SMED30029137

Overview
NameSMED30029137
Smed IDSMED30029137
Length (bp)1053
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30029137 (SMED30029137) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30029137 (SMED30029137) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30029137 (SMED30029137) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30029137 (SMED30029137) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029137

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30029137h1SMcG0015208 Contig2223GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30029137h1SMcG0015208 dd_Smed_v4_3432_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30029137h1SMcG0015208 dd_Smed_v4_3432_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30029137h1SMcG0015208 dd_Smed_v4_3432_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029137h1SMcG0015208 Contig41652newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029137h1SMcG0015208 Contig41652uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30029137 vs. Ensembl Human
Match: SCUBE1 (signal peptide, CUB domain and EGF like domain containing 1 [Source:HGNC Symbol;Acc:HGNC:13441])

HSP 1 Score: 65.0846 bits (157), Expect = 8.359e-11
Identity = 45/148 (30.41%), Postives = 61/148 (41.22%), Query Frame = 2
Query:  113 CLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSINCTE----CPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTFANFSKSIKCTKCQPNY-----FNRNEGQQSCIKCPAGTDQKKSGSTSCLLC 529
            C++C PG+        C  C PG Y D   + +CT CP      + G+ N +E    C PG FS   G K C  CP G++    G T C  C  G       +     C+         + N     CI+CP GT Q + G   C+ C
Sbjct:  630 CVACGPGTHFGGELGQCVSCMPGTYQDMEGQLSCTPCPSSDGLGLPGARNVSECGGQCSPGFFS-ADGFKPCQACPVGTYQPEPGRTGCFPCGGGLLTKHEGTTSFQDCEAKVHCSPGHHYNTTTHRCIRCPVGTYQPEFGQNHCITC 776          
BLAST of SMED30029137 vs. Ensembl Human
Match: SVEP1 (sushi, von Willebrand factor type A, EGF and pentraxin domain containing 1 [Source:HGNC Symbol;Acc:HGNC:15985])

HSP 1 Score: 56.9954 bits (136), Expect = 3.818e-8
Identity = 44/168 (26.19%), Postives = 69/168 (41.07%), Query Frame = 2
Query:   95 TVLGYVCLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSIN--------------------CTECPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCW-PGTFANFSKS--IKCTKCQPNYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLC 529
             + G +C++CP G++ +     C  C  G Y D+  +  C  CP G ++    S N                    C  CP G +    GS++C  CP  + +   G+ N + C  P     FS+S  + C  C  +Y+  N G+  C+ CP       +GS S   C
Sbjct:  993 VLRGRMCVNCPLGTYYNLEHFTCESCRIGSYQDEEGQLECKLCPSGMYTEYIHSRNISDCKAQCKQGTYSYSGLETCESCPLGTYQPKFGSRSCLSCPENTSTVKRGAVNISACGVPCPEGKFSRSGLMPCHPCPRDYYQPNAGKAFCLACPFYGTTPFAGSRSITEC 1160          
BLAST of SMED30029137 vs. Ensembl Human
Match: SVEP1 (sushi, von Willebrand factor type A, EGF and pentraxin domain containing 1 [Source:HGNC Symbol;Acc:HGNC:15985])

HSP 1 Score: 56.9954 bits (136), Expect = 3.886e-8
Identity = 44/168 (26.19%), Postives = 69/168 (41.07%), Query Frame = 2
Query:   95 TVLGYVCLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSIN--------------------CTECPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCW-PGTFANFSKS--IKCTKCQPNYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLC 529
             + G +C++CP G++ +     C  C  G Y D+  +  C  CP G ++    S N                    C  CP G +    GS++C  CP  + +   G+ N + C  P     FS+S  + C  C  +Y+  N G+  C+ CP       +GS S   C
Sbjct:  993 VLRGRMCVNCPLGTYYNLEHFTCESCRIGSYQDEEGQLECKLCPSGMYTEYIHSRNISDCKAQCKQGTYSYSGLETCESCPLGTYQPKFGSRSCLSCPENTSTVKRGAVNISACGVPCPEGKFSRSGLMPCHPCPRDYYQPNAGKAFCLACPFYGTTPFAGSRSITEC 1160          
BLAST of SMED30029137 vs. Ensembl Human
Match: SCUBE3 (signal peptide, CUB domain and EGF like domain containing 3 [Source:HGNC Symbol;Acc:HGNC:13655])

HSP 1 Score: 53.5286 bits (127), Expect = 4.255e-7
Identity = 47/169 (27.81%), Postives = 64/169 (37.87%), Query Frame = 2
Query:  104 GYVCLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSINCT----ECPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNC-----------------------TVCWPGTFANFSKSIKCTKCQPNYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLC 529
            G  C+SCP G++    T  C  C  G + +   + +C  CP        G+ N T    +CPPG  S   G K C  CP G++    G T C                         C PG + N S   +C +C    +  +  Q  C +CP  T     GSTS   C
Sbjct:  633 GTKCVSCPQGTYYHGQTEQCVPCPAGTFQEREGQLSCDLCPGSDAHGPLGATNVTTCAGQCPPGQHS-VDGFKPCQPCPRGTYQPEAGRTLCFPCGGGLTTKHEGAISFQDCDTKVQCSPGHYYNTSIH-RCIRCAMGSYQPDFRQNFCSRCPGNTSTDFDGSTSVAQC 799          
BLAST of SMED30029137 vs. Ensembl Human
Match: SCUBE2 (signal peptide, CUB domain and EGF like domain containing 2 [Source:HGNC Symbol;Acc:HGNC:30425])

HSP 1 Score: 51.6026 bits (122), Expect = 1.648e-6
Identity = 45/152 (29.61%), Postives = 66/152 (43.42%), Query Frame = 2
Query:  113 CLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQ-GTFSNIK--GSINCTE----CPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGT------FANFSKSIKCTKCQPNYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLC 529
            C+SC  G++ D     C LC  G + ++  +  C  CP+ G    +K   + N +E    C PG +S   G   C  C  G+F    G T+C  C  G         +F       +C P +F  N     CI+CP GT Q + G  +C+ C
Sbjct:  667 CVSCRAGTYYDGARERCILCPNGTFQNEEGQMTCEPCPRPGNSGALKTPEAWNMSECGGLCQPGEYS-ADGFAPCQLCALGTFQPEAGRTSCFPCGGGLATKHQGATSFQDCETRVQCSPGHF-YNTTTHRCIRCPVGTYQPEFGKNNCVSC 816          
BLAST of SMED30029137 vs. Ensembl Celegans
Match: clec-78 (C-type LECtin [Source:UniProtKB/TrEMBL;Acc:Q20531])

HSP 1 Score: 64.3142 bits (155), Expect = 5.590e-11
Identity = 49/161 (30.43%), Postives = 74/161 (45.96%), Query Frame = 2
Query:  113 CLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGS--------------------INCTECPPGLFSNTT---GSKNCTQCPPGSFSNTTGSTNCT----VCWPGTFANFSKSIKCTKCQPNYFNRNEGQQSCIKCPAGTDQKKSGST 514
            C++CP GS   N    C LC  G Y D+  +T+C  CP GT++  +GS                    I C  CP   FS      G + C  CP G+++   G+++ +     C  GT++N S    C+ C  N++    GQQSCI+C   T  + +G +
Sbjct: 1850 CMACPSGSV--NINNTCMLCPRGSYQDESGETSCKPCPDGTYTLDEGSQSVGSCLAICGFGMYSSTGLIPCQLCPRHTFSGAAPIGGFRECEACPSGAYTAKLGASSASECKQACKTGTYSN-SGLEPCSACPINFYQPTVGQQSCIECSNTTATQTTGES 2007          

HSP 2 Score: 50.0618 bits (118), Expect = 2.262e-6
Identity = 60/237 (25.32%), Postives = 89/237 (37.55%), Query Frame = 2
Query:   95 TVLGYVCLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSINCTE----CPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPG--TFANFSKSIK-----------------CTKCQPNYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLCXXXXXXXXXXXXCLPCKYGYFAAIAGNIKCYICPAGFYCQYANEIPTSC----PKHYTCPQGSIYPKSC 724
             V+  +C+ C PG++    T  C LC  G Y     +T C +C  G  +  +G+I+  E    CPPG   ++  S +C  C  G +  + G+  C  C  G  T + F+ S                   C  CQ   +      + C+ CP GT  + + ST    C   K           CK G F  +     C  CP G +     E  ++C    P H T   G+     C
Sbjct: 3069 VVVRDLCVPCAPGTYHSAATGECELCPIGEYQPLTARTECFKCAPGQITASEGAISEGECKDNCPPGHQYDSLTS-DCVTCGYGYYQPSAGAFECIPCGIGKTTLSEFATSEDECRDECPDGEQLSASGVCQPCQIGTYRSRGENKKCVACPPGTTTEATMSTRREQCNTPK-----------CKPGQF-LVKETKNCQFCPRGTFQNEEQE--STCKLCAPDHTTAAPGATAESQC 3290          
BLAST of SMED30029137 vs. Ensembl Celegans
Match: F58E6.13 (pep chromosome:WBcel235:V:9745240:9749228:1 gene:WBGene00077697.1 transcript:F58E6.13c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F58E6.13)

