Ubiquitin-conjugating enzyme E2 L3

Overview
NameUbiquitin-conjugating enzyme E2 L3
Smed IDSMED30029139
Length (bp)677
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ubiquitin-conjugating enzyme E2 L3 (SMED30029139) t-SNE clustered cells

Violin plots show distribution of expression levels for Ubiquitin-conjugating enzyme E2 L3 (SMED30029139) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ubiquitin-conjugating enzyme E2 L3 (SMED30029139) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ubiquitin-conjugating enzyme E2 L3 (SMED30029139) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029139

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 36

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30029139SMESG000069969.1 SMESG000069968.1 Contig3873uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30029139SMESG000069969.1 SMESG000069968.1 Contig3873newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30029139SMESG000069968.1 Contig3166GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30029139SMESG000049478.1 Contig3873uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30029139SMESG000049478.1 Contig3873newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30029139SMESG000069968.1 Contig990GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30029139SMESG000069968.1 SMESG000069969.1 dd_Smed_v4_180_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30029139SMESG000069968.1 SMESG000069969.1 dd_Smed_v4_180_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30029139SMESG000069968.1 SMESG000069969.1 dd_Smed_v4_180_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30029139SMESG000069968.1 SMESG000069969.1 dd_Smed_v4_180_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029139SMESG000069968.1 SMESG000069969.1 dd_Smed_v4_180_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30029139SMESG000069968.1 SMESG000069969.1 dd_Smed_v4_180_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30029139SMESG000069968.1 SMESG000069969.1 dd_Smed_v4_180_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30029139SMESG000069968.1 SMESG000069969.1 dd_Smed_v4_180_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029139SMESG000069968.1 SMESG000069969.1 Contig562uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029139SMESG000069968.1 SMESG000069969.1 Contig562newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029139SMESG000069968.1 SMESG000069969.1 Contig563uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029139SMESG000069968.1 SMESG000069969.1 Contig563newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029139SMESG000069968.1 Contig33851uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029139SMESG000069968.1 Contig33851newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029139SMESG000054821.1 Contig563uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029139SMESG000054821.1 Contig563newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029139SMESG000037024.1 Contig562uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029139SMESG000037024.1 Contig562newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029139SMESG000069968.1 SMESG000069969.1 Contig565uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029139SMESG000069968.1 SMESG000069969.1 Contig565newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029139SMESG000069968.1 SMESG000069969.1 Contig564uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029139SMESG000069968.1 SMESG000069969.1 Contig564newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029139SMESG000076325.1 Contig565uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029139SMESG000076325.1 Contig565newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029139SMESG000001228.1 Contig564uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029139SMESG000001228.1 Contig564newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30029139SMESG000069968.1 SMESG000069969.1 dd_Smed_v6_180_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30029139SMESG000069968.1 SMESG000069969.1 dd_Smed_v6_180_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30029139SMESG000069968.1 SMESG000069969.1 dd_Smed_v6_180_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30029139SMESG000069968.1 SMESG000069969.1 dd_Smed_v6_180_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Human
Match: UBE2L3 (ubiquitin conjugating enzyme E2 L3 [Source:HGNC Symbol;Acc:HGNC:12488])

HSP 1 Score: 137.887 bits (346), Expect = 1.114e-40
Identity = 65/153 (42.48%), Postives = 101/153 (66.01%), Query Frame = 2
Query:  134 MAATKRLSKELSVVKSKEEITSFFKITKADPSNIFEWEGLLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNAKKK 592
            MAA++RL KEL  ++ K  + +F  I + D +N+  W+GL+ P +PP+++ AF + + F   +PFKPP IT KT IYHPN+DE+G VCL +I+A NWKP  + +Q+I+    L++ P P H LR DL EE++K  ++F + A +   K  +K+
Sbjct:    1 MAASRRLMKELEEIR-KCGMKNFRNI-QVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKR 151          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Human
Match: UBE2L5 (ubiquitin conjugating enzyme E2 L5 [Source:HGNC Symbol;Acc:HGNC:13477])

HSP 1 Score: 137.502 bits (345), Expect = 1.202e-40
Identity = 65/153 (42.48%), Postives = 100/153 (65.36%), Query Frame = 2
Query:  134 MAATKRLSKELSVVKSKEEITSFFKITKADPSNIFEWEGLLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNAKKK 592
            MAA++RL KEL  ++ K  + +F  I + D +N+  W+GL+ P +PP+N+ AF + + F   +PFKPP IT KT IYHPN+DE+G VCL +I+A NWKP  + +Q+I+    L++ P P H LR DL EE++   ++F + A +   K  +K+
Sbjct:    1 MAASRRLMKELEEIR-KCGMENFRNI-QVDEANLLTWQGLIVPDNPPYNKGAFRIEINFPAEYPFKPPRITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSNDRKKFCKNAEEFTKKYGEKR 151          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Human
Match: UBE2L5 (ubiquitin conjugating enzyme E2 L5 [Source:HGNC Symbol;Acc:HGNC:13477])

HSP 1 Score: 137.502 bits (345), Expect = 1.202e-40
Identity = 65/153 (42.48%), Postives = 100/153 (65.36%), Query Frame = 2
Query:  134 MAATKRLSKELSVVKSKEEITSFFKITKADPSNIFEWEGLLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNAKKK 592
            MAA++RL KEL  ++ K  + +F  I + D +N+  W+GL+ P +PP+N+ AF + + F   +PFKPP IT KT IYHPN+DE+G VCL +I+A NWKP  + +Q+I+    L++ P P H LR DL EE++   ++F + A +   K  +K+
Sbjct:    1 MAASRRLMKELEEIR-KCGMENFRNI-QVDEANLLTWQGLIVPDNPPYNKGAFRIEINFPAEYPFKPPRITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSNDRKKFCKNAEEFTKKYGEKR 151          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Human
Match: UBE2L5 (ubiquitin conjugating enzyme E2 L5 [Source:HGNC Symbol;Acc:HGNC:13477])

HSP 1 Score: 137.502 bits (345), Expect = 1.202e-40
Identity = 65/153 (42.48%), Postives = 100/153 (65.36%), Query Frame = 2
Query:  134 MAATKRLSKELSVVKSKEEITSFFKITKADPSNIFEWEGLLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNAKKK 592
            MAA++RL KEL  ++ K  + +F  I + D +N+  W+GL+ P +PP+N+ AF + + F   +PFKPP IT KT IYHPN+DE+G VCL +I+A NWKP  + +Q+I+    L++ P P H LR DL EE++   ++F + A +   K  +K+
Sbjct:    1 MAASRRLMKELEEIR-KCGMENFRNI-QVDEANLLTWQGLIVPDNPPYNKGAFRIEINFPAEYPFKPPRITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSNDRKKFCKNAEEFTKKYGEKR 151          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Human
Match: UBE2L3 (ubiquitin conjugating enzyme E2 L3 [Source:HGNC Symbol;Acc:HGNC:12488])

HSP 1 Score: 129.413 bits (324), Expect = 1.095e-36
Identity = 55/130 (42.31%), Postives = 86/130 (66.15%), Query Frame = 2
Query:  203 FKITKADPSNIFEWEGLLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNAKKK 592
            F+  + D +N+  W+GL+ P +PP+++ AF + + F   +PFKPP IT KT IYHPN+DE+G VCL +I+A NWKP  + +Q+I+    L++ P P H LR DL EE++K  ++F + A +   K  +K+
Sbjct:   80 FRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKR 209          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Celegans
Match: ubc-18 (UBiquitin Conjugating enzyme [Source:UniProtKB/TrEMBL;Acc:Q21633])

HSP 1 Score: 131.724 bits (330), Expect = 1.010e-38
Identity = 61/153 (39.87%), Postives = 100/153 (65.36%), Query Frame = 2
Query:  134 MAATKRLSKELSVVKSKEEITSFFKITKADPSNIFEWEGLLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNAKKK 592
            M+AT+RL KEL  +K+       ++  + + +N+ +W  LL P   P+N+ AF+V + F  ++PFKPP +  +T IYHPNVDE+G  CL ++ A NWKP  + EQ++     LI++P+P+H +R D+ EEF K +++F + A +H  K+A+K+
Sbjct:    1 MSATRRLQKELGDLKNCG--VKAYENVECEETNLLKWTVLLIPDKEPYNKGAFKVGITFPVDYPFKPPKVAFETKIYHPNVDEEGKFCLPIVTAENWKPATKTEQVMMALLSLINEPEPSHPIRADVAEEFQKDHKKFMKTAEEHTRKHAEKR 151          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Celegans
Match: ubc-1 (Ubiquitin-conjugating enzyme E2 1 [Source:UniProtKB/Swiss-Prot;Acc:P52478])

HSP 1 Score: 75.0998 bits (183), Expect = 1.513e-16
Identity = 38/139 (27.34%), Postives = 70/139 (50.36%), Query Frame = 2
Query:  179 SKEEITSFFKITKADP----------SNIFEWEGLLY-PKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKAR 562
            S+  +   FK  + DP           NI  WE +++ P+  PF +  F++ L+F+E +P KPPT+   + ++HPNV   G +CL ++  N W P      I+     L+D+P+PN        + + +   E++++ +
Sbjct:    5 SRRRLMRDFKKLQEDPPAGVSGAPTEDNILTWEAIIFGPQETPFEDGTFKLSLEFTEEYPNKPPTVKFISKMFHPNVYADGSICLDILQ-NRWSPTYDVAAILTSIQSLLDEPNPNSPANSLAAQLYQENRREYEKRVQ 142          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Celegans
Match: let-70 (Ubiquitin-conjugating enzyme E2 2 [Source:UniProtKB/Swiss-Prot;Acc:P35129])

