8626 bits (172), Expect = 7.130e-11
Identity = 89/408 (21.81%), Postives = 164/408 (40.20%), Query Frame = 2
Query: 2309 ENVPLTSG-TETMEYYHQKIQKLNKKIDVKEKAYKAGVAVSNQMPLSKKEKSKMKIDLNSVKEDLNRLYEKRNKCQYNLSRVDKWILSLGNWNAVVYDVILPEPKRGTSLDLGYLPTLAESKSGTMAIEKDDMSTEDDTKQIVIFIMVSLASTLDQYNSREDNGWLVKHTLKDFQALKRELTPQCPPIDRISLPKVPQRLF--IRRKYTDNDLSHIKDSLNKFIQFLMKTPILAKSESVFKFFCSSLESQMSNEDTLMGPLSLFANTLSDASAKVMLMAKIPTKFVQKVLAPRKHSGSVTSLDSESTDSKSDRKNTXXXXXXXXXXXXXXXXXXXXXXXXXDISMSAFELLEELIQLRKSLTLTRRSMITFVQSFFGKNLTQILTEKVAWIKSESTVFVCLQKYRDSF 3523
            E V  TSG ++   +   K+++LN+K++ K +A  +   + N     KK  SK+K ++  ++++   L       Q +++R D W  +LG W A                                +I   +++ E+  +    F+ V+L     +    E   W V   L +FQ L R+L+   P + ++ LP + +  F  I  K+    L   ++ LN F+Q L+    L +SE+++ F   S +     +  + G  + F  +LS        + K+P  F         H       DS+ +D   D                              ++   F L+ E+ +LR      RR++I  VQ  FG+ + + + + V+WI SE  +   +  +RD+F
Sbjct:  429 EAVEGTSGVSDPASFAVIKLRELNEKLEYKRQALSS---IQNAPKPDKKIISKLKDEILLIEKECTAL-------QLHMARTDWWCENLGLWRA--------------------------------SITSAEVTEENGEQMPCYFVRVNL----QEVGGVETKNWTVPRRLSEFQNLHRKLSECVPSLKKVQLPSLSKLPFKSIDHKF----LGKSRNQLNAFLQNLLSDERLFQSEALYAFLSPSPDYLKVID--VQGKKTSF--SLSS------FLEKLPRDFF-------SHQEEEIEEDSDLSDYGDDVDG-----------------------KKDSLAEPCFMLIGEIFELRGMFKWVRRTLIALVQVTFGRTINKQIRDTVSWISSEQMLVYYISAFRDAF 746          

HSP 2 Score: 54.6842 bits (130), Expect = 6.884e-6
Identity = 56/235 (23.83%), Postives = 115/235 (48.94%), Query Frame = 2
Query:  677 ISEVVHRMSVIEWNIFFCNTLLDNMKSHINFLKSRNNQNDE-------NMYFMGTKTENLFVEAISNRLLRSLLDCKYIQCELVYQFSLGILSHQVIKRAVEYYCEPVNHNQWLFQKLIEKKITRSKLNKQLPHFQYDMSFEDFFKMVESISDLNEVKQIKQKLLNELRMAEVLKFTQSNIDSKNANKKKIQDHNKIGRKTAC-KGHLLTQRDLKCYSNQLSTLLDTVNTKLKMM 1357
            + ++  R+S ++     CN ++  + +H   LK+   +++E       +     +  E  F++  S  L+  LL  K IQ   +      IL+ +V+K  VE    P   NQ L ++L E +   S+ +K+   + Y  S+EDF K++ S SD++ +KQ++ +++ E+  A  +           ++  +++ H   G+++A  K  LL  R++K Y NQL+        +++++
Sbjct:   43 VKQIRQRLSHVDVVKVVCNDIVKALLTHFCDLKAATARHEEQPRPFVLHACLKDSHDEVRFLQTCSQVLVLCLLPSKDIQSLSLRTMLAEILTTKVLKPVVELLSNPDYINQMLLRQL-EYREQMSEHHKR--AYTYAPSYEDFIKLINSNSDVDFLKQLRYQIVVEIIQATTI-----------SSFPQLKRHK--GKESAAMKTDLLRARNMKRYINQLTVAKKQCEKRIRIL 261          
BLAST of Sorting nexin-25-like protein vs. TrEMBL
Match: A0A4D5S4E6 (Putative sorting nexin OS=Ixodes scapularis OX=6945 PE=4 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 1.482e-12
Identity = 96/416 (23.08%), Postives = 161/416 (38.70%), Query Frame = 2
Query: 2309 ENVPLTSG-------TETMEYYHQKIQKLNKKIDVKEKAYKAGVAVSNQMPLSKKEKSKMKIDLNSVKEDLNRLYEKRNKCQYNLSRVDKWILSLGNWNAVVYDVILPEPKRGTSLDLGYLPTLAESKSGTMAIEKDDMSTEDDTKQIVIFIMVSLASTLDQYNSREDNGWLVKHTLKDFQALKRELTPQCPPIDRISLPKVPQRLFIRRKYTDNDLSHIKDSLNKFIQFLMKTPILAKSESVFKFFCSS---LESQM-SNEDTLMGPLSLFANTLSDASAKVMLMAKIPTKFVQKVLAPRKHSGSVTSLDSESTDSKSDRKNTXXXXXXXXXXXXXXXXXXXXXXXXXDISMSAFELLEELIQLRKSLTLTRRSMITFVQSFFGKNLTQILTEKVAWIKSESTVFVCLQKYRDSF 3523
            E  PL SG       TE      +++ +L  ++D K +A +A  A  +  P   K    ++ ++ S++   +RL          + R+  WI  LG W A ++   L                                  +D   ++V +  + L S  D   S    GW+V  T+ DF  L++ L P CP + + +LP   +  F  R Y    L   +  L +F+ F+MK   L KS++++ FF      LE  + + +     PL  F   LS            PT F          +     L     D + D+K+                          D+++  + L +EL +L+      RR++I+FVQ+ +GK + + L E V+W  SE      L++ RDS 
Sbjct:  528 ERAPLPSGLPHPPTVTECCSLAQERLSRLEARMDEKRRALQALHATLDSDP---KMVQTLEKEMESMRGQCDRLAA-------YIERLQAWIQGLGLWTASIHSSQL---------------------------------VKDSNLKLVPYFAI-LVSVPDSSRS----GWVVTKTIPDFHCLQQRLLPVCPELKQQALPSANKPRF--RNYNQPFLDKTQPILQRFLDFVMKEERLNKSDALYSFFSQGPDPLEQDLPAAKKGFPFPLLQFFRNLSG-----------PTLF--------DSNEEDDDLFFSDRDLREDKKD--------------------------DVAVPLYALADELFELQGVFNWLRRALISFVQTSYGKTINRQLREWVSWAVSEPVQLHLLEQLRDSL 848          
BLAST of Sorting nexin-25-like protein vs. TrEMBL
Match: V5HBB3 (Putative sorting nexin-25 (Fragment) OS=Ixodes ricinus OX=34613 PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 2.707e-12
Identity = 95/416 (22.84%), Postives = 160/416 (38.46%), Query Frame = 2
Query: 2309 ENVPLTSG-------TETMEYYHQKIQKLNKKIDVKEKAYKAGVAVSNQMPLSKKEKSKMKIDLNSVKEDLNRLYEKRNKCQYNLSRVDKWILSLGNWNAVVYDVILPEPKRGTSLDLGYLPTLAESKSGTMAIEKDDMSTEDDTKQIVIFIMVSLASTLDQYNSREDNGWLVKHTLKDFQALKRELTPQCPPIDRISLPKVPQRLFIRRKYTDNDLSHIKDSLNKFIQFLMKTPILAKSESVFKFFCSS---LESQM-SNEDTLMGPLSLFANTLSDASAKVMLMAKIPTKFVQKVLAPRKHSGSVTSLDSESTDSKSDRKNTXXXXXXXXXXXXXXXXXXXXXXXXXDISMSAFELLEELIQLRKSLTLTRRSMITFVQSFFGKNLTQILTEKVAWIKSESTVFVCLQKYRDSF 3523