HSP 1 Score: 53.9138 bits (128), Expect = 7.546e-8
Identity = 49/179 (27.37%), Postives = 65/179 (36.31%), Query Frame = 2
Query:  113 CLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSINCTE----CPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTFANFSKSIKCTKCQPNYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLCXXXXXXXXXXXXCLPCKYGYFAAIAGNIKCYICPAG 637
            C  C PG+  D     C  C  G + D+  +T C  CP  T +   G+    +    CP G F +T+ SK C  C    +   +G   C  C  GT              P Y N         KC AG  +   GST                 C PC  G F + A ++ C +CP G
Sbjct:  178 CRLCTPGTMYDEVDEKCVPCPRGEFQDEHGRTTCKTCPDSTTTVGTGTQKKEQCVHVCPSGYFYDTS-SKMCETCGLRGYQPKSGQDRCIPCPDGTV-------------PIYQNSTTIGHCLDKCRAGMQRSSDGST-----------------CEPCPIGSFKS-ADDMVCMMCPTG 324          
BLAST of SMED30029137 vs. Ensembl Celegans
Match: F58E6.13 (pep chromosome:WBcel235:V:9745657:9749228:1 gene:WBGene00077697.1 transcript:F58E6.13d.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F58E6.13)

HSP 1 Score: 53.1434 bits (126), Expect = 1.237e-7
Identity = 52/192 (27.08%), Postives = 70/192 (36.46%), Query Frame = 2
Query:   77 YCF-GILTVLGYVCLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSINCTE----CPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTFANFSKSIKCTKCQPNYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLCXXXXXXXXXXXXCLPCKYGYFAAIAGNIKCYICPAG 637
            +C+ G   V    C  C PG+  D     C  C  G + D+  +T C  CP  T +   G+    +    CP G F +T+ SK C  C    +   +G   C  C  GT              P Y N         KC AG  +   GST                 C PC  G F + A ++ C +CP G
Sbjct:  109 FCYRGATLVDTDKCRLCTPGTMYDEVDEKCVPCPRGEFQDEHGRTTCKTCPDSTTTVGTGTQKKEQCVHVCPSGYFYDTS-SKMCETCGLRGYQPKSGQDRCIPCPDGTV-------------PIYQNSTTIGHCLDKCRAGMQRSSDGST-----------------CEPCPIGSFKS-ADDMVCMMCPTG 268          
BLAST of SMED30029137 vs. Ensembl Fly
Match: uif (gene:FBgn0031879 transcript:FBtr0307072)

HSP 1 Score: 61.6178 bits (148), Expect = 5.699e-10
Identity = 58/206 (28.16%), Postives = 92/206 (44.66%), Query Frame = 2
Query:  113 CLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGS--------------------INCTECPPGLFSN---TTGSKNCTQCPPGSFSNTTGSTNCTVCW----PGTFANFSKSIKCTKCQPNYFNRNEGQQSCIKCPAG--TDQKKS-GSTSCLLCXXXXXXXXXXXXCLPCKYGYFAAIAGNIKCYICPAGF 640
            CL CP G+++     +CT C  G+Y +   +  C  CP GT++  +G+                    + C ECP   F+    T G K+C  CP  SF+    ++N  +C     PGT++    +  C+ C  +++    G QSC +CP+   TD   S G   C     G+   + G  C+P        +  +I+C+ CPAGF
Sbjct: 1856 CLHCPAGTYVSEGQNSCTYCPRGYYQNRDRQGTCLRCPAGTYTKEEGTKSQADCIPVCGYGTYSPTGLVPCLECPRNSFTAEPPTGGFKDCQACPAQSFTYQPAASNKDLCRAKCAPGTYSATGLA-PCSPCPLHHYQGAAGAQSCNECPSNMRTDSPASKGREQCKPVVCGEGACQHGGLCVP--------MGHDIQCF-CPAGF 2051          
BLAST of SMED30029137 vs. Ensembl Fly
Match: uif (gene:FBgn0031879 transcript:FBtr0302162)

HSP 1 Score: 61.6178 bits (148), Expect = 5.699e-10
Identity = 58/206 (28.16%), Postives = 92/206 (44.66%), Query Frame = 2
Query:  113 CLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGS--------------------INCTECPPGLFSN---TTGSKNCTQCPPGSFSNTTGSTNCTVCW----PGTFANFSKSIKCTKCQPNYFNRNEGQQSCIKCPAG--TDQKKS-GSTSCLLCXXXXXXXXXXXXCLPCKYGYFAAIAGNIKCYICPAGF 640
            CL CP G+++     +CT C  G+Y +   +  C  CP GT++  +G+                    + C ECP   F+    T G K+C  CP  SF+    ++N  +C     PGT++    +  C+ C  +++    G QSC +CP+   TD   S G   C     G+   + G  C+P        +  +I+C+ CPAGF
Sbjct: 1856 CLHCPAGTYVSEGQNSCTYCPRGYYQNRDRQGTCLRCPAGTYTKEEGTKSQADCIPVCGYGTYSPTGLVPCLECPRNSFTAEPPTGGFKDCQACPAQSFTYQPAASNKDLCRAKCAPGTYSATGLA-PCSPCPLHHYQGAAGAQSCNECPSNMRTDSPASKGREQCKPVVCGEGACQHGGLCVP--------MGHDIQCF-CPAGF 2051          
BLAST of SMED30029137 vs. Ensembl Fly
Match: uif (gene:FBgn0031879 transcript:FBtr0307074)

HSP 1 Score: 61.6178 bits (148), Expect = 5.699e-10
Identity = 58/206 (28.16%), Postives = 92/206 (44.66%), Query Frame = 2
Query:  113 CLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGS--------------------INCTECPPGLFSN---TTGSKNCTQCPPGSFSNTTGSTNCTVCW----PGTFANFSKSIKCTKCQPNYFNRNEGQQSCIKCPAG--TDQKKS-GSTSCLLCXXXXXXXXXXXXCLPCKYGYFAAIAGNIKCYICPAGF 640
            CL CP G+++     +CT C  G+Y +   +  C  CP GT++  +G+                    + C ECP   F+    T G K+C  CP  SF+    ++N  +C     PGT++    +  C+ C  +++    G QSC +CP+   TD   S G   C     G+   + G  C+P        +  +I+C+ CPAGF
Sbjct: 1856 CLHCPAGTYVSEGQNSCTYCPRGYYQNRDRQGTCLRCPAGTYTKEEGTKSQADCIPVCGYGTYSPTGLVPCLECPRNSFTAEPPTGGFKDCQACPAQSFTYQPAASNKDLCRAKCAPGTYSATGLA-PCSPCPLHHYQGAAGAQSCNECPSNMRTDSPASKGREQCKPVVCGEGACQHGGLCVP--------MGHDIQCF-CPAGF 2051          
BLAST of SMED30029137 vs. Ensembl Fly
Match: uif (gene:FBgn0031879 transcript:FBtr0307073)

HSP 1 Score: 61.6178 bits (148), Expect = 5.699e-10
Identity = 58/206 (28.16%), Postives = 92/206 (44.66%), Query Frame = 2
Query:  113 CLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGS--------------------INCTECPPGLFSN---TTGSKNCTQCPPGSFSNTTGSTNCTVCW----PGTFANFSKSIKCTKCQPNYFNRNEGQQSCIKCPAG--TDQKKS-GSTSCLLCXXXXXXXXXXXXCLPCKYGYFAAIAGNIKCYICPAGF 640
            CL CP G+++     +CT C  G+Y +   +  C  CP GT++  +G+                    + C ECP   F+    T G K+C  CP  SF+    ++N  +C     PGT++    +  C+ C  +++    G QSC +CP+   TD   S G   C     G+   + G  C+P        +  +I+C+ CPAGF
Sbjct: 1856 CLHCPAGTYVSEGQNSCTYCPRGYYQNRDRQGTCLRCPAGTYTKEEGTKSQADCIPVCGYGTYSPTGLVPCLECPRNSFTAEPPTGGFKDCQACPAQSFTYQPAASNKDLCRAKCAPGTYSATGLA-PCSPCPLHHYQGAAGAQSCNECPSNMRTDSPASKGREQCKPVVCGEGACQHGGLCVP--------MGHDIQCF-CPAGF 2051          
BLAST of SMED30029137 vs. Ensembl Fly
Match: uif (gene:FBgn0031879 transcript:FBtr0339664)

HSP 1 Score: 61.6178 bits (148), Expect = 6.115e-10
Identity = 58/206 (28.16%), Postives = 92/206 (44.66%), Query Frame = 2
Query:  113 CLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGS--------------------INCTECPPGLFSN---TTGSKNCTQCPPGSFSNTTGSTNCTVCW----PGTFANFSKSIKCTKCQPNYFNRNEGQQSCIKCPAG--TDQKKS-GSTSCLLCXXXXXXXXXXXXCLPCKYGYFAAIAGNIKCYICPAGF 640
            CL CP G+++     +CT C  G+Y +   +  C  CP GT++  +G+                    + C ECP   F+    T G K+C  CP  SF+    ++N  +C     PGT++    +  C+ C  +++    G QSC +CP+   TD   S G   C     G+   + G  C+P        +  +I+C+ CPAGF
Sbjct: 1856 CLHCPAGTYVSEGQNSCTYCPRGYYQNRDRQGTCLRCPAGTYTKEEGTKSQADCIPVCGYGTYSPTGLVPCLECPRNSFTAEPPTGGFKDCQACPAQSFTYQPAASNKDLCRAKCAPGTYSATGLA-PCSPCPLHHYQGAAGAQSCNECPSNMRTDSPASKGREQCKPVVCGEGACQHGGLCVP--------MGHDIQCF-CPAGF 2051          
BLAST of SMED30029137 vs. Ensembl Zebrafish
Match: si:dkey-21a6.5 (si:dkey-21a6.5 [Source:ZFIN;Acc:ZDB-GENE-131121-257])