HSP 1 Score: 69.3218 bits (168), Expect = 6.975e-15
Identity = 31/119 (26.05%), Postives = 61/119 (51.26%), Query Frame = 2
Query:  230 NIFEWEG-LLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNA 583
            ++F W+  ++ P   P+    F + + F  ++PFKPP +   T IYHPN++  G +CL ++ +  W P +   +++     L+  P+P+  L  ++   +    E + + AR+   K A
Sbjct:   29 DLFHWQATIMGPPESPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRS-QWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRERYNQLAREWTQKYA 146          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Celegans
Match: ubc-13 (Ubiquitin-conjugating enzyme E2 13 [Source:UniProtKB/Swiss-Prot;Acc:Q95XX0])

HSP 1 Score: 61.2326 bits (147), Expect = 9.717e-12
Identity = 29/101 (28.71%), Postives = 49/101 (48.51%), Query Frame = 2
Query:  260 PKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKAR 562
            P   PF    F++ L   E +P   P +   T IYHPN+D+ G +CL ++  + W P +Q   ++     L+  P+P   L  D+ E++     E  + A+
Sbjct:   43 PDDSPFAGGVFKLELFLPEEYPMAAPKVRFMTKIYHPNIDKLGRICLDILK-DKWSPALQIRTVLLSIQALLSAPNPEDPLATDVAEQWKTNEAEAIKTAK 142          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Celegans
Match: uev-2 (Ubiquitin E2 (Conjugating enzyme) variant [Source:UniProtKB/TrEMBL;Acc:Q20872])

HSP 1 Score: 60.8474 bits (146), Expect = 4.319e-11
Identity = 29/104 (27.88%), Postives = 54/104 (51.92%), Query Frame = 2
Query:  260 PKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHA 571
            P+  P+    +EV + F +  P  PP    KTP++HPNVD +G + L ++   +W      +++++E + L+  PD       +   E+  + E ++ KAR +A
Sbjct:   78 PRGSPWEGGEYEVSVNFHK-WPIIPPICEFKTPLHHPNVDLRGSIYLKMLEQEHWSSETSLKKLLREISNLLATPDLTQAANIEAWMEYENQRENYEAKARAYA 180          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Fly
Match: Ubc10 (gene:FBgn0026316 transcript:FBtr0089553)

HSP 1 Score: 141.354 bits (355), Expect = 2.457e-42
Identity = 67/153 (43.79%), Postives = 99/153 (64.71%), Query Frame = 2
Query:  134 MAATKRLSKELSVVKSKEEITSFFKITKADPSNIFEWEGLLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNAKKK 592
            M A +RL KELS ++    + SF  I KAD  N+  W GL+ P +PP+N+ AF + + F   +PFKPP I  KT IYHPN+DE+G VCL +I+  NWKP  + +Q+++    LI+ P+P H LR +L EEF K  ++F + A D+  K+++K+
Sbjct:    1 MTAPRRLRKELSDLQGNA-LKSFRDI-KADDDNLLRWTGLIVPDNPPYNKGAFRIEINFPAEYPFKPPKINFKTRIYHPNIDEKGQVCLPIISTENWKPATRTDQVVQALVDLINDPEPEHPLRAELAEEFLKDRKKFVKNAEDYTKKHSEKR 151          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Fly
Match: Ubc84D (gene:FBgn0017456 transcript:FBtr0081552)

HSP 1 Score: 138.272 bits (347), Expect = 3.250e-41
Identity = 66/154 (42.86%), Postives = 103/154 (66.88%), Query Frame = 2
Query:  134 MAATKRLSKELS-VVKSKEEITSFFKITKADPSNIFEWEGLLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNAKKK 592
            MAAT+RL++ELS +V++K  +++   I  +D S +  W GLL P+  P+N+ AF + + F   +PF PP I  KT IYHPNVDE+G+VCL +I+ +NWKP  + EQ+++    ++  P+P H LR DL EEF + +++F + A +   KNA+K+
Sbjct:    1 MAATRRLTRELSDLVEAK--MSTLRNIESSDES-LLMWTGLLVPEKAPYNKGAFRIEINFPPQYPFMPPKILFKTKIYHPNVDEKGEVCLPIISTDNWKPTTRTEQVLQALVAIVHNPEPEHPLRSDLAEEFVREHKKFMKTAEEFTKKNAEKR 151          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Fly
Match: CG17030 (gene:FBgn0035584 transcript:FBtr0073374)

HSP 1 Score: 93.9745 bits (232), Expect = 8.861e-24
Identity = 40/131 (30.53%), Postives = 81/131 (61.83%), Query Frame = 2
Query:  134 MAATKRLSKELSVVKSKEEITSFFKITKADPSNIFEWEGLLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEF 526
            M   KR+++EL+++   ++   F  +   +P+NI++W GLL P +PP+++ A+++ + F  ++PFKPP I + T +YH NV+E+G VC+ ++   +W P  + +Q+++     I+ P P +    ++  E+
Sbjct:    9 MDGPKRMNRELALMLEDKQNLQFRNLL-VEPNNIYKWTGLLMPVAPPYDKGAYKMEIDFPLDYPFKPPRIHINTRMYHLNVNERGQVCVPILEVEHWIPTTRIDQVLQVLLATINDPQPENAWHIEMAGEY 138          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Fly
Match: Ubc2 (gene:FBgn0015320 transcript:FBtr0080115)

HSP 1 Score: 76.6406 bits (187), Expect = 1.035e-16
Identity = 46/150 (30.67%), Postives = 79/150 (52.67%), Query Frame = 2
Query:  116 SRSLFSMAATKRLSKELSVVKSKEEITSFFKITKADPSNIFEW-EGLLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKAR 562
            SR+L + A  KR+ KEL+ + + +   +     K D  N++EW   +L P    +    F + + FS  +PFKPP +T +T IYH N++ QG +CL ++  +NW P +   +++     L+   +P   L G +  ++ +  EE  R AR
Sbjct:   81 SRALGTSA--KRIQKELAEI-TLDPPPNCSAGPKGD--NLYEWVSTILGPPGSVYEGGVFFLDIHFSPEYPFKPPKVTFRTRIYHCNINSQGVICLDILK-DNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLQNREEHDRIAR 224          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Fly
Match: Ubc2 (gene:FBgn0015320 transcript:FBtr0345437)

HSP 1 Score: 76.6406 bits (187), Expect = 1.035e-16
Identity = 46/150 (30.67%), Postives = 79/150 (52.67%), Query Frame = 2
Query:  116 SRSLFSMAATKRLSKELSVVKSKEEITSFFKITKADPSNIFEW-EGLLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKAR 562
            SR+L + A  KR+ KEL+ + + +   +     K D  N++EW   +L P    +    F + + FS  +PFKPP +T +T IYH N++ QG +CL ++  +NW P +   +++     L+   +P   L G +  ++ +  EE  R AR
Sbjct:   81 SRALGTSA--KRIQKELAEI-TLDPPPNCSAGPKGD--NLYEWVSTILGPPGSVYEGGVFFLDIHFSPEYPFKPPKVTFRTRIYHCNINSQGVICLDILK-DNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLQNREEHDRIAR 224          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Zebrafish
Match: ube2l3a (ubiquitin-conjugating enzyme E2L 3a [Source:ZFIN;Acc:ZDB-GENE-030131-2977])

HSP 1 Score: 142.895 bits (359), Expect = 1.254e-42
Identity = 68/158 (43.04%), Postives = 104/158 (65.82%), Query Frame = 2
Query:  119 RSLFSMAATKRLSKELSVVKSKEEITSFFKITKADPSNIFEWEGLLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNAKKK 592
            +S   MAA++RL KEL  ++ K  + +F  I + D SNI  W+GL+ P +PP+++ AF + + F   +PFKPP IT KT IYHPN+DE+G VCL +I+A NWKP  + +Q+I+    L++ P P H LR DL EE++K  ++F + A +   K+ +K+
Sbjct:   14 QSRSKMAASRRLHKELDEIR-KSGMKNFRNI-QVDESNILTWQGLIVPDNPPYDKGAFRIEITFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFFKNAEEFTKKHGEKR 169          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Zebrafish
Match: ube2l3a (ubiquitin-conjugating enzyme E2L 3a [Source:ZFIN;Acc:ZDB-GENE-030131-2977])

HSP 1 Score: 142.895 bits (359), Expect = 1.254e-42
Identity = 68/158 (43.04%), Postives = 104/158 (65.82%), Query Frame = 2
Query:  119 RSLFSMAATKRLSKELSVVKSKEEITSFFKITKADPSNIFEWEGLLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNAKKK 592
            +S   MAA++RL KEL  ++ K  + +F  I + D SNI  W+GL+ P +PP+++ AF + + F   +PFKPP IT KT IYHPN+DE+G VCL +I+A NWKP  + +Q+I+    L++ P P H LR DL EE++K  ++F + A +   K+ +K+
Sbjct:   14 QSRSKMAASRRLHKELDEIR-KSGMKNFRNI-QVDESNILTWQGLIVPDNPPYDKGAFRIEITFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFFKNAEEFTKKHGEKR 169          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Zebrafish
Match: ube2l3a (ubiquitin-conjugating enzyme E2L 3a [Source:ZFIN;Acc:ZDB-GENE-030131-2977])

HSP 1 Score: 142.124 bits (357), Expect = 1.479e-42
Identity = 67/153 (43.79%), Postives = 102/153 (66.67%), Query Frame = 2
Query:  134 MAATKRLSKELSVVKSKEEITSFFKITKADPSNIFEWEGLLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNAKKK 592
            MAA++RL KEL  ++ K  + +F  I + D SNI  W+GL+ P +PP+++ AF + + F   +PFKPP IT KT IYHPN+DE+G VCL +I+A NWKP  + +Q+I+    L++ P P H LR DL EE++K  ++F + A +   K+ +K+
Sbjct:    1 MAASRRLHKELDEIR-KSGMKNFRNI-QVDESNILTWQGLIVPDNPPYDKGAFRIEITFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFFKNAEEFTKKHGEKR 151          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Zebrafish
Match: ube2l3b (ubiquitin-conjugating enzyme E2L 3b [Source:ZFIN;Acc:ZDB-GENE-030131-662])