            E  PL SG       TE      +++ +L  ++D K +A +A  A  +  P   K    ++ ++ S++   +RL          + R+  WI  LG W A                                +I    +  + + K +  F +  L S  D   S    GW+V  T+ DF  L++ L P CP + + +LP   +  F  R Y    L   +  L +F+ F+MK   L +S++++ FF      LE  + + +     PL  F   LS            PT F          +     L     D + D+K+                          D+++  + L +EL +L+      RR++I+FVQ+ +GK + + L E V+W  SE      L++ RDS 
Sbjct:  345 ERAPLPSGLPHPPTVTECCSLAQERLSRLEARMDEKRRALQALHATLDSDP---KMVQTLEREMESMRGQCDRL-------ATYIERLQAWIQGLGLWTA--------------------------------SIHSSQIVKDSNLKPVPYFAI--LVSVPDSGRS----GWMVTKTIPDFHCLQQRLLPVCPELKQQALPSANKPRF--RSYNQPFLDKTQPILQRFLDFVMKEERLNRSDALYSFFSQGPDPLEQDLPAAKKGFPFPLLQFFRNLSG-----------PTLF--------DSNEEDDDLFFSDRDLREDKKD--------------------------DVAVPLYALADELFELQGVFNWLRRALISFVQTSYGKTINRQLREWVSWAVSEPVQLHLLEQLRDSL 665          
BLAST of Sorting nexin-25-like protein vs. TrEMBL
Match: A0A3Q7XNK2 (sorting nexin-25 OS=Ursus arctos horribilis OX=116960 GN=SNX25 PE=4 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 3.569e-11
Identity = 90/393 (22.90%), Postives = 161/393 (40.97%), Query Frame = 2
Query: 2360 KIQKLNKKIDVKEKAYKAGVAVSNQMPLSKKEKSKMKIDLNSVKEDLNRLYEKRNKCQYNLSRVDKWILSLGNWNAVVYDVILPEPKRGTSLDLGYLPTLAESKSGTMAIEKDDMSTEDDTKQIVIFIMVSLASTLDQYNSREDNGWLVKHTLKDFQALKRELTPQCPPIDRISLPKVPQRLF--IRRKYTDNDLSHIKDSLNKFIQFLMKTPILAKSESVFKFFCSSLESQMSNEDTLMGPLSLFANTLSDASAKVMLMAKIPTKFVQKVLAPRKHSGSVTSLDSESTDSKSD---RKNTXXXXXXXXXXXXXXXXXXXXXXXXXDISMSAFELLEELIQLRKSLTLTRRSMITFVQSFFGKNLTQILTEKVAWIKSESTVFVCLQKYRDSF 3523
            K+++LN+K++ K +A        N +  + K   K+   L   KE++  + ++R   Q +++R D W  +LG W A                                +I   +++ E+  +    F+MVSL     +    E   W V   L +FQ L R+L+   P + ++ LP + +  F  I  K+ +      K+ LNKF+Q L+    L +SE+++ F   S +     +  + G  S F  +LS        + ++P  F         H    T  DS+ +D   D   RK+                           ++   F L+ E+ +LR      RR++I  VQ  FG+ + + + + V+WI SE  +   +  +RD+F
Sbjct:  604 KLRELNEKLEYKRQAL-------NSIQNAPKPDKKIVFKL---KEEIILIEKERTDLQLHMARTDWWCENLGMWKA--------------------------------SITSGEVTEENGEQMPCYFVMVSL----QEVGGVETKNWTVPRRLSEFQNLHRKLSECFPSLKKVQLPSLSKLPFKSIDHKFMEKS----KNQLNKFLQNLLSDERLCQSEALYAFLSPSPDYLKVID--VQGKKSTF--SLSS------FLERLPRDFF-------SHQEEETEEDSDLSDYGDDVDGRKDA--------------------------LAEPCFMLIGEIFELRGMFKWVRRTLIALVQVTFGRTINKQIRDTVSWIFSEQMLVYYVSVFRDAF 903          
BLAST of Sorting nexin-25-like protein vs. TrEMBL
Match: G1LFE8 (Sorting nexin 25 OS=Ailuropoda melanoleuca OX=9646 GN=SNX25 PE=4 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 3.840e-11
Identity = 90/393 (22.90%), Postives = 160/393 (40.71%), Query Frame = 2
Query: 2360 KIQKLNKKIDVKEKAYKAGVAVSNQMPLSKKEKSKMKIDLNSVKEDLNRLYEKRNKCQYNLSRVDKWILSLGNWNAVVYDVILPEPKRGTSLDLGYLPTLAESKSGTMAIEKDDMSTEDDTKQIVIFIMVSLASTLDQYNSREDNGWLVKHTLKDFQALKRELTPQCPPIDRISLPKVPQRLF--IRRKYTDNDLSHIKDSLNKFIQFLMKTPILAKSESVFKFFCSSLESQMSNEDTLMGPLSLFANTLSDASAKVMLMAKIPTKFVQKVLAPRKHSGSVTSLDSESTDSKSD---RKNTXXXXXXXXXXXXXXXXXXXXXXXXXDISMSAFELLEELIQLRKSLTLTRRSMITFVQSFFGKNLTQILTEKVAWIKSESTVFVCLQKYRDSF 3523
            K+++LN+K++ K +A        N +  + K   K+   L   KE++  + ++R   Q +++R D W  +LG W A                                +I   +++ E+  +    F+MVSL     +    E   W V   L +FQ L R+L+   P + ++ LP + +  F  I  K+ +      K+ LNKF+Q L+    L +SE+++ F   S +     +  + G  S F  +LS        + ++P  F         H    T  DS+ +D   D   RK+                           ++   F L+ E+ +LR      RR++I  VQ  FG+ + + + + V WI SE  +   +  +RD+F
Sbjct:  120 KLRELNEKLEYKRQAL-------NSIQNAPKPDKKIVFKL---KEEIILIEKERTDLQLHMARTDWWCENLGMWKA--------------------------------SITSGEVTEENGEQMPCYFVMVSL----QEVGGVETKNWTVPRRLSEFQNLHRKLSECFPSLKKVQLPSLSKLPFKSIDHKFMEKS----KNQLNKFLQNLLSDERLCQSEALYAFLSPSPDYLKVID--VQGKKSTF--SLSS------FLERLPRDFF-------SHQEEETEEDSDLSDYGDDVDGRKDA--------------------------LAEPCFMLIGEIFELRGMFKWVRRTLIALVQVTFGRTINKQIRDTVNWIFSEQMLVYYISVFRDAF 419          
BLAST of Sorting nexin-25-like protein vs. TrEMBL
Match: D2HM30 (PX domain-containing protein (Fragment) OS=Ailuropoda melanoleuca OX=9646 GN=PANDA_012594 PE=4 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 3.999e-11
Identity = 90/393 (22.90%), Postives = 160/393 (40.71%), Query Frame = 2
Query: 2360 KIQKLNKKIDVKEKAYKAGVAVSNQMPLSKKEKSKMKIDLNSVKEDLNRLYEKRNKCQYNLSRVDKWILSLGNWNAVVYDVILPEPKRGTSLDLGYLPTLAESKSGTMAIEKDDMSTEDDTKQIVIFIMVSLASTLDQYNSREDNGWLVKHTLKDFQALKRELTPQCPPIDRISLPKVPQRLF--IRRKYTDNDLSHIKDSLNKFIQFLMKTPILAKSESVFKFFCSSLESQMSNEDTLMGPLSLFANTLSDASAKVMLMAKIPTKFVQKVLAPRKHSGSVTSLDSESTDSKSD---RKNTXXXXXXXXXXXXXXXXXXXXXXXXXDISMSAFELLEELIQLRKSLTLTRRSMITFVQSFFGKNLTQILTEKVAWIKSESTVFVCLQKYRDSF 3523
            K+++LN+K++ K +A        N +  + K   K+   L   KE++  + ++R   Q +++R D W  +LG W A                                +I   +++ E+  +    F+MVSL     +    E   W V   L +FQ L R+L+   P + ++ LP + +  F  I  K+ +      K+ LNKF+Q L+    L +SE+++ F   S +     +  + G  S F  +LS        + ++P  F         H    T  DS+ +D   D   RK+                           ++   F L+ E+ +LR      RR++I  VQ  FG+ + + + + V WI SE  +   +  +RD+F