HSP 1 Score: 112.079 bits (279), Expect = 7.749e-28
Identity = 79/260 (30.38%), Postives = 119/260 (45.77%), Query Frame = 2
Query:  113 CLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSINCTECPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTFANFSKSIKCTKC-QPNYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLCXXXXXXXXXXXXCLPCKYGYFAAIAGNIKCYICPAGFYCQYANEIPTSCPKHYTCPQGSIYPKSCGPLLQGTNTPSCTPSVELIVLICVTSIVALFVIVIIIYAIRKKRGRYLYRGLSNT 889
            C +C PGS+ DN T  C+ C         +   C  C  G +  + G   C  C  G +SN+TG+  C  CP G +SN TGS +C  C PG +++   S  C  C Q +Y N +   Q C  CPAG++  ++ S  C LC+ G +     + C  C  G++    G   C +CP   YC   +  P  CP    CP+GS  P  C          +C  +   I L+ +   V L  I++++  +R++R       L+ T
Sbjct:   58 CAACAPGSYYDNETLLCSCCP--DVGMCVSPEACLLCLPGFYQPLAGRQRCLPCSSGFYSNSTGNTVCQACPAGFYSNNTGSVSCRPCAPGFYSSSRNSTLCNPCPQGSYCNSSSCTQ-CPICPAGSEALQTASKECTLCRPGMHKPSYQSMCQICSSGFYQIRWGQENCDLCPENHYCPSPDVNPIQCPADAFCPEGSSAPGYCMETFFRKAGETCELAPVTIALLVIGGGVGLLFIIVLV--LRRRRDNDSELSLART 312          
BLAST of SMED30029137 vs. Ensembl Zebrafish
Match: scube1 (signal peptide, CUB domain, EGF-like 1 [Source:ZFIN;Acc:ZDB-GENE-050302-78])

HSP 1 Score: 63.929 bits (154), Expect = 1.139e-10
Identity = 47/150 (31.33%), Postives = 65/150 (43.33%), Query Frame = 2
Query:  113 CLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSINCTE----CPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTFANFSKSIKCTKCQP-------NYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLC 529
            C+SC  G+F       C +C  G Y D   + +C  CP+     I G+ N +E    CP G FS + G + C  C  G+F    G   C  C  G     + S     C+        +Y+N       CI+CPAGT Q +SG   C+ C
Sbjct:  636 CVSCVVGTFYSGEQEQCVMCPLGTYQDREGQLSCEPCPRTEGQGIAGAKNVSECGGQCPAGQFS-SDGFRPCQPCQLGTFQPEPGRVLCFPCGGGLMTKHTGSTSFRDCEAKVHCALGHYYNAT--THRCIRCPAGTYQSESGQNYCITC 782          
BLAST of SMED30029137 vs. Ensembl Zebrafish
Match: scube1 (signal peptide, CUB domain, EGF-like 1 [Source:ZFIN;Acc:ZDB-GENE-050302-78])

HSP 1 Score: 63.929 bits (154), Expect = 1.246e-10
Identity = 47/150 (31.33%), Postives = 65/150 (43.33%), Query Frame = 2
Query:  113 CLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSINCTE----CPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTFANFSKSIKCTKCQP-------NYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLC 529
            C+SC  G+F       C +C  G Y D   + +C  CP+     I G+ N +E    CP G FS + G + C  C  G+F    G   C  C  G     + S     C+        +Y+N       CI+CPAGT Q +SG   C+ C
Sbjct:  709 CVSCVVGTFYSGEQEQCVMCPLGTYQDREGQLSCEPCPRTEGQGIAGAKNVSECGGQCPAGQFS-SDGFRPCQPCQLGTFQPEPGRVLCFPCGGGLMTKHTGSTSFRDCEAKVHCALGHYYNAT--THRCIRCPAGTYQSESGQNYCITC 855          
BLAST of SMED30029137 vs. Ensembl Zebrafish
Match: scube2 (signal peptide, CUB domain, EGF-like 2 [Source:NCBI gene;Acc:503728])

HSP 1 Score: 62.3882 bits (150), Expect = 4.174e-10
Identity = 47/157 (29.94%), Postives = 68/157 (43.31%), Query Frame = 2
Query:   98 VLGYVCLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNI---KGSINCTECP----PGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTFANFSKSIKCTKCQ------PNYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLC 529
            +L   C+ C  G++ D     C LC PG Y D+  + +C  CP      I    G+ N +EC     PG FS+  G   C  CP G++    G T+C  C       +  S+    C+      P ++  N     CI+CP GT Q + G   C+ C
Sbjct:  646 LLDKKCVKCSVGTYYDGEQGRCFLCPPGTYQDEEGQVSCDVCPGPEGRGIPRTAGARNISECAGQCRPGQFSH-DGFVPCLPCPQGTYQPEVGRTSCFTCGGSLTTKYDGSVSFQNCETKVQCSPGHY-YNTSTHRCIRCPVGTYQMEFGQNYCIAC 800          
BLAST of SMED30029137 vs. Ensembl Zebrafish
Match: scube3 (signal peptide, CUB domain, EGF-like 3 [Source:ZFIN;Acc:ZDB-GENE-060717-1])

HSP 1 Score: 59.3066 bits (142), Expect = 3.335e-9
Identity = 46/149 (30.87%), Postives = 64/149 (42.95%), Query Frame = 2
Query:  113 CLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSINCT----ECPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGT------FANFSKSIKCTKCQPNYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLC 529
            C+ C PGS+       C  C PG + +   +  C  CP G     +G+ N T    +CPPG FS + G K C  CP G +    G T C  C  G        ++F+       C P ++  N     CI+CP GT Q +     C+ C
Sbjct:  637 CVRCLPGSYYHGEQERCIQCPPGTFQEREGQLACDLCPGGDRHGPQGARNITSCAGQCPPGHFS-SDGFKPCQPCPLGKYQPDPGRTLCFSCGGGLSTKREGASSFNDCEVKVLCSPGHY-YNTSVHRCIRCPHGTYQAEFRQNYCISC 783          

HSP 2 Score: 55.4546 bits (132), Expect = 6.600e-8
Identity = 61/211 (28.91%), Postives = 83/211 (39.34%), Query Frame = 2
Query:   92 LTVLGYVCLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSINCTECPPGLFSNTTGSKNCT----QCPPGSFSNTTGSTNCTVCWPGTFANFSKSIKCTKCQPNYFNRNEGQQSCIKCPAGTDQKKSGSTSC------LLCXXXXXXXXXXXXCLPCKYGYFAAIAGNIKCYICPAGFYCQYANEIPTSCPKHYTC 694
            LT       +C PG   D  +  C  C PG Y     +  C +CP GTF   +G + C  CP G      G++N T    QCPPG FS + G   C  C  G +            QP+      G+  C  C  G   K+ G++S       +LC  G Y N   + C+ C +G + A      C  CP      +   I  S  K+  C
Sbjct:  616 LTQTALKQENCGPGREKD--SGRCVRCLPGSYYHG-EQERCIQCPPGTFQEREGQLACDLCPGGDRHGPQGARNITSCAGQCPPGHFS-SDGFKPCQPCPLGKY------------QPD-----PGRTLCFSCGGGLSTKREGASSFNDCEVKVLCSPGHYYNTSVHRCIRCPHGTYQAEFRQNYCISCPGNTTTDFDGAISVSQCKNREC 805          
BLAST of SMED30029137 vs. Ensembl Xenopus
Match: SCUBE1 (signal peptide, CUB domain, EGF-like 1 [Source:NCBI gene;Acc:100494412])

HSP 1 Score: 69.707 bits (169), Expect = 1.962e-12
Identity = 49/154 (31.82%), Postives = 68/154 (44.16%), Query Frame = 2
Query:   98 VLGYVCLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSINCTE----CPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTFANFSKSIKCTKCQ------PNYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLC 529
            +L   C+ CP G+F +     C  C PG Y D   +  C  CP    S I G+ N +E    C PG FS   G K C  CP G++   +G T C  C  G    +  ++    C+      P ++  N     CI+CP GT Q + G   C+ C
Sbjct:  572 LLDGKCVFCPAGTFYNGEHNQCIPCSPGTYQDTRGQLTCEPCPSNDGSGIGGARNVSECGGQCAPGYFS-LDGFKPCRSCPLGTYQPESGRTLCFPCGGGLVTKYESAVSFQDCETKVHCSPGHY-YNSTTHRCIRCPIGTYQPEFGLNFCITC 723          
BLAST of SMED30029137 vs. Ensembl Xenopus
Match: SCUBE1 (signal peptide, CUB domain, EGF-like 1 [Source:NCBI gene;Acc:100494412])

HSP 1 Score: 69.707 bits (169), Expect = 2.159e-12
Identity = 49/154 (31.82%), Postives = 68/154 (44.16%), Query Frame = 2
Query:   98 VLGYVCLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSINCTE----CPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTFANFSKSIKCTKCQ------PNYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLC 529
            +L   C+ CP G+F +     C  C PG Y D   +  C  CP    S I G+ N +E    C PG FS   G K C  CP G++   +G T C  C  G    +  ++    C+      P ++  N     CI+CP GT Q + G   C+ C
Sbjct:  619 LLDGKCVFCPAGTFYNGEHNQCIPCSPGTYQDTRGQLTCEPCPSNDGSGIGGARNVSECGGQCAPGYFS-LDGFKPCRSCPLGTYQPESGRTLCFPCGGGLVTKYESAVSFQDCETKVHCSPGHY-YNSTTHRCIRCPIGTYQPEFGLNFCITC 770          
BLAST of SMED30029137 vs. Ensembl Xenopus
Match: SCUBE1 (signal peptide, CUB domain, EGF-like 1 [Source:NCBI gene;Acc:100494412])