HSP 1 Score: 140.969 bits (354), Expect = 3.881e-42
Identity = 67/153 (43.79%), Postives = 102/153 (66.67%), Query Frame = 2
Query:  134 MAATKRLSKELSVVKSKEEITSFFKITKADPSNIFEWEGLLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNAKKK 592
            MAA++RL KEL  ++ K  + +F  I + D SNI  W+GL+ P +PP+++ AF + + F   +PFKPP IT KT IYHPN+DE+G VCL +I+A NWKP  + +Q+I+    L++ P P H LR DL EE++K  ++F + A +   K+ +K+
Sbjct:    1 MAASRRLHKELEEIR-KSGMKNFRNI-QVDESNILTWQGLIVPDNPPYDKGAFRIEIIFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFFKNAEEFTKKHGEKR 151          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Zebrafish
Match: ube2l3b (ubiquitin-conjugating enzyme E2L 3b [Source:ZFIN;Acc:ZDB-GENE-030131-662])

HSP 1 Score: 130.183 bits (326), Expect = 3.640e-38
Identity = 57/130 (43.85%), Postives = 87/130 (66.92%), Query Frame = 2
Query:  203 FKITKADPSNIFEWEGLLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNAKKK 592
            F+  + D SNI  W+GL+ P +PP+++ AF + + F   +PFKPP IT KT IYHPN+DE+G VCL +I+A NWKP  + +Q+I+    L++ P P H LR DL EE++K  ++F + A +   K+ +K+
Sbjct:    4 FRNIQVDESNILTWQGLIVPDNPPYDKGAFRIEIIFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFFKNAEEFTKKHGEKR 133          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Xenopus
Match: themis (thymocyte selection associated [Source:Xenbase;Acc:XB-GENE-994469])

HSP 1 Score: 139.043 bits (349), Expect = 3.099e-41
Identity = 66/153 (43.14%), Postives = 100/153 (65.36%), Query Frame = 2
Query:  134 MAATKRLSKELSVVKSKEEITSFFKITKADPSNIFEWEGLLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNAKKK 592
            MAA++RL KEL  ++ K  + +F  I   D SN+  W+GL+ P +PP+++ AF + + F   +PFKPP IT KT IYHPN+DE+G VCL +I+A NWKP  + +Q+I+    L++ P P H LR DL EE++K  ++F + A +   K  +K+
Sbjct:    1 MAASRRLMKELEEIR-KTGMKNFRNIQVED-SNLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKR 151          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Xenopus
Match: themis (thymocyte selection associated [Source:Xenbase;Acc:XB-GENE-994469])

HSP 1 Score: 127.872 bits (320), Expect = 8.517e-37
Identity = 55/130 (42.31%), Postives = 86/130 (66.15%), Query Frame = 2
Query:  203 FKITKADPSNIFEWEGLLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNAKKK 592
            F+  + + SN+  W+GL+ P +PP+++ AF + + F   +PFKPP IT KT IYHPN+DE+G VCL +I+A NWKP  + +Q+I+    L++ P P H LR DL EE++K  ++F + A +   K  +K+
Sbjct:   24 FRNIQVEDSNLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKR 153          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Xenopus
Match: chmp2b (charged multivesicular body protein 2B [Source:Xenbase;Acc:XB-GENE-948820])

HSP 1 Score: 76.6406 bits (187), Expect = 3.198e-17
Identity = 41/151 (27.15%), Postives = 75/151 (49.67%), Query Frame = 2
Query:  140 ATKRLSKELSVVKSKEEITSFFKITKADP--SNIFEWEG-LLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNA 583
            A KR+ KEL+ ++             A P   ++F W+  ++ P   P+    F + + F  ++PFKPP +   T IYHPN++  G +CL ++ +  W P +   +++     L+  P+P+  L  D+ + +    E++ R AR+   K A
Sbjct:    2 ALKRIQKELNDLQRDPPAQC-----SAGPVGDDLFHWQATIMGPTDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRS-QWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRLAREWTQKYA 146          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Xenopus
Match: eif2s2 (eukaryotic translation initiation factor 2 subunit beta [Source:Xenbase;Acc:XB-GENE-964372])

HSP 1 Score: 75.0998 bits (183), Expect = 1.148e-16
Identity = 40/149 (26.85%), Postives = 71/149 (47.65%), Query Frame = 2
Query:  140 ATKRLSKELSVVKSKEEITSFFKITKADPSNIFEWEG-LLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNA 583
            A KR+ KEL  ++              D   +F W+  ++ P   PF    F + + F  ++PFKPP +   T IYHPN++  G +CL ++ +  W P +   +++     L+  P+P+  L  ++   +    E++ R AR+   K A
Sbjct:    2 ALKRIQKELMDLQRDPPAQCSAGPVGED---LFHWQATIMGPNDSPFQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRS-QWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKYA 146          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Xenopus
Match: tep1 (telomerase associated protein 1 [Source:Xenbase;Acc:XB-GENE-495387])

HSP 1 Score: 75.0998 bits (183), Expect = 1.210e-16
Identity = 32/111 (28.83%), Postives = 61/111 (54.95%), Query Frame = 2
Query:  230 NIFEWEGLLY-PKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKA 559
            NI  W  +++ P+  PF +  F+++++FSE +P KPPT+   + ++HPNV   G +CL ++  N W P      I+     L+D+P+PN        + + +   E++++ 
Sbjct:   23 NIMVWNAVIFGPEGTPFEDGTFKLVIEFSEEYPNKPPTVRFVSKMFHPNVYADGSICLDILQ-NRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKRV 132          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Mouse
Match: Ube2l3 (ubiquitin-conjugating enzyme E2L 3 [Source:MGI Symbol;Acc:MGI:109240])

HSP 1 Score: 137.887 bits (346), Expect = 7.647e-41
Identity = 65/153 (42.48%), Postives = 101/153 (66.01%), Query Frame = 2
Query:  134 MAATKRLSKELSVVKSKEEITSFFKITKADPSNIFEWEGLLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNAKKK 592
            MAA++RL KEL  ++ K  + +F  I + D +N+  W+GL+ P +PP+++ AF + + F   +PFKPP IT KT IYHPN+DE+G VCL +I+A NWKP  + +Q+I+    L++ P P H LR DL EE++K  ++F + A +   K  +K+
Sbjct:    1 MAASRRLMKELEEIR-KCGMKNFRNI-QVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKR 151          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Mouse
Match: Ube2l3 (ubiquitin-conjugating enzyme E2L 3 [Source:MGI Symbol;Acc:MGI:109240])

HSP 1 Score: 137.887 bits (346), Expect = 7.647e-41
Identity = 65/153 (42.48%), Postives = 101/153 (66.01%), Query Frame = 2
Query:  134 MAATKRLSKELSVVKSKEEITSFFKITKADPSNIFEWEGLLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNAKKK 592
            MAA++RL KEL  ++ K  + +F  I + D +N+  W+GL+ P +PP+++ AF + + F   +PFKPP IT KT IYHPN+DE+G VCL +I+A NWKP  + +Q+I+    L++ P P H LR DL EE++K  ++F + A +   K  +K+
Sbjct:    1 MAASRRLMKELEEIR-KCGMKNFRNI-QVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKR 151          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Mouse
Match: Ube2l3 (ubiquitin-conjugating enzyme E2L 3 [Source:MGI Symbol;Acc:MGI:109240])

HSP 1 Score: 132.494 bits (332), Expect = 6.008e-39
Identity = 61/137 (44.53%), Postives = 93/137 (67.88%), Query Frame = 2
Query:  137 AATKRLSKELSVVKSKEEITSFFKITKADPSNIFEWEGLLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEF 547
            AA++RL KEL  ++ K  + +F  I + D +N+  W+GL+ P +PP+++ AF + + F   +PFKPP IT KT IYHPN+DE+G VCL +I+A NWKP  + +Q+I+    L++ P P H LR DL EE++K  ++F
Sbjct:    2 AASRRLMKELEEIR-KCGMKNFRNI-QVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKF 136          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Mouse
Match: Ube2l3 (ubiquitin-conjugating enzyme E2L 3 [Source:MGI Symbol;Acc:MGI:109240])

HSP 1 Score: 110.153 bits (274), Expect = 1.801e-30
Identity = 49/113 (43.36%), Postives = 74/113 (65.49%), Query Frame = 2
Query:  254 LYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNAKKK 592
            L   +PP+++ AF + + F   +PFKPP IT KT IYHPN+DE+G VCL +I+A NWKP  + +Q+I+    L++ P P H LR DL EE++K  ++F + A +   K  +K+
Sbjct:    7 LMKDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKR 119          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Mouse
Match: Ube2l6 (ubiquitin-conjugating enzyme E2L 6 [Source:MGI Symbol;Acc:MGI:1914500])