Sbjct:  120 KLRELNEKLEYKRQAL-------NSIQNAPKPDKKIVFKL---KEEIILIEKERTDLQLHMARTDWWCENLGMWKA--------------------------------SITSGEVTEENGEQMPCYFVMVSL----QEVGGVETKNWTVPRRLSEFQNLHRKLSECFPSLKKVQLPSLSKLPFKSIDHKFMEKS----KNQLNKFLQNLLSDERLCQSEALYAFLSPSPDYLKVID--VQGKKSTF--SLSS------FLERLPRDFF-------SHQEEETEEDSDLSDYGDDVDGRKDA--------------------------LAEPCFMLIGEIFELRGMFKWVRRTLIALVQVTFGRTINKQIRDTVNWIFSEQMLVYYISVFRDAF 419          
BLAST of Sorting nexin-25-like protein vs. Ensembl Cavefish
Match: snx25 (sorting nexin 25 [Source:NCBI gene;Acc:103034035])

HSP 1 Score: 59.3066 bits (142), Expect = 2.888e-8
Identity = 58/239 (24.27%), Postives = 106/239 (44.35%), Query Frame = 2
Query: 2336 ETMEYYHQKIQKLNKKIDVKEKAYKAGVAVSNQMPLSKKEKSKMKIDLNSVKEDLNRLYEKRNKCQYNLSRVDKWILSLGNWNAVVYDVILPEPKRGTSLDLGYLPTLAESKSGTMAIEKDDMSTEDDTKQIVIF-IMVSLASTLDQYNSREDNGWLVKHTLKDFQALKRELTPQCPPIDRISLPKVPQRLF--IRRKYTDNDLSHIKDSLNKFIQFLMKTPILAKSESVFKFFCSSLE 3043
            E   Y   K+ +L ++++ K +A    + +    P + K+   M      +KE++  + ++ +  Q ++SR D W  +LG W AV+                      AE+              E++ +Q+  + + VSL    D  NS     W V   L +FQAL R+LT   P + ++ LP + +  F  I +K+    L   K+ LN F+Q ++   ++ +SE+++ F   S E
Sbjct:  568 EQASYAANKLSQLCERLEYKRQA----LGIIQGAPRTDKKIVTM------LKEEIRVMEKEHSDLQLHISRTDWWCENLGTWRAVI--------------------NTAEA-------------CEENGEQMPCYCVAVSLLEGDDSKNS----CWSVTRKLSEFQALHRKLTECFPSLKKVQLPSLSKLPFKSIDQKF----LEKSKNQLNTFLQKMLTDELMCQSEALYAFLSPSPE 755          

HSP 2 Score: 56.6102 bits (135), Expect = 2.116e-7
Identity = 86/409 (21.03%), Postives = 159/409 (38.88%), Query Frame = 2
Query:  746 NMKSHINFLKSRNNQNDE-------NMYFMGTKTENLFVEAISNRLLRSLLDCKYIQCELVYQFSLGILSHQVIKRAVEYYCEPVNHNQWLFQKLIEKKITRSKLNKQLPHFQYDMSFEDFFKMVESISDLNEVKQIKQKLLNELRMAEVLKFTQSNIDSKNANKKKIQDHNKIGRKTACKGHLLTQRDLKCYSNQLSTLLDTVNTKLKMMTRGKANINISTQSLMKSSKRHKISRRNSKSEKQTLSKKIKSKVAGNFNKKLSIGKSVNEKTVALNEIRSLQKFRYKSHFECIPYETIMDSNEGRKFFKEFLNTTLYSRTVELVEMLNHFQNHREDQYVIAQGIVKRYIHSSPPAFDFDKQIVKEMEEFLKGNSSEKVFLKAKVICDKELKQRWYPYFILSPHHTKFSK 1951
             + SH   LK+ N + +E       +     ++ E  F+   S  L+   L  +  +C  +    + +++ +V+K  VE   +P   NQ L   L+E +    K       + Y  S+EDFFK++ + +D++ +KQ++ +++ E+  A  L         K++  K +          A K  LL  RD+K Y NQL+        K++++                                       + +V GN +          +K +   EI S     Y+ HF               + + E ++        ELVE L     +   Q V    I + ++ S       +K + KE+++ L GN    VF K +    + +K+R+YP F++S  + +  K
Sbjct:  196 TLHSHFCDLKAANARQEETPRPLALHPCLRSSEEELQFLRCCSRLLVLCALPARDARCRSLRLVLVEVIATKVLKPLVEVLSDPDYINQMLL-ALLEHREQHKK------AYIYADSYEDFFKLISNSTDIDFLKQLRYQIVVEIVRATTLSSIPQFKKQKDSKGKDV---------AAMKADLLGTRDIKRYINQLTVAKKQCEKKIRLLE----------------------------------GPNYEQEVDGNQDDGFG---PQGQKILQFEEIMS--NALYREHF---------------RIYMERVDKRALISFWELVETLKTANKNEVPQLV--GEIYQDFVESR--EIPVEKALFKEIQQTLVGNKGTDVFHKIQSDVYETMKERYYPSFLVSDLYERLMK 530          
BLAST of Sorting nexin-25-like protein vs. Ensembl Cavefish
Match: snx25 (sorting nexin 25 [Source:NCBI gene;Acc:103034035])

HSP 1 Score: 58.9214 bits (141), Expect = 3.891e-8
Identity = 58/239 (24.27%), Postives = 106/239 (44.35%), Query Frame = 2
Query: 2336 ETMEYYHQKIQKLNKKIDVKEKAYKAGVAVSNQMPLSKKEKSKMKIDLNSVKEDLNRLYEKRNKCQYNLSRVDKWILSLGNWNAVVYDVILPEPKRGTSLDLGYLPTLAESKSGTMAIEKDDMSTEDDTKQIVIF-IMVSLASTLDQYNSREDNGWLVKHTLKDFQALKRELTPQCPPIDRISLPKVPQRLF--IRRKYTDNDLSHIKDSLNKFIQFLMKTPILAKSESVFKFFCSSLE 3043
            E   Y   K+ +L ++++ K +A    + +    P + K+   M      +KE++  + ++ +  Q ++SR D W  +LG W AV+                      AE+              E++ +Q+  + + VSL    D  NS     W V   L +FQAL R+LT   P + ++ LP + +  F  I +K+    L   K+ LN F+Q ++   ++ +SE+++ F   S E
Sbjct:  444 EQASYAANKLSQLCERLEYKRQA----LGIIQGAPRTDKKIVTM------LKEEIRVMEKEHSDLQLHISRTDWWCENLGTWRAVI--------------------NTAEA-------------CEENGEQMPCYCVAVSLLEGDDSKNS----CWSVTRKLSEFQALHRKLTECFPSLKKVQLPSLSKLPFKSIDQKF----LEKSKNQLNTFLQKMLTDELMCQSEALYAFLSPSPE 631          

HSP 2 Score: 51.9878 bits (123), Expect = 4.955e-6
Identity = 88/408 (21.57%), Postives = 159/408 (38.97%), Query Frame = 2
Query:  749 MKSHINFLKSRNNQNDE-------NMYFMGTKTENLFVEAISNRLLRSLLDCKYIQCELVYQFSLGILSHQVIKRAVEYYCEPVNHNQWLFQKLIEKKITRSKLNKQLPHFQYDMSFEDFFKMVESISDLNEVKQIKQKLLNELRMAEVLKFTQSNIDSKNANKKKIQDHNKIGRKTACKGHLLTQRDLKCYSNQLSTLLDTVNTKLKMMTRGKANINISTQSLMKSSKRHKISRRNSKSEKQTLSKKIKSKVAGNFNKKLSIGKSVNEKTVALNEIRSLQKFRYKSHFECIPYETIMDSNEGRKFFKEFLNTTLYSRTVELVEMLNHFQNHREDQYVIAQGIVKRYIHSSPPAFDFDKQIVKEMEEFLKGNSSEKVFLKAKVICDKELKQRWYPYFILSPHHTKFSK 1951