HSP 1 Score: 69.707 bits (169), Expect = 2.285e-12
Identity = 49/154 (31.82%), Postives = 68/154 (44.16%), Query Frame = 2
Query:   98 VLGYVCLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSINCTE----CPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTFANFSKSIKCTKCQ------PNYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLC 529
            +L   C+ CP G+F +     C  C PG Y D   +  C  CP    S I G+ N +E    C PG FS   G K C  CP G++   +G T C  C  G    +  ++    C+      P ++  N     CI+CP GT Q + G   C+ C
Sbjct:  543 LLDGKCVFCPAGTFYNGEHNQCIPCSPGTYQDTRGQLTCEPCPSNDGSGIGGARNVSECGGQCAPGYFS-LDGFKPCRSCPLGTYQPESGRTLCFPCGGGLVTKYESAVSFQDCETKVHCSPGHY-YNSTTHRCIRCPIGTYQPEFGLNFCITC 694          
BLAST of SMED30029137 vs. Ensembl Xenopus
Match: SCUBE1 (signal peptide, CUB domain, EGF-like 1 [Source:NCBI gene;Acc:100494412])

HSP 1 Score: 69.707 bits (169), Expect = 2.486e-12
Identity = 49/154 (31.82%), Postives = 68/154 (44.16%), Query Frame = 2
Query:   98 VLGYVCLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSINCTE----CPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTFANFSKSIKCTKCQ------PNYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLC 529
            +L   C+ CP G+F +     C  C PG Y D   +  C  CP    S I G+ N +E    C PG FS   G K C  CP G++   +G T C  C  G    +  ++    C+      P ++  N     CI+CP GT Q + G   C+ C
Sbjct:  608 LLDGKCVFCPAGTFYNGEHNQCIPCSPGTYQDTRGQLTCEPCPSNDGSGIGGARNVSECGGQCAPGYFS-LDGFKPCRSCPLGTYQPESGRTLCFPCGGGLVTKYESAVSFQDCETKVHCSPGHY-YNSTTHRCIRCPIGTYQPEFGLNFCITC 759          
BLAST of SMED30029137 vs. Ensembl Xenopus
Match: SCUBE1 (signal peptide, CUB domain, EGF-like 1 [Source:NCBI gene;Acc:100494412])

HSP 1 Score: 69.707 bits (169), Expect = 2.505e-12
Identity = 49/154 (31.82%), Postives = 68/154 (44.16%), Query Frame = 2
Query:   98 VLGYVCLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSINCTE----CPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTFANFSKSIKCTKCQ------PNYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLC 529
            +L   C+ CP G+F +     C  C PG Y D   +  C  CP    S I G+ N +E    C PG FS   G K C  CP G++   +G T C  C  G    +  ++    C+      P ++  N     CI+CP GT Q + G   C+ C
Sbjct:  575 LLDGKCVFCPAGTFYNGEHNQCIPCSPGTYQDTRGQLTCEPCPSNDGSGIGGARNVSECGGQCAPGYFS-LDGFKPCRSCPLGTYQPESGRTLCFPCGGGLVTKYESAVSFQDCETKVHCSPGHY-YNSTTHRCIRCPIGTYQPEFGLNFCITC 726          
BLAST of SMED30029137 vs. Ensembl Mouse
Match: Scube1 (signal peptide, CUB domain, EGF-like 1 [Source:MGI Symbol;Acc:MGI:1890616])

HSP 1 Score: 62.003 bits (149), Expect = 5.274e-10
Identity = 47/149 (31.54%), Postives = 63/149 (42.28%), Query Frame = 2
Query:  113 CLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSINCTE----CPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTF------ANFSKSIKCTKCQPNYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLC 529
            C+ C PG++       C  C  G Y D   + +CT CP      + G+ N +E    C PG FS   G K C  CP G++    G T C  C  G        A+F        C P + + N     CI+CP GT Q + G   C+ C
Sbjct:  549 CVPCAPGTYFSGDPGQCMPCVSGTYQDMEGQLSCTPCPSSEGLGLAGARNVSECGGQCSPGYFS-ADGFKPCQACPVGTYQPEPGRTGCFPCGGGLLTKHTGTASFQDCEAKVHCSPGH-HYNTTTHRCIRCPVGTYQPEFGQNHCISC 695          
BLAST of SMED30029137 vs. Ensembl Mouse
Match: Scube1 (signal peptide, CUB domain, EGF-like 1 [Source:MGI Symbol;Acc:MGI:1890616])

HSP 1 Score: 61.6178 bits (148), Expect = 6.340e-10
Identity = 47/149 (31.54%), Postives = 63/149 (42.28%), Query Frame = 2
Query:  113 CLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSINCTE----CPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTF------ANFSKSIKCTKCQPNYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLC 529
            C+ C PG++       C  C  G Y D   + +CT CP      + G+ N +E    C PG FS   G K C  CP G++    G T C  C  G        A+F        C P + + N     CI+CP GT Q + G   C+ C
Sbjct:  630 CVPCAPGTYFSGDPGQCMPCVSGTYQDMEGQLSCTPCPSSEGLGLAGARNVSECGGQCSPGYFS-ADGFKPCQACPVGTYQPEPGRTGCFPCGGGLLTKHTGTASFQDCEAKVHCSPGH-HYNTTTHRCIRCPVGTYQPEFGQNHCISC 776          
BLAST of SMED30029137 vs. Ensembl Mouse
Match: Scube1 (signal peptide, CUB domain, EGF-like 1 [Source:MGI Symbol;Acc:MGI:1890616])

HSP 1 Score: 61.6178 bits (148), Expect = 6.519e-10
Identity = 47/149 (31.54%), Postives = 63/149 (42.28%), Query Frame = 2
Query:  113 CLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSINCTE----CPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTF------ANFSKSIKCTKCQPNYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLC 529
            C+ C PG++       C  C  G Y D   + +CT CP      + G+ N +E    C PG FS   G K C  CP G++    G T C  C  G        A+F        C P + + N     CI+CP GT Q + G   C+ C
Sbjct:  630 CVPCAPGTYFSGDPGQCMPCVSGTYQDMEGQLSCTPCPSSEGLGLAGARNVSECGGQCSPGYFS-ADGFKPCQACPVGTYQPEPGRTGCFPCGGGLLTKHTGTASFQDCEAKVHCSPGH-HYNTTTHRCIRCPVGTYQPEFGQNHCISC 776          
BLAST of SMED30029137 vs. Ensembl Mouse
Match: Scube1 (signal peptide, CUB domain, EGF-like 1 [Source:MGI Symbol;Acc:MGI:1890616])

HSP 1 Score: 61.6178 bits (148), Expect = 7.772e-10
Identity = 47/149 (31.54%), Postives = 63/149 (42.28%), Query Frame = 2
Query:  113 CLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSINCTE----CPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTF------ANFSKSIKCTKCQPNYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLC 529
            C+ C PG++       C  C  G Y D   + +CT CP      + G+ N +E    C PG FS   G K C  CP G++    G T C  C  G        A+F        C P + + N     CI+CP GT Q + G   C+ C
Sbjct:  660 CVPCAPGTYFSGDPGQCMPCVSGTYQDMEGQLSCTPCPSSEGLGLAGARNVSECGGQCSPGYFS-ADGFKPCQACPVGTYQPEPGRTGCFPCGGGLLTKHTGTASFQDCEAKVHCSPGH-HYNTTTHRCIRCPVGTYQPEFGQNHCISC 806          
BLAST of SMED30029137 vs. Ensembl Mouse
Match: Scube3 (signal peptide, CUB domain, EGF-like 3 [Source:MGI Symbol;Acc:MGI:3045253])

HSP 1 Score: 53.5286 bits (127), Expect = 2.614e-7
Identity = 47/169 (27.81%), Postives = 64/169 (37.87%), Query Frame = 2
Query:  104 GYVCLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSINCT----ECPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNC-----------------------TVCWPGTFANFSKSIKCTKCQPNYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLC 529
            G  C+SCP G++    T  C  C  G + +   + +C  CP        G+ N T    +CPPG  S   G K C  CP G++    G T C                         C PG + N S   +C +C    +  +  Q  C +CP  T     GSTS   C
Sbjct:  649 GTKCVSCPQGTYYHGQTEQCVPCPAGTFQEREGQLSCDLCPGSDAHGPLGATNVTTCAGQCPPGHHSG-DGFKPCQPCPRGTYQPEAGRTLCFPCGGGLTTKHEGAVSFQDCDTKVQCSPGHYYNTSIH-RCIRCAVGSYQPDFRQNFCTRCPGNTSTDFDGSTSVAQC 815          
BLAST of SMED30029137 vs. UniProt/SwissProt
Match: sp|Q8IWY4|SCUB1_HUMAN (Signal peptide, CUB and EGF-like domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SCUBE1 PE=1 SV=3)