HSP 1 Score: 108.997 bits (271), Expect = 1.071e-29
Identity = 55/148 (37.16%), Postives = 85/148 (57.43%), Query Frame = 2
Query:  134 MAATKRLSKELSVVKSKEEITSFFKITKADPSNIFEWEGLLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACK 577
            M A+KR++KEL  +   +E+  + +   +D +N+  W  LL P   P+   AF+V + F   +PFKPPT+   T IYHPNV E G VCL LI+  NWKP  +  Q+++    L+ KP+    +R +L +  T+  E F++KA +   K
Sbjct:    1 MMASKRVAKELESLS--KELPPYLRQLSSDDANVLVWHMLLLPDQLPYGLKAFQVRIDFPREYPFKPPTLRFTTKIYHPNVREDGLVCLPLISNENWKPYTKPYQVLEALNVLVSKPNLEEPVRLELADLLTQNPEMFRKKAEEFTLK 146          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. UniProt/SwissProt
Match: sp|Q7K738|UBC10_DROME (Ubiquitin-conjugating enzyme E2-18 kDa OS=Drosophila melanogaster OX=7227 GN=Ubc10 PE=1 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 2.463e-41
Identity = 67/153 (43.79%), Postives = 99/153 (64.71%), Query Frame = 2
Query:  134 MAATKRLSKELSVVKSKEEITSFFKITKADPSNIFEWEGLLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNAKKK 592
            M A +RL KELS ++    + SF  I KAD  N+  W GL+ P +PP+N+ AF + + F   +PFKPP I  KT IYHPN+DE+G VCL +I+  NWKP  + +Q+++    LI+ P+P H LR +L EEF K  ++F + A D+  K+++K+
Sbjct:    1 MTAPRRLRKELSDLQGNA-LKSFRDI-KADDDNLLRWTGLIVPDNPPYNKGAFRIEINFPAEYPFKPPKINFKTRIYHPNIDEKGQVCLPIISTENWKPATRTDQVVQALVDLINDPEPEHPLRAELAEEFLKDRKKFVKNAEDYTKKHSEKR 151          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. UniProt/SwissProt
Match: sp|P52487|UBC84_DROME (Ubiquitin-conjugating enzyme E2-18 kDa OS=Drosophila melanogaster OX=7227 GN=Ubc84D PE=2 SV=2)

HSP 1 Score: 138.272 bits (347), Expect = 3.258e-40
Identity = 66/154 (42.86%), Postives = 103/154 (66.88%), Query Frame = 2
Query:  134 MAATKRLSKELS-VVKSKEEITSFFKITKADPSNIFEWEGLLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNAKKK 592
            MAAT+RL++ELS +V++K  +++   I  +D S +  W GLL P+  P+N+ AF + + F   +PF PP I  KT IYHPNVDE+G+VCL +I+ +NWKP  + EQ+++    ++  P+P H LR DL EEF + +++F + A +   KNA+K+
Sbjct:    1 MAATRRLTRELSDLVEAK--MSTLRNIESSDES-LLMWTGLLVPEKAPYNKGAFRIEINFPPQYPFMPPKILFKTKIYHPNVDEKGEVCLPIISTDNWKPTTRTEQVLQALVAIVHNPEPEHPLRSDLAEEFVREHKKFMKTAEEFTKKNAEKR 151          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. UniProt/SwissProt
Match: sp|Q5R5I4|UB2L3_PONAB (Ubiquitin-conjugating enzyme E2 L3 OS=Pongo abelii OX=9601 GN=UBE2L3 PE=2 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 3.621e-40
Identity = 65/153 (42.48%), Postives = 101/153 (66.01%), Query Frame = 2
Query:  134 MAATKRLSKELSVVKSKEEITSFFKITKADPSNIFEWEGLLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNAKKK 592
            MAA++RL KEL  ++ K  + +F  I + D +N+  W+GL+ P +PP+++ AF + + F   +PFKPP IT KT IYHPN+DE+G VCL +I+A NWKP  + +Q+I+    L++ P P H LR DL EE++K  ++F + A +   K  +K+
Sbjct:    1 MAASRRLMKELEEIR-KCGMKNFRNI-RVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKR 151          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. UniProt/SwissProt
Match: sp|P68037|UB2L3_MOUSE (Ubiquitin-conjugating enzyme E2 L3 OS=Mus musculus OX=10090 GN=Ube2l3 PE=1 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 5.349e-40
Identity = 65/153 (42.48%), Postives = 101/153 (66.01%), Query Frame = 2
Query:  134 MAATKRLSKELSVVKSKEEITSFFKITKADPSNIFEWEGLLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNAKKK 592
            MAA++RL KEL  ++ K  + +F  I + D +N+  W+GL+ P +PP+++ AF + + F   +PFKPP IT KT IYHPN+DE+G VCL +I+A NWKP  + +Q+I+    L++ P P H LR DL EE++K  ++F + A +   K  +K+
Sbjct:    1 MAASRRLMKELEEIR-KCGMKNFRNI-QVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKR 151          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. UniProt/SwissProt
Match: sp|P68036|UB2L3_HUMAN (Ubiquitin-conjugating enzyme E2 L3 OS=Homo sapiens OX=9606 GN=UBE2L3 PE=1 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 5.349e-40
Identity = 65/153 (42.48%), Postives = 101/153 (66.01%), Query Frame = 2
Query:  134 MAATKRLSKELSVVKSKEEITSFFKITKADPSNIFEWEGLLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNAKKK 592
            MAA++RL KEL  ++ K  + +F  I + D +N+  W+GL+ P +PP+++ AF + + F   +PFKPP IT KT IYHPN+DE+G VCL +I+A NWKP  + +Q+I+    L++ P P H LR DL EE++K  ++F + A +   K  +K+
Sbjct:    1 MAASRRLMKELEEIR-KCGMKNFRNI-QVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKR 151          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. TrEMBL
Match: A0A210QTU7 (Ubiquitin-conjugating enzyme E2 L3 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT15701 PE=3 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 8.300e-49
Identity = 80/153 (52.29%), Postives = 106/153 (69.28%), Query Frame = 2
Query:  134 MAATKRLSKELSVVKSKEEITSFFKITKADPSNIFEWEGLLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNAKKK 592
            MAAT+RL KEL  +K+KE     FKI  AD SNI  W GL+ P+  P+N+ AF++ + F   +PFKPP IT KT IYHPNVDE+G VCL +I+A+NWKP  + EQ+I+    LID+P+P H LR DL EE TK  ++F + A DH  K+A+K+
Sbjct:    1 MAATRRLGKELQDIKNKE-TAGVFKIIIADESNILNWSGLILPQKSPYNKGAFKIEILFPAEYPFKPPKITFKTKIYHPNVDEKGQVCLPIISADNWKPATKTEQVIESLVALIDEPEPEHPLRADLAEELTKDKKKFLKNAEDHTKKHAEKR 152          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. TrEMBL
Match: A0A1D1W5S0 (UBIQUITIN_CONJUGAT_2 domain-containing protein OS=Ramazzottius varieornatus OX=947166 GN=RvY_18443 PE=3 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 3.828e-45
Identity = 73/153 (47.71%), Postives = 105/153 (68.63%), Query Frame = 2
Query:  134 MAATKRLSKELSVVKSKEEITSFFKITKADPSNIFEWEGLLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNAKKK 592
            MAAT+RL+KEL+ ++S    T  F+  KAD SNI +W+GLL P++ P+N+ AF + + F   +PFKPP I  +T IYHPN+DE+G VCL +I A+NWKP  + EQ+++    LI +P+P H LR DL EEFTK  ++F + A D   K ++K+
Sbjct:    1 MAATRRLTKELADIQSASSKT--FREIKADESNILQWQGLLVPEAAPYNKGAFRIEINFPAEYPFKPPKINFRTKIYHPNIDEKGQVCLPIIQADNWKPATKTEQVVQSLLDLISEPEPEHPLRADLAEEFTKDRKKFMKNAEDFTKKYSEKR 151          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. TrEMBL
Match: A0A2P2I1I8 (Ubiquitin-conjugating enzyme E2 L3-like OS=Hirondellea gigas OX=1518452 PE=2 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 2.226e-43
Identity = 72/153 (47.06%), Postives = 107/153 (69.93%), Query Frame = 2
Query:  134 MAATKRLSKELSVVKSKEEITSFFKITKADPSNIFEWEGLLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNAKKK 592
            MAAT+RL KEL+ ++ +  I SF K  + D +NI +W+GL+ P+S P+N+ AF + + F   +PFKPP +T KT IYHPN+DE+G VCL +I+A NWKP  + +Q+I    QL+++P+P H LR DL EE+TK  ++F + A D   KN++K+
Sbjct:    1 MAATRRLQKELADIR-RTGIKSF-KDIQVDENNILQWQGLIVPESVPYNKGAFRIEVVFPAEYPFKPPKLTFKTKIYHPNIDEKGQVCLPIISAENWKPATKTDQVIDSLVQLVNEPEPEHPLRADLAEEYTKDRKKFIKNAEDFTKKNSEKR 151          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. TrEMBL
Match: T1JMF0 (UBIQUITIN_CONJUGAT_2 domain-containing protein OS=Strigamia maritima OX=126957 PE=3 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 3.401e-43
Identity = 71/153 (46.41%), Postives = 104/153 (67.97%), Query Frame = 2
Query:  134 MAATKRLSKELSVVKSKEEITSFFKITKADPSNIFEWEGLLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNAKKK 592
            MAAT+RL KELS ++ +  + SF  I + D +NI  W+GL+ P +PP+N+ AF + + F   +PFKPP I  KT IYHPN+DE+G VCL +I+A NWKP  + +Q+I+    L++ P+P H LR DL EE+TK  ++F + A D   KN++K+
Sbjct:    1 MAATRRLQKELSDIR-RSGLKSFRDI-QVDEANILTWQGLIVPDNPPYNKGAFRIEINFPAEYPFKPPKINFKTKIYHPNIDEKGQVCLPIISAENWKPATKTDQVIQALVALVNDPEPEHPLRADLAEEYTKDRKKFMKNAEDFTKKNSEKR 151          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. TrEMBL
Match: A0A3M7T8K3 (Ubiquitin-conjugating enzyme E2 L3 OS=Brachionus plicatilis OX=10195 GN=BpHYR1_026180 PE=3 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 4.039e-43
Identity = 70/153 (45.75%), Postives = 102/153 (66.67%), Query Frame = 2
Query:  134 MAATKRLSKELSVVKSKEEITSFFKITKADPSNIFEWEGLLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNAKKK 592
            MAAT+RL KEL  + S+  + SF  I   D  NI  W GL+ P +PP+N+ AF++ + F   +PFKPP IT KT IYHPN+DE+G VCL +I A NWKP  + +Q+I+    L++ P+P H LRG++ +E+TK  ++F + A +H  K A+K+
Sbjct:    1 MAATRRLQKELQEITSENGLKSFKNII-VDEQNILNWTGLIVPDNPPYNKGAFKIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPIIQAENWKPATKTDQVIQSLVALVNDPEPEHPLRGEIADEYTKDRKKFLKNAEEHTKKFAEKR 152          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Cavefish
Match: ube2l3b (ubiquitin conjugating enzyme E2 L3 [Source:NCBI gene;Acc:103044625])