            + SH   LK+ N + +E       +     ++ E  F+   S  L+   L  +  +C  +    + +++ +V+K  VE   +P   NQ L   L+E +    K       + Y  S+EDFFK++ + +D++ +KQ++ +++ E+  A  L    S+I      K K           A K  LL  RD+K Y NQL+        K++++                                       + +V GN +          +K +   EI S     Y+ HF               + + E ++        ELVE L     +   Q V    I + ++ S       +K + KE+++ L GN    VF K +    + +K+R+YP F++S  + +  K
Sbjct:   77 LHSHFCDLKAANARYEETPRPLALHPCLRSSEEELQFLRCCSRLLVLCALPARDARCRSLRLVLVEVIATKVLKPLVEVLSDPDYINQMLL-ALLEHREQHKK------AYIYADSYEDFFKLISNSTDIDFLKQLRYQIVVEIVRATTL----SSIPQFKKQKGK--------DVAAMKADLLGTRDIKRYINQLTVAKKQCEKKIRLLE----------------------------------GPNYEQEVDGNQDDGFG---PQGQKILQFEEIMS--NALYREHF---------------RIYMERVDKRALISFWELVETLKTANKNEVPQLV--GEIYQDFVESR--EIPVEKALFKEIQQTLVGNKGTDVFHKIQSDVYETMKERYYPSFLVSDLYERLMK 407          
BLAST of Sorting nexin-25-like protein vs. Ensembl Nematostella
Match: EDO37987 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE70])

HSP 1 Score: 68.9366 bits (167), Expect = 1.281e-11
Identity = 107/451 (23.73%), Postives = 182/451 (40.35%), Query Frame = 2
Query:  680 SEVVHRMSVIEWNIFFCNTLLDNMKSHINFLK---SRNNQNDENMYFM-----GTKTENLFVEAISNRLLRSLLDCKYIQCELVYQFSLGILSHQVIKRAVEYYCEPVNHNQWLFQKLIEKKITRSKLNKQLPHFQYDMSFEDFFKMVESISDLNEVKQIKQKLLNELRMAEVLKFTQSNIDSKNANKKKIQDHNKIGRKTACKGHLLTQRDLKCYSNQLSTLLDTVNTKLKMMTRGKANINISTQSLMKSSKRHKISRRNSKSEKQTLSKKIKSKVAGNFNKKLSIGKSVNEKTVALNEIRSLQKFRYKSHFECIPYETIMDSNEGRKFFKEFLNTTLYSRTVELVEMLNHFQNHREDQYVIAQGIVKR-------YIH-SSPPAFDFDKQIVKEMEEFLKGNSSEKVFLKAKVICDKELKQRWYPYFILSPHHTKFSKHLSKELNSIES 1984
            S VV R+  ++   F  + L+D + +H   L+    RN+      + +       K E  ++  IS+ +L   L  +  QC  +      IL++ V +   +  C+P   NQ +   L  K+   +K     P + Y  ++EDF +M+ + + + E+KQI+  ++     AE+++ T  N + +   K+  Q  N+   K A     L  R+LK Y NQ               T  KA          +  KR K+  + S + +Q    K  +KV G   K LS  +                               IMD++  R FF  FL    +SR   L+      +N R    V    IVK        Y+  SS  +   D  +V++ME FL G    + F  A+    + L++++Y  F+LS  +  F   L  E++ + +
Sbjct:   44 SNVVERLKNVDKVNFLSSDLVDILTNHFQSLRLADQRNSPETAEAFVLHHCLTSKKAELDYLRKISDVILYCFLSERNSQCPEMRVLLREILAYSVFQPLADMLCDPDYINQTVLIYLEAKETLTAK---HKPRYAYAETYEDFIRMINTCNSVEELKQIRYHII-----AEIMQATTIN-NLRGIEKQNQQTDNQPLNKDA----QLRTRNLKRYINQ--------------CTVAKA----------QCEKRIKLLGKPSTTPEQ--KPKPTNKVTGP-TKMLSFAE-------------------------------IMDNSLARSFFMSFLQNHTHSRN--LLSFWMAIENLR---LVKPAEIVKSTHDIYQVYVAPSSDKSIMLDTSLVRDMEGFLNGTEGLQSFFTAQKKVYQHLEEKFYRRFVLSQEYFMFVCQLEAEMDDLRA 418          
BLAST of Sorting nexin-25-like protein vs. Ensembl Medaka
Match: snx25 (sorting nexin 25 [Source:NCBI gene;Acc:101155361])

HSP 1 Score: 75.485 bits (184), Expect = 3.169e-13
Identity = 89/402 (22.14%), Postives = 161/402 (40.05%), Query Frame = 2
Query: 2336 ETMEYYHQKIQKLNKKIDVKEKAYKAGVAVSNQMPLSKKEKSKMKIDLNSVKEDLNRLYEKRNKCQYNLSRVDKWILSLGNWNAVVYDVILPEPKRGTSLDLGYLPTLAESKSGTMAIEKDDMSTEDDTKQIVIF-IMVSLASTLDQYNSREDNGWLVKHTLKDFQALKRELTPQCPPIDRISLPKVPQRLF--IRRKYTDNDLSHIKDSLNKFIQFLMKTPILAKSESVFKFFCSSLESQMSNEDTLMGPLSLFANTLSDASAKVMLMAKIPTKFVQKVLAPRKHSGSVTSLDSESTDSKSDRKNTXXXXXXXXXXXXXXXXXXXXXXXXXDISMSAFELLEELIQLRKSLTLTRRSMITFVQSFFGKNLTQILTEKVAWIKSESTVFVCLQKYRDSFRID 3532
            E   Y   K+++L  K++ K +A  +   + N     KK  SK+K       E++  + ++ ++ Q +++R D W  +LG+W A +                    T AE+              E+  + +  + + VSL    +  NSR    W V+  L +FQ L R+LT   P + ++ +P + +  F  I +K+    L   K  LN F+Q L+    L +SE ++ F   S E            L + +     + +    + ++P  F     +  +  G   S  S+  D    RKN                           ++   F L+ E+ +LR      R+++I  VQ  FG+ + + + + V WI SE  +   +  +RD+F  D
Sbjct:  583 EQASYAATKLRQLYDKLEYKRQALGS---IQNAPKPDKKIVSKLK-------EEIGAMEKEHSELQQHITRTDWWCENLGHWKATI--------------------TSAEA-------------AEESGETVACYGVCVSLTEGEETPNSR----WSVQRKLSEFQILHRKLTECFPSLKKLQVPSLSKLPFKSIDQKF----LEKSKTQLNAFLQRLLTDDRLCQSEVLYAFLSPSPEH-----------LKVMSIQKKSSFSLASFLERLPGDF----FSHTEEDGDEDSDLSDYGDETDGRKNA--------------------------LAEPCFMLIGEIFELRGMFKWVRKTLIALVQVTFGRTINKQIRDTVNWIFSEQMLVCYISVFRDTFWPD 892          
BLAST of Sorting nexin-25-like protein vs. Ensembl Medaka
Match: snx25 (sorting nexin 25 [Source:NCBI gene;Acc:101155361])

HSP 1 Score: 75.0998 bits (183), Expect = 4.140e-13
Identity = 89/402 (22.14%), Postives = 160/402 (39.80%), Query Frame = 2
Query: 2336 ETMEYYHQKIQKLNKKIDVKEKAYKAGVAVSNQMPLSKKEKSKMKIDLNSVKEDLNRLYEKRNKCQYNLSRVDKWILSLGNWNAVVYDVILPEPKRGTSLDLGYLPTLAESKSGTMAIEKDDMSTEDDTKQIVIF-IMVSLASTLDQYNSREDNGWLVKHTLKDFQALKRELTPQCPPIDRISLPKVPQRLF--IRRKYTDNDLSHIKDSLNKFIQFLMKTPILAKSESVFKFFCSSLESQMSNEDTLMGPLSLFANTLSDASAKVMLMAKIPTKFVQKVLAPRKHSGSVTSLDSESTDSKSDRKNTXXXXXXXXXXXXXXXXXXXXXXXXXDISMSAFELLEELIQLRKSLTLTRRSMITFVQSFFGKNLTQILTEKVAWIKSESTVFVCLQKYRDSFRID 3532