HSP 1 Score: 65.0846 bits (157), Expect = 4.014e-10
Identity = 45/148 (30.41%), Postives = 61/148 (41.22%), Query Frame = 2
Query:  113 CLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSINCTE----CPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTFANFSKSIKCTKCQPNY-----FNRNEGQQSCIKCPAGTDQKKSGSTSCLLC 529
            C++C PG+        C  C PG Y D   + +CT CP      + G+ N +E    C PG FS   G K C  CP G++    G T C  C  G       +     C+         + N     CI+CP GT Q + G   C+ C
Sbjct:  630 CVACGPGTHFGGELGQCVSCMPGTYQDMEGQLSCTPCPSSDGLGLPGARNVSECGGQCSPGFFS-ADGFKPCQACPVGTYQPEPGRTGCFPCGGGLLTKHEGTTSFQDCEAKVHCSPGHHYNTTTHRCIRCPVGTYQPEFGQNHCITC 776          
BLAST of SMED30029137 vs. UniProt/SwissProt
Match: sp|Q5G872|SCUB2_DANRE (Signal peptide, CUB and EGF-like domain-containing protein 2 OS=Danio rerio OX=7955 GN=scube2 PE=2 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 3.123e-9
Identity = 47/157 (29.94%), Postives = 68/157 (43.31%), Query Frame = 2
Query:   98 VLGYVCLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNI---KGSINCTECP----PGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTFANFSKSIKCTKCQ------PNYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLC 529
            +L   C+ C  G++ D     C LC PG Y D+  + +C  CP      I    G+ N +EC     PG FS+  G   C  CP G++    G T+C  C       +  S+    C+      P ++  N     CI+CP GT Q + G   C+ C
Sbjct:  646 LLDKKCVKCSVGTYYDGEQGRCFLCPPGTYQDEEGQVSCDVCPGPEGRGIPETAGARNISECAGQCRPGQFSH-DGFVPCLPCPQGTYQPEVGRTSCFTCGGSLTTKYDGSVSFQNCETKVQCSPGHY-YNTSTHRCIRCPVGTYQMEFGQNYCIAC 800          
BLAST of SMED30029137 vs. UniProt/SwissProt
Match: sp|Q6NZL8|SCUB1_MOUSE (Signal peptide, CUB and EGF-like domain-containing protein 1 OS=Mus musculus OX=10090 GN=Scube1 PE=2 SV=2)

HSP 1 Score: 61.6178 bits (148), Expect = 5.436e-9
Identity = 47/149 (31.54%), Postives = 63/149 (42.28%), Query Frame = 2
Query:  113 CLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSINCTE----CPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTF------ANFSKSIKCTKCQPNYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLC 529
            C+ C PG++       C  C  G Y D   + +CT CP      + G+ N +E    C PG FS   G K C  CP G++    G T C  C  G        A+F        C P + + N     CI+CP GT Q + G   C+ C
Sbjct:  660 CVPCAPGTYFSGDPGQCMPCVSGTYQDMEGQLSCTPCPSSEGLGLAGARNVSECGGQCSPGYFS-ADGFKPCQACPVGTYQPEPGRTGCFPCGGGLLTKHTGTASFQDCEAKVHCSPGH-HYNTTTHRCIRCPVGTYQPEFGQNHCISC 806          
BLAST of SMED30029137 vs. UniProt/SwissProt
Match: sp|Q4LDE5|SVEP1_HUMAN (Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SVEP1 PE=1 SV=3)

HSP 1 Score: 56.9954 bits (136), Expect = 1.834e-7
Identity = 44/168 (26.19%), Postives = 69/168 (41.07%), Query Frame = 2
Query:   95 TVLGYVCLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSIN--------------------CTECPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCW-PGTFANFSKS--IKCTKCQPNYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLC 529
             + G +C++CP G++ +     C  C  G Y D+  +  C  CP G ++    S N                    C  CP G +    GS++C  CP  + +   G+ N + C  P     FS+S  + C  C  +Y+  N G+  C+ CP       +GS S   C
Sbjct:  993 VLRGRMCVNCPLGTYYNLEHFTCESCRIGSYQDEEGQLECKLCPSGMYTEYIHSRNISDCKAQCKQGTYSYSGLETCESCPLGTYQPKFGSRSCLSCPENTSTVKRGAVNISACGVPCPEGKFSRSGLMPCHPCPRDYYQPNAGKAFCLACPFYGTTPFAGSRSITEC 1160          
BLAST of SMED30029137 vs. UniProt/SwissProt
Match: sp|Q66PY1|SCUB3_MOUSE (Signal peptide, CUB and EGF-like domain-containing protein 3 OS=Mus musculus OX=10090 GN=Scube3 PE=1 SV=1)

HSP 1 Score: 53.5286 bits (127), Expect = 1.855e-6
Identity = 47/169 (27.81%), Postives = 64/169 (37.87%), Query Frame = 2
Query:  104 GYVCLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSINCT----ECPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNC-----------------------TVCWPGTFANFSKSIKCTKCQPNYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLC 529
            G  C+SCP G++    T  C  C  G + +   + +C  CP        G+ N T    +CPPG  S   G K C  CP G++    G T C                         C PG + N S   +C +C    +  +  Q  C +CP  T     GSTS   C
Sbjct:  633 GTKCVSCPQGTYYHGQTEQCVPCPAGTFQEREGQLSCDLCPGSDAHGPLGATNVTTCAGQCPPGHHSG-DGFKPCQPCPRGTYQPEAGRTLCFPCGGGLTTKHEGAVSFQDCDTKVQCSPGHYYNTSIH-RCIRCAVGSYQPDFRQNFCTRCPGNTSTDFDGSTSVAQC 799          
BLAST of SMED30029137 vs. TrEMBL
Match: A0A267EIF8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig007599g2 PE=4 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 6.948e-35
Identity = 84/249 (33.73%), Postives = 122/249 (49.00%), Query Frame = 2
Query:  113 CLSCPPG-SFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSINCTECPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTFANFSKSIKCTKCQPNYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLCXXX-XXXXXXXXXCLPCKYGYFAAIAGNIKCYICPAGFYCQYANEIPTSCPKHYTCPQGSIYPKSC-GPLLQGTNTP-SCTPSVELIVLICVTSIVALFVIVIIIYAIR 847
            C  CPPG S      R+C  C  G +     +  CT CP G  +  +G+INCTEC PG   + +G++ C  CP GS+S+   S  C +C PG F++ +    C  C    F    G  +C+ CPAG DQK  G   C  C++G        + C  C+ GY+    G++ C  CPAG+YC      P SCP    CP GS  P  C GP L    +  +C  +  L  ++  ++IV++ V + +   +R
Sbjct:   65 CARCPPGTSQAKPGQRDCQPCPVGMHQPASGQAGCTACPAGEEAPSRGAINCTECRPGFNKSESGAQLCGACPAGSYSDELASLECQLCPPGQFSHTAGQSACQPCPAGTFANWTGASACVVCPAGRDQKHEGGLDCQACRRGFYKAYPAVDDCKLCQPGYYNRAEGSLGCLACPAGYYCPRPWVDPESCPALSVCPAGSYEPIQCRGPFLAADKSSNACQATASLYAVLSASAIVSVIVGLAVAGYVR 313          
BLAST of SMED30029137 vs. TrEMBL
Match: A0A267GG54 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig007599g1 PE=4 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 1.073e-33
Identity = 83/249 (33.33%), Postives = 121/249 (48.59%), Query Frame = 2
Query:  113 CLSCPPG-SFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSINCTECPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTFANFSKSIKCTKCQPNYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLCXXX-XXXXXXXXXCLPCKYGYFAAIAGNIKCYICPAGFYCQYANEIPTSCPKHYTCPQGSIYPKSC-GPLLQGTNTP-SCTPSVELIVLICVTSIVALFVIVIIIYAIR 847
            C  CPPG S      R+C  C  G +     +  CT CP G  +  +G+INCTEC PG   + +G++ C  CP GS+S+   S  C +C  G F++ +    C  C    F    G  +C+ CPAG DQK  G   C  C++G        + C  C+ GY+    G++ C  CPAG+YC      P SCP    CP GS  P  C GP L    +  +C  +  L  ++  ++IV++ V + +   +R
Sbjct:   65 CARCPPGTSQAKPGQRDCQPCPVGMHQPASGQAGCTACPAGEEAPSRGAINCTECRPGFNKSESGAQLCGACPAGSYSDELASLECQLCPSGQFSHTAGQSACQPCPAGTFANWTGASACVVCPAGRDQKHEGGLDCQACRRGFYKAYPAVDDCKLCQPGYYNRAEGSLGCLACPAGYYCPRPWVDPESCPALSVCPAGSYEPIQCRGPFLAADKSSNACQATASLYAVLSASAIVSVIVGLAVAGYVR 313          
BLAST of SMED30029137 vs. TrEMBL
Match: A0A1I8J2J3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 4.519e-31
Identity = 83/249 (33.33%), Postives = 119/249 (47.79%), Query Frame = 2
Query:  113 CLSCPPG-SFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSINCTECPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTFANFSKSIKCTKCQPNYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLCXXX-XXXXXXXXXCLPCKYGYFAAIAGNIKCYICPAGFYCQYANEIPTSCPKHYTCPQGSIYPKSC-GPLLQGTNTP-SCTPSVELIVLICVTSIVALFVIVIIIYAIR 847
            C  CPPG S      R+C  C  G +     +  CT CP G  +  +G+INCTEC PG   + +G++ C  CP GS+S+   S  C  C  GTFAN++                 G  +C+ CPAG DQK  G   C  C++G        + C  C+ GY+    G++ C  CPAG+YC      P SCP    CP GS  P  C GP L    +  +C  +  L  ++  ++IV++ V + +   +R
Sbjct:   65 CARCPPGTSQAKPGQRDCQPCPVGMHQPASGQAGCTACPAGEEAPSRGAINCTECRPGFNKSESGAQLCGACPAGSYSDELASLECQPCPAGTFANWT-----------------GASACVVCPAGRDQKHEGGLDCQACRRGFYKAYPAVDDCKLCQPGYYNRAEGSLGCLACPAGYYCPRPWVDPESCPALSVCPAGSYEPIQCRGPFLAADKSSNACQATASLYAVLSASAIVSVIVGLAVAGYVR 296          
BLAST of SMED30029137 vs. TrEMBL
Match: W5MJ72 (Si:dkey-21a6.5 OS=Lepisosteus oculatus OX=7918 PE=4 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 9.491e-31
Identity = 79/252 (31.35%), Postives = 114/252 (45.24%), Query Frame = 2
Query:  113 CLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSINCTECPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTFANFSKSIKCTKCQPNYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLCXXXXXXXXXXXXCLPCKYGYFAAIAGNIKCYICPAGFYCQYANEIPTSCPKHYTCPQGSIYPKSCGPLLQGTNTPSCTPSVELIVLICVTSIVALFVIVIIIYAIRKKRGRYL 868
            C++C PGS+ DN T  C+ C          ++NC  C +G +  +     C  C  G ++N+TGS  C  CP G+F N+TGS  CT C PG + +   +  C  C    F  +     C  CP G +  K  S  C  C+ G Y       C  C  G+F    G   C ICP   YC   + IP  CP    CP+GS  P  C          +C  +   I L+ +   +ALFV+ +++   +++R R L
Sbjct:   61 CVACAPGSYYDNGTLACSCCP--ERGLCVAQSNCLPCSRGHYQPLAAQDLCLPCSQGFYTNSTGSPVCLSCPAGTFGNSTGSQACTACSPGYYTSRQNATSCDPCPLGTFCNSSSCAQCQPCPGGAESLKPASRECTPCRPGMYKEPHETICRICNSGFFQIHWGQESCEICPKDHYCPSPDVIPIQCPADAFCPKGSTAPGYCMETFLRKAGDTCELAPVTIALLVIAGGLALFVVALLVLRRKRERDREL 310          
BLAST of SMED30029137 vs. TrEMBL
Match: M3XHA2 (TNFR-Cys domain-containing protein OS=Latimeria chalumnae OX=7897 GN=LOC102363870 PE=4 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 7.309e-29
Identity = 88/274 (32.12%), Postives = 128/274 (46.72%), Query Frame = 2
Query:  113 CLSCPPGSFIDNFTRNCTLCEPGH--YSDDFNKTNCTECPQGTFSNIKGSINCTECPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTFANFSKSIKCTKCQPNYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLCXXXXXXXXXXXXCLPCKYGYFAAIAGNIKCYICPAGFYCQYANEIPTSCPKHYTCPQGSIYPKSCGPLLQGTNTPSCTPSVELIVLICVTSIVALFVIVIIIYAIRKKRGRYLYRGLSNTFSEPSPFVSRKNT 928
            C++C PG++ +N T NC+ C  G   Y ++     C  CP G + +  G   C  CP G ++N+TGS  C  C PG +SN TGS  C+ C PG F +   +  C  C P  F        C  CP G +     ST C  C+ G + +   + C  C  GY+    G   C ICP   YC   +  P  CP    CP GS  P+ C  +    +  +C  +   IVL+ +    A+ V+VI    +R+KR   L +G   T S  +P + ++ T
Sbjct:   69 CVTCLPGTYSNNGTLNCSCCSDGSCTYPEE-----CLSCPVGHYQSQAGQQVCFLCPYGFYTNSTGSSACFPCEPGFYSNETGSLTCSRCAPGYFTSRLSATFCDPCPPGSFCNTTNCSVCKTCPGGEEAVSKASTECSPCRPGMFKHPSDSMCKICSSGYYQIKWGQETCEICPENHYCPSPDINPILCPNDAFCPAGSTAPQYCMEIFLRKSGGTCELAPLTIVLLAI--CFAMIVLVIAFLILRRKRD--LDQG---TVSSRAPLLQKERT 330          
BLAST of SMED30029137 vs. Ensembl Cavefish
Match: si:dkey-21a6.5 (si:dkey-21a6.5 [Source:ZFIN;Acc:ZDB-GENE-131121-257])