HSP 1 Score: 142.895 bits (359), Expect = 6.059e-43
Identity = 66/153 (43.14%), Postives = 97/153 (63.40%), Query Frame = 2
Query:  134 MAATKRLSKELSVVKSKEEITSFFKITKADPSNIFEWEGLLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNAKKK 592
            MAA++RL KEL  ++        F+I + D SNI  W+GL+ P +PP+ + AF + + F   +PFKPP IT KT IYHPN+DE+G VCL +I+A NWKP   AEQ+I+    L++ P P H LR DL +++ K   +F + A +   K+ +K+
Sbjct:    1 MAASRRLHKELEEIRKSG--MKNFRIVQVDESNILAWQGLILPDNPPYEKGAFRIEIIFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATTAEQVIQSLITLVNDPQPEHPLRADLAQDYIKNRSKFFKNAEEFTKKHGEKR 151          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Cavefish
Match: ube2l3a (ubiquitin-conjugating enzyme E2 L3 [Source:NCBI gene;Acc:103024125])

HSP 1 Score: 140.969 bits (354), Expect = 2.857e-42
Identity = 67/153 (43.79%), Postives = 102/153 (66.67%), Query Frame = 2
Query:  134 MAATKRLSKELSVVKSKEEITSFFKITKADPSNIFEWEGLLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNAKKK 592
            MAA++RL KEL  ++ K  + +F  I + D SNI  W+GL+ P +PP+++ AF + + F   +PFKPP IT KT IYHPN+DE+G VCL +I+A NWKP  + +Q+I+    L++ P P H LR DL EE++K  ++F + A +   K+ +K+
Sbjct:    1 MAASRRLHKELDEIR-KSGMKNFRNI-QVDESNILTWQGLIVPDNPPYDKGAFRIEIIFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFFKNAEEFTKKHGEKR 151          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Cavefish
Match: ube2l3b (ubiquitin conjugating enzyme E2 L3 [Source:NCBI gene;Acc:103044625])

HSP 1 Score: 132.494 bits (332), Expect = 1.364e-38
Identity = 58/130 (44.62%), Postives = 85/130 (65.38%), Query Frame = 2
Query:  203 FKITKADPSNIFEWEGLLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNAKKK 592
            F+I + D SNI  W+GL+ P +PP+ + AF + + F   +PFKPP IT KT IYHPN+DE+G VCL +I+A NWKP   AEQ+I+    L++ P P H LR DL +++ K   +F + A +   K+ +K+
Sbjct:   45 FRIVQVDESNILAWQGLILPDNPPYEKGAFRIEIIFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATTAEQVIQSLITLVNDPQPEHPLRADLAQDYIKNRSKFFKNAEEFTKKHGEKR 174          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Cavefish
Match: ube2d1a (ubiquitin-conjugating enzyme E2 D4-like [Source:NCBI gene;Acc:103029158])

HSP 1 Score: 77.0258 bits (188), Expect = 1.317e-17
Identity = 41/151 (27.15%), Postives = 74/151 (49.01%), Query Frame = 2
Query:  140 ATKRLSKELSVVKSKEEITSFFKITKADP--SNIFEWEG-LLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNA 583
            A KR+ KEL  ++             A P   ++F W+  ++ P   PF    F + ++F  ++PFKPP +   T IYHPN++  G +CL ++ +  W P +   +++     L+  P+P+  L  D+   +    +++ R AR+   K A
Sbjct:    2 AMKRIQKELQDLQRDPP-----SQCSAGPMGEDLFHWQATIMGPGDSPFQGGVFFLTIQFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRS-QWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAHTYKSDKDKYNRLAREWTQKYA 146          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Cavefish
Match: ube2d1b (ubiquitin conjugating enzyme E2 D1 [Source:NCBI gene;Acc:103029965])

HSP 1 Score: 76.2554 bits (186), Expect = 3.349e-17
Identity = 41/151 (27.15%), Postives = 73/151 (48.34%), Query Frame = 2
Query:  140 ATKRLSKELSVVKSKEEITSFFKITKADP--SNIFEWEG-LLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNA 583
            A KR+ KEL  ++             A P   ++F W+  ++ P   P+    F + + F  ++PFKPP +   T IYHPN++  G +CL ++ +  W P +   +++     L+  P+P+  L  D+   +    E++ R AR+   K A
Sbjct:    2 ALKRIQKELQDLQRDPPAQ-----CSAGPVGDDLFHWQATIMGPSDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRS-QWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAHIYKSDKEKYNRLAREWTQKYA 146          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Sea Lamprey
Match: ube2l3a (ubiquitin-conjugating enzyme E2L 3a [Source:ZFIN;Acc:ZDB-GENE-030131-2977])

HSP 1 Score: 130.183 bits (326), Expect = 7.304e-39
Identity = 60/138 (43.48%), Postives = 88/138 (63.77%), Query Frame = 2
Query:  134 MAATKRLSKELSVVKSKEEITSFFKITKADPSNIFEWEGLLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEF 547
            +AAT    KEL+ +++       F+   A+ SNI  W GL+ P + P+++ AF + + F   +PFKPP IT KT IYHPN+DE+G VCL +INA NWKP  + +Q+I     L++ P+P H LR D+ EE+TK  ++F
Sbjct:    1 LAATTSFHKELTDIRTSG--MKNFRNILAEDSNILLWHGLIVPDNAPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPIINAENWKPATKTDQVINALVALVNDPEPEHPLRADVAEEYTKDRKKF 136          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006211.1 (pep scaffold:Pmarinus_7.0:GL476897:3176:4886:1 gene:ENSPMAG00000005612.1 transcript:ENSPMAT00000006211.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.9442 bits (180), Expect = 3.832e-17
Identity = 32/112 (28.57%), Postives = 61/112 (54.46%), Query Frame = 2
Query:  227 SNIFEWEGLLY-PKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKA 559
            +NI  W  +++ P+  PF +  F++ ++F+E +P KPPT+   + ++HPNV   G +CL ++  N W P      I+     L+D+P+PN        + + +   E+++K 
Sbjct:   19 NNIMVWNAVIFGPEGTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKMFHPNVYADGSICLDILQ-NRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKKV 129          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008817.1 (pep scaffold:Pmarinus_7.0:GL476329:1748443:1760143:-1 gene:ENSPMAG00000007968.1 transcript:ENSPMAT00000008817.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.559 bits (179), Expect = 7.143e-17
Identity = 33/111 (29.73%), Postives = 60/111 (54.05%), Query Frame = 2
Query:  230 NIFEWEGLLY-PKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKA 559
            NI  W  +++ P+  PF +  F++ L+F+E +P KPPT+   + ++HPNV   G +CL ++  N W P      I+     L+D+P+PN        + + +   E+++K 
Sbjct:   32 NIMLWNAVIFGPEGTPFEDGTFKLTLEFTEEYPNKPPTVKFVSKMFHPNVYADGSICLDILQ-NRWSPTYDVSSILTSIQSLLDEPNPNSPANSLAAQLYQENKREYEKKV 141          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010378.1 (pep scaffold:Pmarinus_7.0:GL477318:26908:31295:-1 gene:ENSPMAG00000009396.1 transcript:ENSPMAT00000010378.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.2478 bits (173), Expect = 4.083e-16
Identity = 29/117 (24.79%), Postives = 61/117 (52.14%), Query Frame = 2
Query:  230 NIFEWEG-LLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACK 577
            ++F W+  ++ P   P+    F + + F  ++PFKPP +   T IYHPN++  G +CL ++ +  W P +   +++     L+  P+P+  L  ++   +    +++ + AR+  C 
Sbjct:   30 DLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRS-QWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNKLARETICS 145          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Sea Lamprey
Match: ube2t (ubiquitin-conjugating enzyme E2T (putative) [Source:NCBI gene;Acc:768152])

HSP 1 Score: 71.2478 bits (173), Expect = 5.211e-16
Identity = 32/107 (29.91%), Postives = 55/107 (51.40%), Query Frame = 2
Query:  272 PFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINA---NNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNA 583
            P+    F + ++  + +PF+PP +T  TPIYHPN+D  G +CL ++       W+P +    ++    QL+ +P+P+  L  D+  EF      F   A+    K+A
Sbjct:   45 PYEGGIFSLEVQIPDRYPFEPPKVTFLTPIYHPNIDTAGRICLDILKMPPKGAWRPSLNVSTVLTSVQQLMGEPNPDDPLMPDISAEFKYNKPSFVSTAKSWTQKHA 151          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Yeast
Match: UBC11 (Ubiquitin-conjugating enzyme; most similar in sequence to Xenopus ubiquitin-conjugating enzyme E2-C, but not a true functional homolog of this E2; unlike E2-C, not required for the degradation of mitotic cyclin Clb2 [Source:SGD;Acc:S000005866])