            E   Y   K+++L  K++ K +A  +   + N     KK  SK+K       E++  + ++ ++ Q +++R D W  +LG+W A +                    T AE+              E+  + +  + + VSL    +  NSR    W V+  L +FQ L R+LT   P + ++ +P + +  F  I +K+    L   K  LN F+Q L+    L +SE ++ F   S E            L + +     + +    + ++P  F        +  G   S  S+  D    RKN                           ++   F L+ E+ +LR      R+++I  VQ  FG+ + + + + V WI SE  +   +  +RD+F  D
Sbjct:  583 EQASYAATKLRQLYDKLEYKRQALGS---IQNAPKPDKKIVSKLK-------EEIGAMEKEHSELQQHITRTDWWCENLGHWKATI--------------------TSAEA-------------AEESGETVACYGVCVSLTEGEETPNSR----WSVQRKLSEFQILHRKLTECFPSLKKLQVPSLSKLPFKSIDQKF----LEKSKTQLNAFLQRLLTDDRLCQSEVLYAFLSPSPEH-----------LKVMSIQKKSSFSLASFLERLPGDFFSHT----EEDGDEDSDLSDYGDETDGRKNA--------------------------LAEPCFMLIGEIFELRGMFKWVRKTLIALVQVTFGRTINKQIRDTVNWIFSEQMLVCYISVFRDTFWPD 892          
BLAST of Sorting nexin-25-like protein vs. Planmine SMEST
Match: SMESG000002020.1 (SMESG000002020.1)

HSP 1 Score: 2293.08 bits (5941), Expect = 0.000e+0
Identity = 1226/1241 (98.79%), Postives = 1226/1241 (98.79%), Query Frame = 2
Query:  338 MFLLLPSIYFINKISHNTIETKNFFKVENALLTPGIKKRGFFKTLSKMSYVDFIDGKEANLTSISPFPSRRXXXXXXXXXXXXXKYYVLPYAEANSWXXXXXXXXXXXXXXXXISEVVHRMSVIEWNIFFCNTLLDNMKSHINFLKSRNNQNDENMYFMGTKTENLFVEAISNRLLRSLLDCKYIQCELVYQFSLGILSHQVIKRAVEYYCEPVNHNQWLFQKLIEKKITRSKLNKQLPHFQYDMSFEDFFKMVESISDLNEVKQIKQKLLNELRMAEVLKFTQSNIDSKNANKKKIQDHNKIGRKTACKGHLLTQRDLKCYSNQLSTLLDTVNTKLKMMTRGKANINISTQSLMKSSKRHKISRRNSKSEKQTLSKKIKSKVAGNFNKKLSIGKSVNEKTVALNEIRSLQKFRYKSHFECIPYETIMDSNEGRKFFKEFLNTTLYSRTVELVEMLNHFQNHREDQYVIAQGIVKRYIHSSPPAFDFDKQIVKEMEEFLKGNSSEKVFLKAKVICDKELKQRWYPYFILSPHHTKFSKHLSKELNSIESIKMMDISPPGMSTDTGDTDIESDASEDLSQNVLNSTMNSEKLMTDNDDDNPPALLFDFTQSLTKEHADETQSMQTDEIDTNKLVSXXXXXXXXXXXXXXXXXXLKPSFENVPLTSGTETMEYYHQKIQKLNKKIDVKEKAYKAGVAVSNQMPLSKKEKSKMKIDLNSVKEDLNRLYEKRNKCQYNLSRVDKWILSLGNWNAVVYDVILPEPKRGTSLDLGYLPTLAESKSGTMAIEKDDMSTEDDTKQIVIFIMVSLASTLDQYNSREDNGWLVKHTLKDFQALKRELTPQCPPIDRISLPKVPQRLFIRRKYTDNDLSHIKDSLNKFIQFLMKTPILAKSESVFKFFCSSLESQMSNEDTLMGPLSLFANTLSDASAKVMLMAKIPTKFVQKVLAPRKHSGSVTSLDSESTDSKSDRKNTXXXXXXXXXXXXXXXXXXXXXXXXXDISMSAFELLEELIQLRKSLTLTRRSMITFVQSFFGKNLTQILTEKVAWIKSESTVFVCLQKYRDSFRIDXXXXXXXXXXTHYVDEGSKLHPSASAFIAVHVSDTSESNLQHVNSNSSPTMNKARFYQKNDTGSCENFESQSGDIQGATNKADNNDVGSVKAGIQFNQSWSYSIKCDEAVKRLLWEMVPEYWKTLFGAMSVADSVGFVFESLQSLEANKALIYRILQSFVXXXXXXXXXXXXYLTA 4060
            MFLLLPSIYFINKISHNTIETKNFFKVENALLTPGIKKRGFFKTLSKMSYVDFIDGKEANLTSISPFPSRRIEEIVDDIIDEIIKYYVLPYAEANSWKFKNTETFLKKFLKKLISEVVHRMSVIEWNIFFCNTLLDNMKSHINFLKSRNNQNDENMYFMGTKTENLFVEAISNRLLRSLLDCKYIQCELVYQFSLGILSHQVIKRAVEYYCEPVNHNQWLFQKLIEKKITRSKLNKQLPHFQYDMSFEDFFKMVESISDLNEVKQIKQKLLNELRMAEVLKFTQSNIDSKNANKKK QDHNKIGRKTACKGHLLTQRDLKCYSNQLSTLLDTVNTKLKMMTRGKANINISTQSLMKSSKRHKISRRNSKSEKQTLSKKIKSKVAGNFNKKLSIGKSVNEKTVALNE              CIPYETIMDSNEGRKFFKEFLNTTLYSRTVELVEMLNHFQNHREDQYVIAQGIVKRYIHSSPPAFDFDKQIVKEMEEFLKGNSSEKVFLKAKVICDKELKQRWYPYFILSPHHTKFSKHLSKELNSIESIKMMDISPPGMSTDTGDTDIESDASEDLSQNVLNSTMNSEKLMTDNDDDNPPALLFDFTQSLTKEHADETQSMQTDEIDTNKLVSDTFEGHTDEEFEEEEDGFLKPSFENVPLTSGTETMEYYHQKIQKLNKKIDVKEKAYKAGVAVSNQMPLSKKEKSKMKIDLNSVKEDLNRLYEKRNKCQYNLSRVDKWILSLGNWNAVVYDVILPEPKRGTSLDLGYLPTLAESKSGTMAIEKDDMSTEDDTKQIVIFIMVSLASTLDQYNSREDNGWLVKHTLKDFQALKRELTPQCPPIDRISLPKVPQRLFIRRKYTDNDLSHIKDSLNKFIQFLMKTPILAKSESVFKFFCSSLESQMSNEDTLMGPLSLFANTLSDASAKVMLMAKIPTKFVQKVLAPRKHSGSVTSLDSESTDSKSDRKNTSRRISGSSHIGGSLKHKLRKLSHSKDISMSAFELLEELIQLRKSLTLTRRSMITFVQSFFGKNLTQILTEKVAWIKSESTVFVCLQKYRDSFRIDSSESFQSSSETHYVDEGSKLHPSASAFIAVHVSDTSESNLQHVNSNSSPTMNKARFYQKNDTGSCENFESQSGDIQGATNKADNNDVGSVKAGIQFNQSWSYSIKCDEAVKRLLWEMVPEYWKTLFGAMSVADSVGFVFESLQSLEANKALIYRILQSFVDELLEEDDEQQLYLTA
Sbjct:    1 MFLLLPSIYFINKISHNTIETKNFFKVENALLTPGIKKRGFFKTLSKMSYVDFIDGKEANLTSISPFPSRRIEEIVDDIIDEIIKYYVLPYAEANSWKFKNTETFLKKFLKKLISEVVHRMSVIEWNIFFCNTLLDNMKSHINFLKSRNNQNDENMYFMGTKTENLFVEAISNRLLRSLLDCKYIQCELVYQFSLGILSHQVIKRAVEYYCEPVNHNQWLFQKLIEKKITRSKLNKQLPHFQYDMSFEDFFKMVESISDLNEVKQIKQKLLNELRMAEVLKFTQSNIDSKNANKKKSQDHNKIGRKTACKGHLLTQRDLKCYSNQLSTLLDTVNTKLKMMTRGKANINISTQSLMKSSKRHKISRRNSKSEKQTLSKKIKSKVAGNFNKKLSIGKSVNEKTVALNE--------------CIPYETIMDSNEGRKFFKEFLNTTLYSRTVELVEMLNHFQNHREDQYVIAQGIVKRYIHSSPPAFDFDKQIVKEMEEFLKGNSSEKVFLKAKVICDKELKQRWYPYFILSPHHTKFSKHLSKELNSIESIKMMDISPPGMSTDTGDTDIESDASEDLSQNVLNSTMNSEKLMTDNDDDNPPALLFDFTQSLTKEHADETQSMQTDEIDTNKLVSDTFEGHTDEEFEEEEDGFLKPSFENVPLTSGTETMEYYHQKIQKLNKKIDVKEKAYKAGVAVSNQMPLSKKEKSKMKIDLNSVKEDLNRLYEKRNKCQYNLSRVDKWILSLGNWNAVVYDVILPEPKRGTSLDLGYLPTLAESKSGTMAIEKDDMSTEDDTKQIVIFIMVSLASTLDQYNSREDNGWLVKHTLKDFQALKRELTPQCPPIDRISLPKVPQRLFIRRKYTDNDLSHIKDSLNKFIQFLMKTPILAKSESVFKFFCSSLESQMSNEDTLMGPLSLFANTLSDASAKVMLMAKIPTKFVQKVLAPRKHSGSVTSLDSESTDSKSDRKNTSRRISGSSHIGGSLKHKLRKLSHSKDISMSAFELLEELIQLRKSLTLTRRSMITFVQSFFGKNLTQILTEKVAWIKSESTVFVCLQKYRDSFRIDSSESFQSSSETHYVDEGSKLHPSASAFIAVHVSDTSESNLQHVNSNSSPTMNKARFYQKNDTGSCENFESQSGDIQGATNKADNNDVGSVKAGIQFNQSWSYSIKCDEAVKRLLWEMVPEYWKTLFGAMSVADSVGFVFESLQSLEANKALIYRILQSFVDELLEEDDEQQLYLTA 1227          

HSP 2 Score: 72.0182 bits (175), Expect = 3.131e-12