HSP 1 Score: 90.8929 bits (224), Expect = 2.259e-20
Identity = 75/258 (29.07%), Postives = 110/258 (42.64%), Query Frame = 2
Query:  113 CLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSINCTECPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTFANFSKSIKCTKCQPNYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLCXXXXXXXXXXXXCLPCKYGYFAAIAGNIKCYICPAGFYCQYANEIPTSCPKHYTCPQGSIYPKSCGPLLQGTNTPSCTPSVELIVLICVTSIVALFVIVIIIYAIRKKRGRYLYRGLSN 886
            C +C PGS+ DN T  C  C             C  C QG +  + G   C  C PG ++  TGS  C  CPPGSF+N TGS +C  C P  + +   +  C  C    +  +   Q C  CPAG++  + G+  C  C +  +       C  C  G++    G   C ICP   YC   +  P  CP    CP+GS  P  C          +C  +   I L+ +     LF+I+++   +R+++       LS 
Sbjct:   44 CEACAPGSYYDN-TLLCLCCP--EVGLCMFPGACLPCFQGFYQPLAGQQTCLPCLPGFYT-FTGSPVCQACPPGSFTNNTGSLSCRTCSP-FYTSERNATLCNPCPEGTYCSSSCVQ-CQICPAGSEALQDGAKDCTPC-RPMHKPSRQKMCQICSSGFYQISWGQENCDICPENHYCPSPDVNPIQCPSDAFCPEGSTAPGYCMETFFRKAGDTCELAPVTIALLVIGGGALLFIILLV---LRRRKDTDSELSLSR 291          
BLAST of SMED30029137 vs. Ensembl Cavefish
Match: svep1 (sushi, von Willebrand factor type A, EGF and pentraxin domain containing 1 [Source:NCBI gene;Acc:103042618])

HSP 1 Score: 65.0846 bits (157), Expect = 4.595e-11
Identity = 53/159 (33.33%), Postives = 71/159 (44.65%), Query Frame = 2
Query:   77 YCFGILTVLGYVCLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSINCTECP----PGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTFA---NFSKSIKC-TKCQPNYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLC 529
            YC     + G +C+ CP G+F       C  C  G+Y D+  KT C  CP G  +    S N +EC     PG  S+ +G + C  CP G +    GS NC  C P T         SI+C   C   +F+R+ G   C  CP    Q + G + CL C
Sbjct:  990 YCRPGSVLKGRMCVQCPVGTFYSMEYAECESCRRGYYQDEEGKTECKICPNGYSTPYLHSRNVSECKAQCRPG-SSSFSGLETCESCPLGEYQPDFGSRNCRPCPPNTSTVNRGAVDSIECGVPCSAGHFSRS-GLVPCYPCPRDYYQPEDGRSFCLSC 1146          
BLAST of SMED30029137 vs. Ensembl Cavefish
Match: scube1 (signal peptide, CUB domain and EGF like domain containing 1 [Source:NCBI gene;Acc:103025513])

HSP 1 Score: 63.1586 bits (152), Expect = 1.778e-10
Identity = 46/149 (30.87%), Postives = 61/149 (40.94%), Query Frame = 2
Query:  113 CLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSINCTE----CPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTFANFSKSIKCTKCQPN------YFNRNEGQQSCIKCPAGTDQKKSGSTSCLLC 529
            C+SC  G+F       C  C PG Y D   + +C  CP        G+ N +E    CP G FS   G + C  CP G+F    G   C  C  G     + S    +C+        +F  N     CI+CP GT Q + G   C+ C
Sbjct:  615 CVSCSVGTFYSGEQNQCVQCPPGTYQDRDGQLSCEPCPSTELQGTAGAKNVSECGVRCPAGHFS-ADGFRPCQLCPLGTFQPEVGRVLCFPCGGGLMTKHTGSTSFRECEAKVHCASGHF-YNSSTHRCIRCPPGTYQSEFGQNYCITC 761          
BLAST of SMED30029137 vs. Ensembl Cavefish
Match: scube1 (signal peptide, CUB domain and EGF like domain containing 1 [Source:NCBI gene;Acc:103025513])

HSP 1 Score: 63.1586 bits (152), Expect = 2.063e-10
Identity = 46/149 (30.87%), Postives = 61/149 (40.94%), Query Frame = 2
Query:  113 CLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSINCTE----CPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTFANFSKSIKCTKCQPN------YFNRNEGQQSCIKCPAGTDQKKSGSTSCLLC 529
            C+SC  G+F       C  C PG Y D   + +C  CP        G+ N +E    CP G FS   G + C  CP G+F    G   C  C  G     + S    +C+        +F  N     CI+CP GT Q + G   C+ C
Sbjct:  709 CVSCSVGTFYSGEQNQCVQCPPGTYQDRDGQLSCEPCPSTELQGTAGAKNVSECGVRCPAGHFS-ADGFRPCQLCPLGTFQPEVGRVLCFPCGGGLMTKHTGSTSFRECEAKVHCASGHF-YNSSTHRCIRCPPGTYQSEFGQNYCITC 855          
BLAST of SMED30029137 vs. Ensembl Cavefish
Match: scube1 (signal peptide, CUB domain and EGF like domain containing 1 [Source:NCBI gene;Acc:103025513])