HSP 1 Score: 82.4185 bits (202), Expect = 1.866e-20
Identity = 49/148 (33.11%), Postives = 77/148 (52.03%), Query Frame = 2
Query:  137 AATKRLSKEL-SVVKSKEEITSFFKITKADPSNIFEWEGLLY-PKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHAC 574
              TKRL  EL  ++ S  E  S F +   D +++  W G +  PK  P++   F+V LKF +N+PF PP I   +P++HPNVD+ G++CL ++    W  V   E I+     L+ +P+    L     E +    EE+++K    AC
Sbjct:    8 CVTKRLQNELLQLLSSTTESISAFPV---DDNDLTYWVGYITGPKDTPYSGLKFKVSLKFPQNYPFHPPMIKFLSPMWHPNVDKSGNICLDILK-EKWSAVYNVETILLSLQSLLGEPNNRSPLNAVAAELWDADMEEYRKKVL--AC 149          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Yeast
Match: UBC13 (E2 ubiquitin-conjugating enzyme; involved in the error-free DNA postreplication repair pathway; interacts with Mms2p to assemble ubiquitin chains at the Ub Lys-63 residue; DNA damage triggers redistribution from the cytoplasm to the nucleus [Source:SGD;Acc:S000002499])

HSP 1 Score: 75.8702 bits (185), Expect = 5.662e-18
Identity = 37/111 (33.33%), Postives = 60/111 (54.05%), Query Frame = 2
Query:  260 PKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNAKKK 592
            P+  P+ +  FE+ L   +++P + P +   T IYHPN+D  G +CL ++   NW P +Q   ++     L+  P+PN  L  D+ E++ K  +  K KAR+     AKKK
Sbjct:   42 PEQSPYEDGIFELELYLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEQGAKAKAREWTKLYAKKK 151          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Yeast
Match: UBC4 (Ubiquitin-conjugating enzyme (E2); key E2 partner with Ubc1p for the anaphase-promoting complex (APC); mediates degradation of abnormal or excess proteins, including calmodulin and histone H3; regulates levels of DNA Polymerase-{alpha} to promote efficient and accurate DNA replication; interacts with many SCF ubiquitin protein ligases; component of the cellular stress response; UBC4 has a paralog, UBC5, that arose from the whole genome duplication [Source:SGD;Acc:S000000286])

HSP 1 Score: 73.1738 bits (178), Expect = 6.459e-17
Identity = 39/151 (25.83%), Postives = 81/151 (53.64%), Query Frame = 2
Query:  134 MAATKRLSKELSVVKSKEEITSFFKITKADPSNIFEWEG-LLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNA 583
            M+++KR++KELS ++ ++  TS       D  +++ W+  ++ P   P+    F + + F  ++PFKPP I+  T IYHPN++  G++CL ++  + W P +   +++     L+   +P+  L  ++   +     +++  AR+   K A
Sbjct:    1 MSSSKRIAKELSDLE-RDPPTSCSAGPVGD--DLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIYHPNINANGNICLDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTDRPKYEATAREWTKKYA 147          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Yeast
Match: UBC5 (Ubiquitin-conjugating enzyme; mediates selective degradation of short-lived, abnormal, or excess proteins, including histone H3; central component of the cellular stress response; expression is heat inducible; protein abundance increases in response to DNA replication stress; UBC5 has a paralog, UBC4, that arose from the whole genome duplication [Source:SGD;Acc:S000002466])

HSP 1 Score: 70.0922 bits (170), Expect = 8.624e-16
Identity = 36/153 (23.53%), Postives = 78/153 (50.98%), Query Frame = 2
Query:  134 MAATKRLSKELSVVKSKEEITSFFKITKADP--SNIFEWEG-LLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNA 583
            M+++KR++KELS +      +       A P   +++ W+  ++ P   P+    F + + F  ++PFKPP +   T IYHPN++  G++CL ++  + W P +   +++     L+   +P+  L  ++ + +     +++  A++   K A
Sbjct:    1 MSSSKRIAKELSDLGRDPPAS-----CSAGPVGDDLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNFTTKIYHPNINSSGNICLDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAQIYKTDKAKYEATAKEWTKKYA 147          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Yeast
Match: UBC1 (Ubiquitin-conjugating enzyme; key E2 partner with Ubc4p for the anaphase-promoting complex (APC); mediates selective degradation of short-lived and abnormal proteins; plays a role in vesicle biogenesis and ER-associated protein degradation (ERAD); component of the cellular stress response; protein abundance increases in response to DNA replication stress key E2 partner with Ubc4p for the anaphase-promoting complex (APC) [Source:SGD;Acc:S000002584])

HSP 1 Score: 66.6254 bits (161), Expect = 4.470e-14
Identity = 39/144 (27.08%), Postives = 69/144 (47.92%), Query Frame = 2
Query:  134 MAATKRLSKELSVVKSKEEITSFFKITKADPSNIFEWEG-LLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDE-QGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKA 559
            M+  KR+ KE+  VK  ++  +   +     S+I   +G  L P   P+    F V ++    +PFKPP +   T +YHPN+    G +CL ++  N W PV+  +  +     L+  P+PN     ++ + + +  E F + A
Sbjct:    1 MSRAKRIMKEIQAVK--DDPAAHITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPMEYPFKPPKMQFDTKVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQHYLRDRESFNKTA 141          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Nematostella
Match: EDO33599 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRR4])

HSP 1 Score: 148.288 bits (373), Expect = 1.993e-45
Identity = 71/153 (46.41%), Postives = 98/153 (64.05%), Query Frame = 2
Query:  134 MAATKRLSKELSVVKSKEEITSFFKITKADPSNIFEWEGLLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNAKKK 592
            MAATKRL KEL  ++     T  F+  K D SNI  W+GL+ P+ PP+N+ AF + + F   +PFKPP IT KT IYHPN+DE+G VCL +I+  NWKP  + EQ+I+    L+  P+P H LR DL EE++K  ++F + A D   K  +K+
Sbjct:    1 MAATKRLGKELDELRKSG--TKTFRDVKVDESNILYWQGLIVPEMPPYNKGAFRIEICFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPIISPENWKPATKTEQVIQALLALVHDPEPEHPLRADLAEEYSKDKKKFMKNAEDCTKKYGEKR 151          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Nematostella
Match: EDO43669 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXR8])

HSP 1 Score: 72.7886 bits (177), Expect = 2.214e-16
Identity = 31/119 (26.05%), Postives = 63/119 (52.94%), Query Frame = 2
Query:  230 NIFEWEG-LLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNA 583
            ++F W+  ++ P   P+    F + + F  ++PFKPP ++  T IYHPN++  G +CL ++ +  W P +   +++     L+D P+P+  L  ++   F    +++   A++   K A
Sbjct:   29 DLFHWQATIMGPADSPYQGGVFFLTIHFPTDYPFKPPKVSFTTKIYHPNINSNGSICLDILRS-QWSPALTISKVLLSICSLMDDPNPDDPLVPEIARSFKTDRKKYNDMAKEWTRKYA 146          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Nematostella
Match: EDO28400 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6K6])

HSP 1 Score: 70.4774 bits (171), Expect = 8.133e-16
Identity = 33/114 (28.95%), Postives = 60/114 (52.63%), Query Frame = 2
Query:  251 LLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINA---NNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNA 583
            L+  +  P+++  F++ ++  E +PF+PP +   TPIYHPN+D  G +CL  +       WKP +    ++     L+ +P+P+  L  ++  EF     +F  KA++   K A
Sbjct:    4 LIGAEGTPYHKGIFKLDIQIPERYPFEPPKVRFVTPIYHPNIDSSGRICLDTLKMPPKGMWKPALNISSVLSTILILMAEPNPDDPLMAEISNEFKYNKAQFLEKAKEWTLKFA 117          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Nematostella
Match: EDO47887 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL90])

HSP 1 Score: 70.0922 bits (170), Expect = 8.218e-15
Identity = 33/114 (28.95%), Postives = 60/114 (52.63%), Query Frame = 2
Query:  251 LLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINA---NNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNA 583
            L+  +  P+++  F++ ++  E +PF+PP +   TPIYHPN+D  G +CL  +       WKP +    ++     L+ +P+P+  L  ++  EF     +F  KA++   K A
Sbjct:   39 LIGAEGTPYHKGIFKLDIQIPERYPFEPPKVRFVTPIYHPNIDSSGRICLDTLKMPPKGMWKPALNISSVLSTILILMAEPNPDDPLMAEISNEFKYNKAQFLEKAKEWTLKFA 152          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Nematostella
Match: EDO33975 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQR5])

HSP 1 Score: 69.3218 bits (168), Expect = 1.031e-14
Identity = 39/143 (27.27%), Postives = 72/143 (50.35%), Query Frame = 2
Query:  140 ATKRLSKELSVVKSKEEITSFFKITKADPSNIFEW-EGLLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARD 565
            A KR+ +EL+ + + +   +     K D   ++EW   +L P    +    F + + F  ++PFKPP IT +T IYH N++ QG +CL ++  ++W P +   +++     L+   +P   L G +  ++    EE    AR+
Sbjct:   40 AAKRIQRELAGI-TLDPPPNCSAGPKGD--KLYEWYSTILGPPGSVYEGGVFFLDIHFPTDYPFKPPKITFRTRIYHCNINSQGHICLDILK-DSWSPALTMSKVLLSICSLLTDCNPADPLVGSIATQYLTNREEHDNTARE 178          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Medaka
Match: ENSORLT00000021696.2 (ubiquitin conjugating enzyme E2 L3 [Source:NCBI gene;Acc:101169213])