Identity = 34/34 (100.00%), Postives = 34/34 (100.00%), Query Frame = -3
Query:    2 MFLLLPSIYFINKISHNTIETKNFFKVENALLTP 103
            MFLLLPSIYFINKISHNTIETKNFFKVENALLTP
Sbjct:    1 MFLLLPSIYFINKISHNTIETKNFFKVENALLTP 34          
BLAST of Sorting nexin-25-like protein vs. Planmine SMEST
Match: SMESG000002020.1 (SMESG000002020.1)

HSP 1 Score: 2195.24 bits (5687), Expect = 0.000e+0
Identity = 1179/1194 (98.74%), Postives = 1179/1194 (98.74%), Query Frame = 2
Query:  479 MSYVDFIDGKEANLTSISPFPSRRXXXXXXXXXXXXXKYYVLPYAEANSWXXXXXXXXXXXXXXXXISEVVHRMSVIEWNIFFCNTLLDNMKSHINFLKSRNNQNDENMYFMGTKTENLFVEAISNRLLRSLLDCKYIQCELVYQFSLGILSHQVIKRAVEYYCEPVNHNQWLFQKLIEKKITRSKLNKQLPHFQYDMSFEDFFKMVESISDLNEVKQIKQKLLNELRMAEVLKFTQSNIDSKNANKKKIQDHNKIGRKTACKGHLLTQRDLKCYSNQLSTLLDTVNTKLKMMTRGKANINISTQSLMKSSKRHKISRRNSKSEKQTLSKKIKSKVAGNFNKKLSIGKSVNEKTVALNEIRSLQKFRYKSHFECIPYETIMDSNEGRKFFKEFLNTTLYSRTVELVEMLNHFQNHREDQYVIAQGIVKRYIHSSPPAFDFDKQIVKEMEEFLKGNSSEKVFLKAKVICDKELKQRWYPYFILSPHHTKFSKHLSKELNSIESIKMMDISPPGMSTDTGDTDIESDASEDLSQNVLNSTMNSEKLMTDNDDDNPPALLFDFTQSLTKEHADETQSMQTDEIDTNKLVSXXXXXXXXXXXXXXXXXXLKPSFENVPLTSGTETMEYYHQKIQKLNKKIDVKEKAYKAGVAVSNQMPLSKKEKSKMKIDLNSVKEDLNRLYEKRNKCQYNLSRVDKWILSLGNWNAVVYDVILPEPKRGTSLDLGYLPTLAESKSGTMAIEKDDMSTEDDTKQIVIFIMVSLASTLDQYNSREDNGWLVKHTLKDFQALKRELTPQCPPIDRISLPKVPQRLFIRRKYTDNDLSHIKDSLNKFIQFLMKTPILAKSESVFKFFCSSLESQMSNEDTLMGPLSLFANTLSDASAKVMLMAKIPTKFVQKVLAPRKHSGSVTSLDSESTDSKSDRKNTXXXXXXXXXXXXXXXXXXXXXXXXXDISMSAFELLEELIQLRKSLTLTRRSMITFVQSFFGKNLTQILTEKVAWIKSESTVFVCLQKYRDSFRIDXXXXXXXXXXTHYVDEGSKLHPSASAFIAVHVSDTSESNLQHVNSNSSPTMNKARFYQKNDTGSCENFESQSGDIQGATNKADNNDVGSVKAGIQFNQSWSYSIKCDEAVKRLLWEMVPEYWKTLFGAMSVADSVGFVFESLQSLEANKALIYRILQSFVXXXXXXXXXXXXYLTA 4060
            MSYVDFIDGKEANLTSISPFPSRRIEEIVDDIIDEIIKYYVLPYAEANSWKFKNTETFLKKFLKKLISEVVHRMSVIEWNIFFCNTLLDNMKSHINFLKSRNNQNDENMYFMGTKTENLFVEAISNRLLRSLLDCKYIQCELVYQFSLGILSHQVIKRAVEYYCEPVNHNQWLFQKLIEKKITRSKLNKQLPHFQYDMSFEDFFKMVESISDLNEVKQIKQKLLNELRMAEVLKFTQSNIDSKNANKKK QDHNKIGRKTACKGHLLTQRDLKCYSNQLSTLLDTVNTKLKMMTRGKANINISTQSLMKSSKRHKISRRNSKSEKQTLSKKIKSKVAGNFNKKLSIGKSVNEKTVALNE              CIPYETIMDSNEGRKFFKEFLNTTLYSRTVELVEMLNHFQNHREDQYVIAQGIVKRYIHSSPPAFDFDKQIVKEMEEFLKGNSSEKVFLKAKVICDKELKQRWYPYFILSPHHTKFSKHLSKELNSIESIKMMDISPPGMSTDTGDTDIESDASEDLSQNVLNSTMNSEKLMTDNDDDNPPALLFDFTQSLTKEHADETQSMQTDEIDTNKLVSDTFEGHTDEEFEEEEDGFLKPSFENVPLTSGTETMEYYHQKIQKLNKKIDVKEKAYKAGVAVSNQMPLSKKEKSKMKIDLNSVKEDLNRLYEKRNKCQYNLSRVDKWILSLGNWNAVVYDVILPEPKRGTSLDLGYLPTLAESKSGTMAIEKDDMSTEDDTKQIVIFIMVSLASTLDQYNSREDNGWLVKHTLKDFQALKRELTPQCPPIDRISLPKVPQRLFIRRKYTDNDLSHIKDSLNKFIQFLMKTPILAKSESVFKFFCSSLESQMSNEDTLMGPLSLFANTLSDASAKVMLMAKIPTKFVQKVLAPRKHSGSVTSLDSESTDSKSDRKNTSRRISGSSHIGGSLKHKLRKLSHSKDISMSAFELLEELIQLRKSLTLTRRSMITFVQSFFGKNLTQILTEKVAWIKSESTVFVCLQKYRDSFRIDSSESFQSSSETHYVDEGSKLHPSASAFIAVHVSDTSESNLQHVNSNSSPTMNKARFYQKNDTGSCENFESQSGDIQGATNKADNNDVGSVKAGIQFNQSWSYSIKCDEAVKRLLWEMVPEYWKTLFGAMSVADSVGFVFESLQSLEANKALIYRILQSFVDELLEEDDEQQLYLTA
Sbjct:    1 MSYVDFIDGKEANLTSISPFPSRRIEEIVDDIIDEIIKYYVLPYAEANSWKFKNTETFLKKFLKKLISEVVHRMSVIEWNIFFCNTLLDNMKSHINFLKSRNNQNDENMYFMGTKTENLFVEAISNRLLRSLLDCKYIQCELVYQFSLGILSHQVIKRAVEYYCEPVNHNQWLFQKLIEKKITRSKLNKQLPHFQYDMSFEDFFKMVESISDLNEVKQIKQKLLNELRMAEVLKFTQSNIDSKNANKKKSQDHNKIGRKTACKGHLLTQRDLKCYSNQLSTLLDTVNTKLKMMTRGKANINISTQSLMKSSKRHKISRRNSKSEKQTLSKKIKSKVAGNFNKKLSIGKSVNEKTVALNE--------------CIPYETIMDSNEGRKFFKEFLNTTLYSRTVELVEMLNHFQNHREDQYVIAQGIVKRYIHSSPPAFDFDKQIVKEMEEFLKGNSSEKVFLKAKVICDKELKQRWYPYFILSPHHTKFSKHLSKELNSIESIKMMDISPPGMSTDTGDTDIESDASEDLSQNVLNSTMNSEKLMTDNDDDNPPALLFDFTQSLTKEHADETQSMQTDEIDTNKLVSDTFEGHTDEEFEEEEDGFLKPSFENVPLTSGTETMEYYHQKIQKLNKKIDVKEKAYKAGVAVSNQMPLSKKEKSKMKIDLNSVKEDLNRLYEKRNKCQYNLSRVDKWILSLGNWNAVVYDVILPEPKRGTSLDLGYLPTLAESKSGTMAIEKDDMSTEDDTKQIVIFIMVSLASTLDQYNSREDNGWLVKHTLKDFQALKRELTPQCPPIDRISLPKVPQRLFIRRKYTDNDLSHIKDSLNKFIQFLMKTPILAKSESVFKFFCSSLESQMSNEDTLMGPLSLFANTLSDASAKVMLMAKIPTKFVQKVLAPRKHSGSVTSLDSESTDSKSDRKNTSRRISGSSHIGGSLKHKLRKLSHSKDISMSAFELLEELIQLRKSLTLTRRSMITFVQSFFGKNLTQILTEKVAWIKSESTVFVCLQKYRDSFRIDSSESFQSSSETHYVDEGSKLHPSASAFIAVHVSDTSESNLQHVNSNSSPTMNKARFYQKNDTGSCENFESQSGDIQGATNKADNNDVGSVKAGIQFNQSWSYSIKCDEAVKRLLWEMVPEYWKTLFGAMSVADSVGFVFESLQSLEANKALIYRILQSFVDELLEEDDEQQLYLTA 1180          
The following BLAST results are available for this feature:
BLAST of Sorting nexin-25-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
SNX258.807e-1523.54sorting nexin 25 [Source:HGNC Symbol;Acc:HGNC:2188... [more]
SNX258.807e-1523.54sorting nexin 25 [Source:HGNC Symbol;Acc:HGNC:2188... [more]
SNX251.309e-1423.54sorting nexin 25 [Source:HGNC Symbol;Acc:HGNC:2188... [more]
back to top
BLAST of Sorting nexin-25-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sorting nexin-25-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sorting nexin-25-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