HSP 1 Score: 62.7734 bits (151), Expect = 2.123e-10
Identity = 46/149 (30.87%), Postives = 61/149 (40.94%), Query Frame = 2
Query:  113 CLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSINCTE----CPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTFANFSKSIKCTKCQPN------YFNRNEGQQSCIKCPAGTDQKKSGSTSCLLC 529
            C+SC  G+F       C  C PG Y D   + +C  CP        G+ N +E    CP G FS   G + C  CP G+F    G   C  C  G     + S    +C+        +F  N     CI+CP GT Q + G   C+ C
Sbjct:  679 CVSCSVGTFYSGEQNQCVQCPPGTYQDRDGQLSCEPCPSTELQGTAGAKNVSECGVRCPAGHFS-ADGFRPCQLCPLGTFQPEVGRVLCFPCGGGLMTKHTGSTSFRECEAKVHCASGHF-YNSSTHRCIRCPPGTYQSEFGQNYCITC 825          
BLAST of SMED30029137 vs. Ensembl Nematostella
Match: EDO49128 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGX1])

HSP 1 Score: 101.679 bits (252), Expect = 1.321e-24
Identity = 61/179 (34.08%), Postives = 86/179 (48.04%), Query Frame = 2
Query:  113 CLSCPPGSFIDNFTR-NCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSINCTECPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTFANFSKSIKCTKCQPNYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLCXXXXXXXX-XXXXCLPCKYGYFAAIAGNIKCYICPAGFY 643
            C  C PG F + F + NC+ CEPGH+  +  + +C  C  G + N  G   C EC  G + N  G   C +C  G + N  G + C  C  G + N      C +C    +    GQ +C++C AG  Q K G ++CL C  G+Y NK   + CL C  G +   +G  KC  C AG +
Sbjct:    1 CTKCAPGYFQEQFGQPNCSACEPGHFQPNSGQISCPPCTDGQYQNKSGQSTCLECTAGQYQNKPGQSTCLECTAGQYQNKPGQSTCLECTAGQYQNKPGQSTCLECTAGQYQNKPGQSTCLECTAGQYQNKPGQSTCLECTAGQYQNKPGQSTCLECTAGQYQNKSGQAKCLPCAAGQH 179          

HSP 2 Score: 86.2705 bits (212), Expect = 3.889e-19
Identity = 70/256 (27.34%), Postives = 99/256 (38.67%), Query Frame = 2
Query:  110 VCLSCPPGSFIDNFTRN-CTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSINCTECPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTFANFSKSIKCTKCQPNYFNRNEGQQSCIKCPAGT-----------------DQKKSGSTSCLLCXXXXXXXXXXXXCLPCKYGYFAAIAGNIKCYICPAGFYC-QYANEIPTSCPK-HYTCPQGSIYPKSCGPLLQGTNTPSCTPSVELIVLICVTSIVALF 817
             CL C  G + +   ++ C  C  G Y +   ++ C EC  G + N  G   C EC  G + N  G   C +C  G + N  G + C  C  G + N S   KC  C         GQ  C+ CPAG                   Q K+G TS                C+PC  G+F +  G   C +C  G Y  +   EI  +CP  HY   Q  +   +C    QGT  P     +E++V +C +     +
Sbjct:   68 TCLECTAGQYQNKPGQSTCLECTAGQYQNKPGQSTCLECTAGQYQNKPGQSTCLECTAGQYQNKPGQSTCLECTAGQYQNKPGQSTCLECTAGQYQNKSGQAKCLPCAAGQHQNKNGQGYCLPCPAGNYQGSQGKALCLPCSKGYHQNKTGQTS----------------CVPCAVGHFQSQEGQPICELCEHGEYQNKTGQEICRTCPAGHY---QDQMGQTTCRVCKQGTFQP-----LEILVDMCQSCKSGWY 299          

HSP 3 Score: 85.1149 bits (209), Expect = 8.871e-19
Identity = 55/182 (30.22%), Postives = 80/182 (43.96%), Query Frame = 2
Query:  110 VCLSCPPGSFIDNFTRN-CTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSINCTECPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTFANFSKSIKCTKCQPNYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLCXXXXXX--XXXXXXCLPCKYGYFAAIAGNIKCYICPAGFYC 646
             CL C  G + +   ++ C  C  G Y +   +  C  C  G   N  G   C  CP G +  + G   C  C  G   N TG T+C  C  G F +      C  C+   +    GQ+ C  CPAG  Q + G T+C +CK+G +       + C  CK G++  ++G   C  CP G++C
Sbjct:  136 TCLECTAGQYQNKPGQSTCLECTAGQYQNKSGQAKCLPCAAGQHQNKNGQGYCLPCPAGNYQGSQGKALCLPCSKGYHQNKTGQTSCVPCAVGHFQSQEGQPICELCEHGEYQNKTGQEICRTCPAGHYQDQMGQTTCRVCKQGTFQPLEILVDMCQSCKSGWYQPLSGETSCIECPEGYFC 317          
BLAST of SMED30029137 vs. Ensembl Nematostella
Match: EDO47187 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN01])

HSP 1 Score: 75.0998 bits (183), Expect = 1.043e-16
Identity = 49/146 (33.56%), Postives = 64/146 (43.84%), Query Frame = 2
Query:  212 CTECPQGTFSNIKGSINCTECPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTFANFSKSIKCTKCQPNYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLCXXXXXXXXXXXXCLPCKYGYFAAIAGNIKCYICPAGFYCQ 649
            C+ CP  T+ N  G  +C  CPPG + N +G + C QCPPG++  + G                    CT C  N +    GQ SCI CP GT Q +SG   C+ C       KP   C  C+ G +   +G   C  C AG   Q
Sbjct:    1 CSPCPTATYQNQSGQASCVHCPPGTYQNKSGQEACNQCPPGTYGKSDG-------------------MCTLCPTNTYQNKSGQASCIYCPNGTHQNQSGQEGCVEC-PPGSYWKPDGMCALCQKGTYQNQSGQTTCIQCAAGLVTQ 126          

HSP 2 Score: 72.4034 bits (176), Expect = 1.080e-15
Identity = 42/123 (34.15%), Postives = 61/123 (49.59%), Query Frame = 2
Query:  161 CTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSINCTECPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTFANFSKSIKCTKCQPNYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLC 529
            C+ C    Y +   + +C  CP GT+ N  G   C +CPPG +  + G   CT CP  ++ N +G  +C  C  GT  N S    C +C P  + + +G   C  C  GT Q +SG T+C+ C
Sbjct:    1 CSPCPTATYQNQSGQASCVHCPPGTYQNKSGQEACNQCPPGTYGKSDGM--CTLCPTNTYQNKSGQASCIYCPNGTHQNQSGQEGCVECPPGSYWKPDGM--CALCQKGTYQNQSGQTTCIQC 119          

HSP 3 Score: 68.5514 bits (166), Expect = 2.700e-14
Identity = 41/133 (30.83%), Postives = 63/133 (47.37%), Query Frame = 2
Query:  113 CLSCPPGSFIDNFTR-NCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSINCTECPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTFANFSKSIKCTKCQPNYFNRNEGQQSCIKCPAGTDQKKSG 508
            C  CP  ++ +   + +C  C PG Y +   +  C +CP GT+    G   CT CP   + N +G  +C  CP G+  N +G   C  C PG++  +     C  CQ   +    GQ +CI+C AG   + +G
Sbjct:    1 CSPCPTATYQNQSGQASCVHCPPGTYQNKSGQEACNQCPPGTYGKSDGM--CTLCPTNTYQNKSGQASCIYCPNGTHQNQSGQEGCVECPPGSY--WKPDGMCALCQKGTYQNQSGQTTCIQCAAGLVTQNTG 129          

HSP 4 Score: 55.4546 bits (132), Expect = 1.017e-9
Identity = 33/92 (35.87%), Postives = 43/92 (46.74%), Query Frame = 2
Query:  110 VCLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSINCTECPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPG 385
             C  CPPG++  +    CTLC    Y +   + +C  CP GT  N  G   C ECPPG +    G   C  C  G++ N +G T C  C  G
Sbjct:   34 ACNQCPPGTYGKSDGM-CTLCPTNTYQNKSGQASCIYCPNGTHQNQSGQEGCVECPPGSYWKPDGM--CALCQKGTYQNQSGQTTCIQCAAG 122          
BLAST of SMED30029137 vs. Ensembl Nematostella
Match: EDO44945 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU40])

HSP 1 Score: 65.0846 bits (157), Expect = 1.702e-11
Identity = 56/159 (35.22%), Postives = 70/159 (44.03%), Query Frame = 2
Query:  170 CEPGHYSDDFNKTNCTECPQGTFSNIKGSINCTECPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTFANFSKSIKCTKCQPNYFNRNEGQ--QSCIKCPAGTDQKKSGSTSCLLCXXXXXXXXXXXXCLPCKYGYFAAIAGNIKCYICPAGF 640
            C PG Y D   K NC  CP+GT+ N  G +NCT CPPGL + TTGS N   C               +C  G F N  KS  C  C    +   E     SC+ CP+     KSG+T+   C     +       LPC+ G     AGN    +CP+G 
Sbjct:  632 CTPGQYFDTL-KANCMTCPEGTYQNEVGKVNCTSCPPGLATLTTGSTNKEDCRK-------------ICGKGEFFNMDKS-SCDHCPLGTYQDLEKHTNTSCVSCPSKM-STKSGATNKSACISFCDS-------LPCEGGECKE-AGNRFVCMCPSGL 766          
BLAST of SMED30029137 vs. Ensembl Nematostella
Match: EDO34703 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNM7])