HSP 1 Score: 140.198 bits (352), Expect = 2.165e-41
Identity = 64/153 (41.83%), Postives = 103/153 (67.32%), Query Frame = 2
Query:  134 MAATKRLSKELSVVKSKEEITSFFKITKADPSNIFEWEGLLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNAKKK 592
            MAA++RL+KEL  ++ +  + +F  I + + SN+  W+GL+ P +PP+++ AF + + F   +PFKPP IT KT IYHPN+DE+G VCL +I+A NWKP  + +Q+I+    L++ P P H LR DL EE++K  ++F + A +   K+ +K+
Sbjct:   36 MAASRRLAKELEEIR-RSGMKNFRNI-QVEESNLLSWQGLIVPDNPPYDKGAFRIEIIFPTEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFLKNAEEFTKKHGEKR 186          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Medaka
Match: ENSORLT00000000949.2 (ubiquitin-conjugating enzyme E2 L3 [Source:NCBI gene;Acc:101158291])

HSP 1 Score: 127.487 bits (319), Expect = 5.893e-37
Identity = 56/130 (43.08%), Postives = 85/130 (65.38%), Query Frame = 2
Query:  203 FKITKADPSNIFEWEGLLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNAKKK 592
            F+  +AD +NI  W+GL+ P  PP+++ AF + + F   +PFKPP I+ KT IYHPN+DE+G VCL +I+  NWKP  +  Q+I+    L++ P P H LR DL EE+TK   +F + A +   K+++K+
Sbjct:   15 FRNIQADEANILTWQGLIVPDCPPYDKGAFRIEIIFPAEYPFKPPKISFKTKIYHPNIDEKGQVCLPIISVENWKPATRTLQVIQCLIALVNTPQPEHPLRTDLAEEYTKDRAKFMKNAEEFTKKHSEKR 144          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Medaka
Match: ube2d4 (ubiquitin-conjugating enzyme E2 D4 [Source:NCBI gene;Acc:101172587])

HSP 1 Score: 75.485 bits (184), Expect = 6.372e-17
Identity = 40/151 (26.49%), Postives = 74/151 (49.01%), Query Frame = 2
Query:  140 ATKRLSKELSVVKSKEEITSFFKITKADP--SNIFEWEG-LLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNA 583
            A KR+ KELS ++             A P   ++F W+  ++ P   P+    F + + F  ++PFKPP +   T IYHPN++  G +CL ++ +  W P +   +++     L+  P+P+  L  ++   +    E++ + AR+   K A
Sbjct:    2 ALKRIQKELSDLQRDPPAQ-----CSAGPVGDDLFHWQATIMGPSDSPYQSGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRS-QWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNKLAREWTQKYA 146          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Medaka
Match: ube2b (ubiquitin conjugating enzyme E2 B [Source:NCBI gene;Acc:101172675])

HSP 1 Score: 75.0998 bits (183), Expect = 8.112e-17
Identity = 33/111 (29.73%), Postives = 60/111 (54.05%), Query Frame = 2
Query:  230 NIFEWEGLLY-PKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKA 559
            NI  W  +++ P   PF +  F++L++FSE +P KPPT+   + ++HPNV   G +CL ++  N W P      I+     L+D+P+PN        + + +   E++++ 
Sbjct:   32 NIMLWNAVIFGPVGTPFEDGTFKLLIEFSEEYPNKPPTVRFVSRMFHPNVYADGSICLDILQ-NRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKRV 141          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Medaka
Match: ENSORLT00000020581.2 (ubiquitin-conjugating enzyme E2 E1 [Source:NCBI gene;Acc:101156678])

HSP 1 Score: 75.8702 bits (185), Expect = 1.105e-16
Identity = 34/112 (30.36%), Postives = 60/112 (53.57%), Query Frame = 2
Query:  230 NIFEWEG-LLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKAR 562
            NI+EW   +L P    +    F + + F+ ++PFKPP +T +T IYH N++ QG +CL ++  +NW P +   +++     L+   +P   L G +  ++T    E  R A+
Sbjct:   76 NIYEWRSTILGPPGSVYEGGVFFLDIAFTPDYPFKPPKVTFRTRIYHCNINSQGVICLDILK-DNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYTTNRAEHDRTAK 186          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Planmine SMEST
Match: SMESG000069968.1 (SMESG000069968.1)

HSP 1 Score: 314.309 bits (804), Expect = 1.023e-110
Identity = 153/153 (100.00%), Postives = 153/153 (100.00%), Query Frame = 2
Query:  134 MAATKRLSKELSVVKSKEEITSFFKITKADPSNIFEWEGLLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNAKKK 592
            MAATKRLSKELSVVKSKEEITSFFKITKADPSNIFEWEGLLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNAKKK
Sbjct:    1 MAATKRLSKELSVVKSKEEITSFFKITKADPSNIFEWEGLLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNAKKK 153          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Planmine SMEST
Match: SMESG000059431.1 (SMESG000059431.1)

HSP 1 Score: 157.147 bits (396), Expect = 1.436e-48
Identity = 69/153 (45.10%), Postives = 105/153 (68.63%), Query Frame = 2
Query:  134 MAATKRLSKELSVVKSKEEITSFFKITKADPSNIFEWEGLLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNAKKK 592
            M+A++R+ KELS +++K E+   F+  + D  NI  W+GL+ P++PP+N+ AF+V + F   +PFKPP IT+KT IYHPNVDE+G +C+ +I   NWKP  + EQ+I+    +I  PD +HFLR D+ EEFTK  + F + A ++  K A+K+
Sbjct:    1 MSASRRIQKELSDIQNKPEVQKCFREIQVDDKNILVWQGLIVPENPPYNKGAFKVQIDFPVEYPFKPPKITIKTKIYHPNVDEKGQICMPIITPENWKPATKIEQVIQNLVAMIHDPDADHFLRADVAEEFTKNKQIFMKNAEEYTKKYAEKR 153          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Planmine SMEST
Match: SMESG000048377.1 (SMESG000048377.1)

HSP 1 Score: 73.559 bits (179), Expect = 2.975e-16
Identity = 40/147 (27.21%), Postives = 72/147 (48.98%), Query Frame = 2
Query:  128 FSMAATKRLSKELSVVKSKEEITSFFKITKADPSNIFEWEG-LLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARD 565
             S  A +RL  +  V   KE     + +   D  NI  W G +L P   PF +  F++ ++F E++P KPP +   + ++HPN+   G++CL ++  N W P      ++     L+  P+PN     +  + +   N E+++K R+
Sbjct:    1 MSTKARRRLMNDF-VKLQKEPPPGVYAVPTED--NIMLWRGVILGPYGTPFEDGVFKLSMEFKEDYPHKPPNVKFISRMFHPNIYTDGNICLDILQ-NMWSPSFDICAVLTSLQSLLGDPNPNSPANANAAQLYEHHNVEYRKKVRE 143          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Planmine SMEST
Match: SMESG000081859.1 (SMESG000081859.1)

HSP 1 Score: 72.7886 bits (177), Expect = 2.016e-15
Identity = 46/151 (30.46%), Postives = 74/151 (49.01%), Query Frame = 2
Query:  119 RSLFSMAATKRLSKELSVVKSKEEITSFFKITKADP--SNIFEWEG-LLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKAR 562
            R     +A KR+ KEL     ++ I        A+P   N+F W G LL P    +    F + + F  ++PFKPP I  K  IYH NV+  G +CL ++  NNW P++   +I+     L+   +P+  L G + +++    +E  + AR
Sbjct:   29 RPTLHDSALKRIQKEL-----QDFIKDPPPNCSAEPIDGNLFHWNGTLLGPVGSVYEGGIFFLDIGFPSDYPFKPPKIAFKNRIYHCNVNSVGTICLDIL-KNNWSPILNVGKILLSICSLMCDCNPDDPLVGYIAKQYIHNRKEHDKTAR 173          
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Planmine SMEST
Match: SMESG000064169.1 (SMESG000064169.1)