snx257.578e-1321.71sorting nexin 25 [Source:ZFIN;Acc:ZDB-GENE-121105-... [more]
back to top
BLAST of Sorting nexin-25-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sorting nexin-25-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Snx257.907e-1221.87sorting nexin 25 [Source:MGI Symbol;Acc:MGI:214261... [more]
Snx251.019e-1121.81sorting nexin 25 [Source:MGI Symbol;Acc:MGI:214261... [more]
Snx251.019e-1121.81sorting nexin 25 [Source:MGI Symbol;Acc:MGI:214261... [more]
back to top
BLAST of Sorting nexin-25-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q9H3E2|SNX25_HUMAN4.229e-1423.54Sorting nexin-25 OS=Homo sapiens OX=9606 GN=SNX25 ... [more]
sp|Q3ZT31|SNX25_MOUSE7.130e-1121.81Sorting nexin-25 OS=Mus musculus OX=10090 GN=Snx25... [more]
back to top
BLAST of Sorting nexin-25-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4D5S4E61.482e-1223.08Putative sorting nexin OS=Ixodes scapularis OX=694... [more]
V5HBB32.707e-1222.84Putative sorting nexin-25 (Fragment) OS=Ixodes ric... [more]
A0A3Q7XNK23.569e-1122.90sorting nexin-25 OS=Ursus arctos horribilis OX=116... [more]
G1LFE83.840e-1122.90Sorting nexin 25 OS=Ailuropoda melanoleuca OX=9646... [more]
D2HM303.999e-1122.90PX domain-containing protein (Fragment) OS=Ailurop... [more]
back to top
BLAST of Sorting nexin-25-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
snx252.888e-824.27sorting nexin 25 [Source:NCBI gene;Acc:103034035][more]
snx253.891e-824.27sorting nexin 25 [Source:NCBI gene;Acc:103034035][more]
back to top
BLAST of Sorting nexin-25-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sorting nexin-25-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sorting nexin-25-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO379871.281e-1123.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Sorting nexin-25-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
snx253.169e-1322.14sorting nexin 25 [Source:NCBI gene;Acc:101155361][more]
snx254.140e-1322.14sorting nexin 25 [Source:NCBI gene;Acc:101155361][more]
back to top
BLAST of Sorting nexin-25-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000002020.13.131e-1298.79SMESG000002020.1[more]
SMESG000002020.10.000e+098.74SMESG000002020.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029142 ID=SMED30029142|Name=Sorting nexin-25-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=4155bp
CTGGTGTCAATAATGCATTTTCAACTTTGAAAAAATTTTTGGTCTCTATA
GTATTGTGACTTATTTTATTGATAAAATAAATGGATGGCAATAATAAAAA
CATAGTCACTAGGTAAAAAAATAATGCCAGCCAGCCAATTGCATTGAAAA
TATTTGATAAAACATAAATACTTTATAATGAACTAATTTCAAATTTCTTT
AAAATTAAATTGTTTAGGAAAATGCCTCTTAATTAGAAATGGGATTGAAG
TTATTATTCTTTATTTTTGTTATTTATGTTTTATCAAATATTTTCAATGC
AATTGGCTGGCTGGCATTATTTTTTTACCTAGTGACTATGTTTTTATTAT
TGCCATCCATTTATTTTATCAATAAAATAAGTCACAATACTATAGAGACC
AAAAATTTTTTCAAAGTTGAAAATGCATTATTGACACCAGGCATTAAAAA
GAGAGGATTTTTCAAAACATTATCGAAAATGTCTTACGTAGATTTTATTG
ATGGGAAAGAAGCCAACTTGACATCTATTTCACCATTTCCATCAAGAAGA
ATCGAAGAAATTGTTGATGATATTATTGATGAAATTATAAAATACTACGT
TTTACCATATGCAGAAGCCAACAGCTGGAAATTTAAAAATACTGAAACCT
TTCTAAAGAAATTTTTGAAAAAGTTAATATCAGAAGTTGTTCATAGAATG
AGCGTTATTGAATGGAATATATTTTTCTGTAATACTCTATTGGATAACAT
GAAAAGTCATATTAATTTTTTAAAGTCTCGTAATAATCAAAACGATGAAA
ACATGTACTTCATGGGGACAAAAACGGAAAATCTTTTCGTTGAGGCGATT
TCCAATCGCTTGTTACGATCTCTTTTGGATTGCAAATATATCCAGTGTGA
ACTAGTGTACCAGTTTTCCCTAGGCATACTGTCTCACCAGGTGATCAAGC
GAGCAGTTGAATACTACTGTGAACCGGTAAACCATAATCAATGGTTGTTT
CAAAAACTTATAGAGAAAAAAATTACTCGCTCTAAACTCAATAAGCAATT
ACCTCACTTTCAGTATGACATGAGCTTTGAGGATTTCTTCAAAATGGTTG
AGTCGATCAGTGACTTGAATGAAGTCAAACAGATTAAACAGAAATTACTC
AATGAACTTAGGATGGCAGAAGTTTTGAAATTTACTCAGAGTAACATTGA
TTCGAAAAATGCCAATAAGAAGAAAATCCAGGATCACAATAAAATAGGGA
GAAAAACCGCTTGTAAAGGGCATTTATTGACCCAGAGAGATCTAAAATGT
TATTCCAATCAACTGTCAACCCTCCTTGACACGGTGAATACAAAATTGAA
AATGATGACCCGAGGTAAAGCCAATATCAATATCAGCACCCAATCACTTA
TGAAATCATCAAAGCGCCACAAAATATCACGTCGAAATTCAAAATCCGAA
AAGCAAACTTTATCAAAGAAAATCAAATCCAAAGTCGCCGGGAATTTCAA
TAAAAAACTAAGTATTGGTAAATCAGTAAATGAAAAGACAGTTGCATTAA
ACGAGATTCGCTCTCTCCAGAAGTTCCGTTATAAATCTCATTTCGAGTGC
ATTCCCTATGAGACGATTATGGATAGTAATGAAGGCAGGAAATTTTTCAA
AGAGTTTCTGAATACGACTTTATACAGCAGAACTGTAGAGTTGGTAGAAA
TGTTAAATCATTTTCAAAACCACCGGGAAGACCAATATGTGATTGCTCAG
GGTATCGTAAAGCGCTATATACATTCTTCCCCACCAGCTTTTGATTTTGA
TAAGCAAATCGTCAAAGAAATGGAAGAATTCCTCAAAGGAAATTCGAGTG
AGAAAGTTTTCTTGAAAGCCAAAGTGATTTGTGATAAAGAACTAAAACAG
CGCTGGTATCCGTATTTCATTCTTAGTCCGCATCATACAAAATTCTCAAA
GCATCTCAGCAAGGAACTGAACTCTATAGAATCGATAAAAATGATGGATA
TATCACCCCCTGGCATGTCCACCGACACCGGTGACACAGATATTGAGTCA
GATGCTTCAGAAGATTTGTCACAAAATGTTCTCAATTCGACAATGAATAG
TGAAAAATTGATGACAGACAATGATGATGATAATCCTCCGGCACTTTTGT
TTGATTTCACTCAAAGCTTGACGAAGGAACACGCTGATGAGACTCAATCA
ATGCAAACCGATGAAATTGATACGAATAAATTAGTGTCTGATACTTTTGA
GGGTCACACAGATGAAGAATTTGAAGAAGAGGAAGACGGATTTTTGAAGC
CTTCATTCGAAAACGTACCACTGACCAGTGGAACTGAAACGATGGAGTAT