HSP 1 Score: 70.8626 bits (172), Expect = 2.191e-15
Identity = 31/119 (26.05%), Postives = 63/119 (52.94%), Query Frame = 2
Query:  230 NIFEWEG-LLYPKSPPFNEFAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNA 583
            ++F W+  ++ P   P++   F + ++F  ++PFKPP +T  T IYHPN++  G +CL ++    W P +   +++     L+  P+P+  L  ++   +    +++   A+D   K A
Sbjct:   29 DLFHWQATIMGPNDSPYDGGVFFLDIQFPTDYPFKPPKVTFTTKIYHPNINANGSICLDILRG-QWSPALTISKVLLSICSLLTDPNPDDPLVPEIARIYKNDRKKYNDTAQDWTRKYA 146          
The following BLAST results are available for this feature:
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
UBE2L31.114e-4042.48ubiquitin conjugating enzyme E2 L3 [Source:HGNC Sy... [more]
UBE2L51.202e-4042.48ubiquitin conjugating enzyme E2 L5 [Source:HGNC Sy... [more]
UBE2L51.202e-4042.48ubiquitin conjugating enzyme E2 L5 [Source:HGNC Sy... [more]
UBE2L51.202e-4042.48ubiquitin conjugating enzyme E2 L5 [Source:HGNC Sy... [more]
UBE2L31.095e-3642.31ubiquitin conjugating enzyme E2 L3 [Source:HGNC Sy... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ubc-181.010e-3839.87UBiquitin Conjugating enzyme [Source:UniProtKB/Tr... [more]
ubc-11.513e-1627.34Ubiquitin-conjugating enzyme E2 1 [Source:UniProt... [more]
let-706.975e-1526.05Ubiquitin-conjugating enzyme E2 2 [Source:UniProt... [more]
ubc-139.717e-1228.71Ubiquitin-conjugating enzyme E2 13 [Source:UniPro... [more]
uev-24.319e-1127.88Ubiquitin E2 (Conjugating enzyme) variant [Source... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ubc102.457e-4243.79gene:FBgn0026316 transcript:FBtr0089553[more]
Ubc84D3.250e-4142.86gene:FBgn0017456 transcript:FBtr0081552[more]
CG170308.861e-2430.53gene:FBgn0035584 transcript:FBtr0073374[more]
Ubc21.035e-1630.67gene:FBgn0015320 transcript:FBtr0080115[more]
Ubc21.035e-1630.67gene:FBgn0015320 transcript:FBtr0345437[more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ube2l3a1.254e-4243.04ubiquitin-conjugating enzyme E2L 3a [Source:ZFIN;A... [more]
ube2l3a1.254e-4243.04ubiquitin-conjugating enzyme E2L 3a [Source:ZFIN;A... [more]
ube2l3a1.479e-4243.79ubiquitin-conjugating enzyme E2L 3a [Source:ZFIN;A... [more]
ube2l3b3.881e-4243.79ubiquitin-conjugating enzyme E2L 3b [Source:ZFIN;A... [more]
ube2l3b3.640e-3843.85ubiquitin-conjugating enzyme E2L 3b [Source:ZFIN;A... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
themis3.099e-4143.14thymocyte selection associated [Source:Xenbase;Acc... [more]
themis8.517e-3742.31thymocyte selection associated [Source:Xenbase;Acc... [more]
chmp2b3.198e-1727.15charged multivesicular body protein 2B [Source:Xen... [more]
eif2s21.148e-1626.85eukaryotic translation initiation factor 2 subunit... [more]
tep11.210e-1628.83telomerase associated protein 1 [Source:Xenbase;Ac... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ube2l37.647e-4142.48ubiquitin-conjugating enzyme E2L 3 [Source:MGI Sym... [more]
Ube2l37.647e-4142.48ubiquitin-conjugating enzyme E2L 3 [Source:MGI Sym... [more]
Ube2l36.008e-3944.53ubiquitin-conjugating enzyme E2L 3 [Source:MGI Sym... [more]
Ube2l31.801e-3043.36ubiquitin-conjugating enzyme E2L 3 [Source:MGI Sym... [more]
Ube2l61.071e-2937.16ubiquitin-conjugating enzyme E2L 6 [Source:MGI Sym... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7K738|UBC10_DROME2.463e-4143.79Ubiquitin-conjugating enzyme E2-18 kDa OS=Drosophi... [more]
sp|P52487|UBC84_DROME3.258e-4042.86Ubiquitin-conjugating enzyme E2-18 kDa OS=Drosophi... [more]
sp|Q5R5I4|UB2L3_PONAB3.621e-4042.48Ubiquitin-conjugating enzyme E2 L3 OS=Pongo abelii... [more]
sp|P68037|UB2L3_MOUSE5.349e-4042.48Ubiquitin-conjugating enzyme E2 L3 OS=Mus musculus... [more]
sp|P68036|UB2L3_HUMAN5.349e-4042.48Ubiquitin-conjugating enzyme E2 L3 OS=Homo sapiens... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210QTU78.300e-4952.29Ubiquitin-conjugating enzyme E2 L3 OS=Mizuhopecten... [more]
A0A1D1W5S03.828e-4547.71UBIQUITIN_CONJUGAT_2 domain-containing protein OS=... [more]
A0A2P2I1I82.226e-4347.06Ubiquitin-conjugating enzyme E2 L3-like OS=Hironde... [more]
T1JMF03.401e-4346.41UBIQUITIN_CONJUGAT_2 domain-containing protein OS=... [more]
A0A3M7T8K34.039e-4345.75Ubiquitin-conjugating enzyme E2 L3 OS=Brachionus p... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ube2l3b6.059e-4343.14ubiquitin conjugating enzyme E2 L3 [Source:NCBI ge... [more]
ube2l3a2.857e-4243.79ubiquitin-conjugating enzyme E2 L3 [Source:NCBI ge... [more]
ube2l3b1.364e-3844.62ubiquitin conjugating enzyme E2 L3 [Source:NCBI ge... [more]
ube2d1a1.317e-1727.15ubiquitin-conjugating enzyme E2 D4-like [Source:NC... [more]
ube2d1b3.349e-1727.15ubiquitin conjugating enzyme E2 D1 [Source:NCBI ge... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ube2l3a7.304e-3943.48ubiquitin-conjugating enzyme E2L 3a [Source:ZFIN;A... [more]
ENSPMAT00000006211.13.832e-1728.57pep scaffold:Pmarinus_7.0:GL476897:3176:4886:1 gen... [more]
ENSPMAT00000008817.17.143e-1729.73pep scaffold:Pmarinus_7.0:GL476329:1748443:1760143... [more]
ENSPMAT00000010378.14.083e-1624.79pep scaffold:Pmarinus_7.0:GL477318:26908:31295:-1 ... [more]
ube2t5.211e-1629.91ubiquitin-conjugating enzyme E2T (putative) [Sourc... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
UBC111.866e-2033.11Ubiquitin-conjugating enzyme; most similar in sequ... [more]
UBC135.662e-1833.33E2 ubiquitin-conjugating enzyme; involved in the e... [more]
UBC46.459e-1725.83Ubiquitin-conjugating enzyme (E2); key E2 partner ... [more]
UBC58.624e-1623.53Ubiquitin-conjugating enzyme; mediates selective d... [more]
UBC14.470e-1427.08Ubiquitin-conjugating enzyme; key E2 partner with ... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO335991.993e-4546.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436692.214e-1626.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO284008.133e-1628.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478878.218e-1528.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339751.031e-1427.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000021696.22.165e-4141.83ubiquitin conjugating enzyme E2 L3 [Source:NCBI ge... [more]
ENSORLT00000000949.25.893e-3743.08ubiquitin-conjugating enzyme E2 L3 [Source:NCBI ge... [more]
ube2d46.372e-1726.49ubiquitin-conjugating enzyme E2 D4 [Source:NCBI ge... [more]
ube2b8.112e-1729.73ubiquitin conjugating enzyme E2 B [Source:NCBI gen... [more]
ENSORLT00000020581.21.105e-1630.36ubiquitin-conjugating enzyme E2 E1 [Source:NCBI ge... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 L3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069968.11.023e-110100.00SMESG000069968.1[more]
SMESG000059431.11.436e-4845.10SMESG000059431.1[more]
SMESG000048377.12.975e-1627.21SMESG000048377.1[more]
SMESG000081859.12.016e-1530.46SMESG000081859.1[more]
SMESG000064169.12.191e-1526.05SMESG000064169.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029139 ID=SMED30029139|Name=Ubiquitin-conjugating enzyme E2 L3|organism=Schmidtea mediterranea sexual|type=transcript|length=677bp
CATTTATTGAATTTTCATTTGAAAATATTATTTTTTAACAGATAATTAAT
GGTGTTTGAAATACACATTGTTTATTTATATTAAAATCAAATAACAGGAA
TAATTTCAAGGTTAATCAAGATCCTTATTTTCAATGGCTGCAACTAAAAG
ACTGTCTAAAGAACTATCTGTCGTTAAAAGTAAAGAAGAAATTACAAGCT
TTTTTAAGATAACAAAAGCTGATCCTAGTAATATTTTTGAATGGGAAGGA
TTACTATATCCGAAATCACCACCATTTAATGAATTTGCCTTTGAGGTTTT
ACTTAAATTTTCTGAGAATCACCCATTTAAGCCACCAACTATTACAATGA
AAACACCAATTTACCATCCAAATGTAGATGAACAAGGCGATGTTTGTTTG
GCTTTAATTAATGCTAACAATTGGAAGCCTGTAGTTCAAGCTGAGCAAAT
TATCAAAGAATTTGCACAGTTAATTGATAAACCGGATCCCAACCATTTTT
TGCGAGGAGATCTCGGGGAAGAGTTTACCAAGCGTAATGAGGAGTTTAAG
AGAAAAGCGAGGGATCATGCATGCAAAAATGCTAAAAAGAAATAGACAAT
TAGTAAAATTTGATGATCGATAAAATTTCGATAACAATAAAATTTATTTG
AATACAATTATGGTTTTAGTAAAAAAA
back to top

protein sequence of SMED30029139-orf-1

>SMED30029139-orf-1 ID=SMED30029139-orf-1|Name=SMED30029139-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=154bp
MAATKRLSKELSVVKSKEEITSFFKITKADPSNIFEWEGLLYPKSPPFNE
FAFEVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALINANNWKPV
VQAEQIIKEFAQLIDKPDPNHFLRGDLGEEFTKRNEEFKRKARDHACKNA
KKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016740transferase activity
GO:0000166nucleotide binding
GO:0005524ATP binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000484secretory system
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000608UBQ-conjugat_E2
IPR016135UBQ-conjugating_enzyme/RWD
IPR023313UBQ-conjugating_AS
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSMARTSM00212ubc_7coord: 5..151
e-value: 7.0E-32
score: 121.9
NoneNo IPR availablePANTHERPTHR24068:SF170UBIQUITIN-CONJUGATING ENZYME E2 L5coord: 1..152
NoneNo IPR availablePANTHERPTHR24068FAMILY NOT NAMEDcoord: 1..152
IPR000608Ubiquitin-conjugating enzyme E2PFAMPF00179UQ_concoord: 6..145
e-value: 1.8E-31
score: 108.6
IPR000608Ubiquitin-conjugating enzyme E2PROSITEPS50127UBIQUITIN_CONJUGAT_2coord: 5..140
score: 25.344
IPR000608Ubiquitin-conjugating enzyme E2CDDcd00195UBCccoord: 4..146
e-value: 2.52143E-34
score: 114.992
IPR016135Ubiquitin-conjugating enzyme/RWD-likeGENE3DG3DSA:3.10.110.10coord: 1..153
e-value: 7.4E-39
score: 134.9
IPR016135Ubiquitin-conjugating enzyme/RWD-likeSUPERFAMILYSSF54495UBC-likecoord: 2..151
IPR023313Ubiquitin-conjugating enzyme, active sitePROSITEPS00183UBIQUITIN_CONJUGAT_1coord: 77..92