TATCATCAGAAGATTCAGAAATTAAATAAAAAAATCGATGTAAAAGAAAA
GGCCTACAAAGCAGGGGTAGCCGTGTCCAATCAGATGCCCTTGAGCAAGA
AAGAAAAATCAAAGATGAAAATAGACCTGAACTCAGTGAAAGAGGACCTC
AATCGGTTGTATGAGAAACGTAATAAATGTCAATACAATTTAAGTCGAGT
TGACAAATGGATTCTGTCATTGGGAAATTGGAATGCCGTCGTTTATGATG
TGATTTTACCGGAACCGAAAAGAGGTACATCTTTGGATTTAGGCTATTTG
CCCACATTGGCCGAATCGAAATCTGGAACAATGGCAATTGAGAAAGACGA
TATGTCAACAGAAGATGATACAAAACAAATAGTGATCTTCATTATGGTTA
GTTTGGCGTCGACTTTAGATCAGTATAATAGTCGTGAAGATAATGGTTGG
CTTGTTAAGCATACACTGAAAGATTTCCAAGCATTGAAACGGGAATTAAC
ACCACAATGCCCTCCAATTGACCGAATTAGTCTCCCTAAAGTTCCACAAA
GGCTGTTTATAAGAAGGAAGTACACCGACAATGACTTGTCTCACATCAAA
GACAGTTTGAATAAATTCATCCAGTTTCTAATGAAGACTCCAATTTTAGC
AAAATCAGAATCCGTTTTTAAATTCTTTTGCTCCTCTCTAGAAAGTCAAA
TGTCCAATGAAGATACATTAATGGGCCCCTTGTCGCTATTCGCAAATACC
TTATCAGACGCCAGTGCGAAAGTTATGCTTATGGCGAAAATACCAACCAA
ATTCGTTCAGAAGGTTTTAGCTCCTAGAAAACATTCTGGCAGTGTTACTA
GCTTAGATAGTGAAAGCACTGATAGTAAATCAGATAGAAAGAATACCTCT
CGACGCATATCAGGCTCTAGTCACATTGGTGGCAGTCTCAAACACAAGTT
GAGGAAATTAAGTCATTCAAAAGATATCTCAATGTCTGCATTCGAACTAT
TAGAAGAATTGATACAACTAAGGAAGTCTTTAACTTTGACAAGAAGATCT
ATGATTACTTTCGTTCAAAGCTTCTTCGGTAAAAATCTAACTCAAATCCT
AACAGAAAAAGTCGCTTGGATTAAGTCTGAATCCACAGTTTTCGTTTGTT
TGCAAAAATATCGCGACAGTTTTCGAATTGATTCATCGGAATCATTTCAG
AGCAGTAGTGAAACCCACTATGTCGATGAAGGCTCCAAGCTGCACCCGTC
AGCATCGGCATTTATTGCAGTCCATGTATCGGATACATCAGAGAGTAACC
TTCAACATGTCAACTCTAACTCATCTCCGACAATGAATAAAGCGAGATTT
TATCAGAAAAATGACACCGGAAGTTGTGAAAATTTCGAAAGTCAATCAGG
CGACATTCAGGGTGCCACAAATAAAGCTGACAATAATGATGTCGGTTCCG
TTAAGGCTGGAATTCAATTCAATCAGTCGTGGAGTTATTCTATTAAATGC
GATGAAGCCGTCAAGCGGTTGCTATGGGAAATGGTTCCAGAATACTGGAA
AACATTATTCGGGGCAATGAGTGTTGCCGACAGTGTTGGATTCGTGTTTG
AGTCCCTACAAAGCCTGGAAGCCAACAAGGCATTAATCTATAGAATTCTC
CAATCATTCGTGGACGAGCTGCTGGAGGAGGATGACGAGCAACAGCTCTA
TTTGACAGCATAGGTTACCATCGGTAGTTGACATCTGATGTGTCAATCGA
GTCCCATTATCAGAGTATTATTGATTTTATTGTGTAAAATAGATTGTTAT
TGCAG
back to top

protein sequence of SMED30029142-orf-1

>SMED30029142-orf-1 ID=SMED30029142-orf-1|Name=SMED30029142-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1275bp
MGLKLLFFIFVIYVLSNIFNAIGWLALFFYLVTMFLLLPSIYFINKISHN
TIETKNFFKVENALLTPGIKKRGFFKTLSKMSYVDFIDGKEANLTSISPF
PSRRIEEIVDDIIDEIIKYYVLPYAEANSWKFKNTETFLKKFLKKLISEV
VHRMSVIEWNIFFCNTLLDNMKSHINFLKSRNNQNDENMYFMGTKTENLF
VEAISNRLLRSLLDCKYIQCELVYQFSLGILSHQVIKRAVEYYCEPVNHN
QWLFQKLIEKKITRSKLNKQLPHFQYDMSFEDFFKMVESISDLNEVKQIK
QKLLNELRMAEVLKFTQSNIDSKNANKKKIQDHNKIGRKTACKGHLLTQR
DLKCYSNQLSTLLDTVNTKLKMMTRGKANINISTQSLMKSSKRHKISRRN
SKSEKQTLSKKIKSKVAGNFNKKLSIGKSVNEKTVALNEIRSLQKFRYKS
HFECIPYETIMDSNEGRKFFKEFLNTTLYSRTVELVEMLNHFQNHREDQY
VIAQGIVKRYIHSSPPAFDFDKQIVKEMEEFLKGNSSEKVFLKAKVICDK
ELKQRWYPYFILSPHHTKFSKHLSKELNSIESIKMMDISPPGMSTDTGDT
DIESDASEDLSQNVLNSTMNSEKLMTDNDDDNPPALLFDFTQSLTKEHAD
ETQSMQTDEIDTNKLVSDTFEGHTDEEFEEEEDGFLKPSFENVPLTSGTE
TMEYYHQKIQKLNKKIDVKEKAYKAGVAVSNQMPLSKKEKSKMKIDLNSV
KEDLNRLYEKRNKCQYNLSRVDKWILSLGNWNAVVYDVILPEPKRGTSLD
LGYLPTLAESKSGTMAIEKDDMSTEDDTKQIVIFIMVSLASTLDQYNSRE
DNGWLVKHTLKDFQALKRELTPQCPPIDRISLPKVPQRLFIRRKYTDNDL
SHIKDSLNKFIQFLMKTPILAKSESVFKFFCSSLESQMSNEDTLMGPLSL
FANTLSDASAKVMLMAKIPTKFVQKVLAPRKHSGSVTSLDSESTDSKSDR
KNTSRRISGSSHIGGSLKHKLRKLSHSKDISMSAFELLEELIQLRKSLTL
TRRSMITFVQSFFGKNLTQILTEKVAWIKSESTVFVCLQKYRDSFRIDSS
ESFQSSSETHYVDEGSKLHPSASAFIAVHVSDTSESNLQHVNSNSSPTMN
KARFYQKNDTGSCENFESQSGDIQGATNKADNNDVGSVKAGIQFNQSWSY
SIKCDEAVKRLLWEMVPEYWKTLFGAMSVADSVGFVFESLQSLEANKALI
YRILQSFVDELLEEDDEQQLYLTA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036871PX_dom_sf
IPR036305RGS_sf
IPR001683Phox
IPR003114Phox_assoc
IPR016137RGS
Vocabulary: molecular function
TermDefinition
GO:0035091phosphatidylinositol binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 740..760
NoneNo IPR availableCOILSCoilCoilcoord: 293..313
NoneNo IPR availableGENE3DG3DSA:1.20.58.1850coord: 453..573
e-value: 5.3E-11
score: 44.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 386..411
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 984..1020
NoneNo IPR availablePANTHERPTHR22775:SF42FI21262P1coord: 6..1095
NoneNo IPR availablePANTHERPTHR22775SORTING NEXINcoord: 6..1095
NoneNo IPR availableTMHMMTMhelixcoord: 5..27
IPR001683Phox homologous domainPFAMPF00787PXcoord: 842..931
e-value: 2.1E-9
score: 37.4
IPR001683Phox homologous domainPROSITEPS50195PXcoord: 811..937
score: 10.724
IPR003114Phox-associated domainPFAMPF02194PXAcoord: 104..253
e-value: 9.9E-6
score: 25.6
IPR016137RGS domainPFAMPF00615RGScoord: 458..568
e-value: 1.5E-10
score: 41.3
IPR016137RGS domainPROSITEPS50132RGScoord: 456..570
score: 10.002
IPR036871PX domain superfamilyGENE3DG3DSA:3.30.1520.10coord: 812..944
e-value: 3.7E-12
score: 48.1
IPR036871PX domain superfamilySUPERFAMILYSSF64268PX domaincoord: 850..933
IPR036305RGS domain superfamilySUPERFAMILYSSF48097Regulator of G-protein signaling, RGScoord: 455..570