HSP 1 Score: 61.6178 bits (148), Expect = 2.173e-10
Identity = 49/177 (27.68%), Postives = 75/177 (42.37%), Query Frame = 2
Query:  113 CLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSINCTECPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTFANFSKSIKCTKCQPNYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLCXXXXXXXXXXXXCLPCKYGYFAAIAGNIKCYICPAGFY 643
            C+SCPPG+F D+    C L                 CP+ T+ +  GS+ C +CP G ++  +G+K  ++C P             VC  GT++     + C  C   Y+  ++ Q +C KCP  T   + G+ S   C             +PC  G ++A  G   C  CP G Y
Sbjct:  724 CMSCPPGNFYDSAQSQCVL-----------------CPRDTYEHNTGSLACQKCPSGTYTFKSGTKKGSECKP-------------VCQAGTYSTTGLEL-CQPCAIGYYQSHKRQTTCNKCPGSTITLEEGADSISKCG------------MPCAPGTYSAT-GVEPCAPCPVGTY 856          
BLAST of SMED30029137 vs. Ensembl Nematostella
Match: EDO45805 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRR0])

HSP 1 Score: 53.5286 bits (127), Expect = 2.901e-9
Identity = 38/131 (29.01%), Postives = 57/131 (43.51%), Query Frame = 2
Query:  131 GSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSINCTECPPGLFSNTTGSKNCTQCPPGSFSN--TTGSTNCTVCWPGTFANFSKSIKCTKCQPNYFNRNEGQQSCIKCPAGTDQKKSGSTS 517
            G+F +  +RNC++C  G Y D+  +T C  CP GT + + G+IN T C                C  G + +    G+  C  C  GT+            QP  F++     SC+KCP G    + G+ S
Sbjct:    2 GTFYNEKSRNCSICPLGTYQDEMGQTVCKSCPSGTLTVVSGAINETLCYD-------------TCEAGEYRHIGEGGAATCLACPIGTY------------QPQAFSK-----SCLKCPDGKSTTRVGAMS 102          

HSP 2 Score: 48.9062 bits (115), Expect = 1.122e-7
Identity = 34/100 (34.00%), Postives = 48/100 (48.00%), Query Frame = 2
Query:  230 GTFSNIKGSINCTECPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTFANFSKSIKCTKCQPNYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLC 529
            GTF N K S NC+ CP G + +  G   C  CP G+ +  +G+ N T+C+    A   + I              G  +C+ CP GT Q ++ S SCL C
Sbjct:    2 GTFYNEK-SRNCSICPLGTYQDEMGQTVCKSCPSGTLTVVSGAINETLCYDTCEAGEYRHIG-----------EGGAATCLACPIGTYQPQAFSKSCLKC 89          
BLAST of SMED30029137 vs. Ensembl Medaka
Match: si:dkey-21a6.5 (laminin subunit gamma-2 [Source:NCBI gene;Acc:101161203])

HSP 1 Score: 65.855 bits (159), Expect = 5.653e-12
Identity = 58/219 (26.48%), Postives = 90/219 (41.10%), Query Frame = 2
Query:  212 CTECPQGTFSNIKGSINCTECPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTFANFSKSIKCTKCQPNYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLCXXXXXXXXXXXXCLPCKYGYFAAIAGNIKCYICPAGFYC--QYANEIPTSCPKHYTCPQGSIYPKSCGPLLQGTNTPSCTPSVELIVLICVTSIVALFVIVIIIYAIRKKRGR 862
            C  C +G + ++ G   C  C PG +S  TGS  C  CP GSF+N T S  CT C P +  +  ++                      CP GT+  ++ +  C  C +  +     + C  C  G++    G   C +CP   YC  Q  +  P  CP    CP+GS+ P  C          +C  +   I L+ +     LFVI++++   +   G 
Sbjct:   36 CLPCKKGFYQSLSGQEQCLPCSPGFYS-LTGSPLCHPCPSGSFNNNTRSETCTSCSPSSSCSLCQT----------------------CPGGTEALQTAAKDCTPC-RPMHKPPHQSMCQICNSGFYQIRWGQENCDVCPENHYCPFQSPDVNPIQCPSDAFCPEGSLAPGYCMETFFRKAGDTCELAPVTIALLVIGGGALLFVILMVLRRRKDTDGE 230          
BLAST of SMED30029137 vs. Ensembl Medaka
Match: scube2 (signal peptide, CUB domain and EGF like domain containing 2 [Source:NCBI gene;Acc:101161226])

HSP 1 Score: 66.6254 bits (161), Expect = 1.189e-11
Identity = 48/175 (27.43%), Postives = 80/175 (45.71%), Query Frame = 2
Query:   44 ENMKIFIQCISYCFGILTVLGYVCLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQ---GTFSNIKGSINCTE----CPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTFANFSKSIKCTKCQ------PNYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLC 529
            +N+    +   +C     ++G  C+SC  G++ D+  R C LC+ G + D+  + +C +CP       S + G+ N +E    C PG +S+  G   C  CP G++    G T+C  C        S ++   +C+      P ++  N     CI+CP GT Q + G   C  C
Sbjct:  638 KNLGQSAELQGHCGAGQVLVGRKCVSCGAGTYYDSDQRRCILCQAGTFQDEEGQMSCEQCPAPEGREASGVVGARNLSECGGQCSPGQYSH-DGFTPCLLCPLGTYQPEVGRTSCFSCGGNLVTKHSGAVTFQECETKVQCSPGHY-YNTSTHRCIRCPVGTYQVEFGQNYCSTC 810          
BLAST of SMED30029137 vs. Ensembl Medaka
Match: scube1 (signal peptide, CUB and EGF-like domain-containing protein 1 [Source:NCBI gene;Acc:105357050])

HSP 1 Score: 58.5362 bits (140), Expect = 5.801e-9
Identity = 43/149 (28.86%), Postives = 62/149 (41.61%), Query Frame = 2
Query:  113 CLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSINCT----ECPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTFANFSKSIKCTKCQ------PNYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLC 529
            C+SC  G+F       C  C  G Y D   + +C  CP      I G+ N +    +CP G +S + G   C  CP G++    G   C  C  G    +  S+    C+      P ++  N     CI+C AGT Q + G   C+ C
Sbjct:  664 CVSCGVGTFYSGEQEQCVQCPTGTYQDTEGQLSCEPCPSIDGQGIIGAKNVSQCGGQCPAGQYS-SDGFHPCQPCPQGTYQPEPGRVQCFQCGGGLMTKYEGSVSFRDCEAKVHCAPGHY-YNSTTHRCIRCQAGTYQSEFGQNYCITC 810          
BLAST of SMED30029137 vs. Ensembl Medaka
Match: scube1 (signal peptide, CUB and EGF-like domain-containing protein 1 [Source:NCBI gene;Acc:105357050])

HSP 1 Score: 58.151 bits (139), Expect = 6.439e-9
Identity = 43/149 (28.86%), Postives = 62/149 (41.61%), Query Frame = 2
Query:  113 CLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSINCT----ECPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTFANFSKSIKCTKCQ------PNYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLC 529
            C+SC  G+F       C  C  G Y D   + +C  CP      I G+ N +    +CP G +S + G   C  CP G++    G   C  C  G    +  S+    C+      P ++  N     CI+C AGT Q + G   C+ C
Sbjct:  694 CVSCGVGTFYSGEQEQCVQCPTGTYQDTEGQLSCEPCPSIDGQGIIGAKNVSQCGGQCPAGQYS-SDGFHPCQPCPQGTYQPEPGRVQCFQCGGGLMTKYEGSVSFRDCEAKVHCAPGHY-YNSTTHRCIRCQAGTYQSEFGQNYCITC 840          
BLAST of SMED30029137 vs. Ensembl Medaka
Match: scube1 (signal peptide, CUB and EGF-like domain-containing protein 1 [Source:NCBI gene;Acc:105357050])

HSP 1 Score: 58.151 bits (139), Expect = 6.768e-9
Identity = 43/149 (28.86%), Postives = 62/149 (41.61%), Query Frame = 2
Query:  113 CLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSINCT----ECPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTFANFSKSIKCTKCQ------PNYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLC 529
            C+SC  G+F       C  C  G Y D   + +C  CP      I G+ N +    +CP G +S + G   C  CP G++    G   C  C  G    +  S+    C+      P ++  N     CI+C AGT Q + G   C+ C
Sbjct:  641 CVSCGVGTFYSGEQEQCVQCPTGTYQDTEGQLSCEPCPSIDGQGIIGAKNVSQCGGQCPAGQYS-SDGFHPCQPCPQGTYQPEPGRVQCFQCGGGLMTKYEGSVSFRDCEAKVHCAPGHY-YNSTTHRCIRCQAGTYQSEFGQNYCITC 787          
BLAST of SMED30029137 vs. Planmine SMEST
Match: SMESG000021130.1 (SMESG000021130.1)

HSP 1 Score: 565.074 bits (1455), Expect = 0.000e+0
Identity = 298/299 (99.67%), Postives = 299/299 (100.00%), Query Frame = 2
Query:   50 MKIFIQCISYCFGILTVLGYVCLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGTFSNIKGSINCTECPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTFANFSKSIKCTKCQPNYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLCXXXXXXXXXXXXCLPCKYGYFAAIAGNIKCYICPAGFYCQYANEIPTSCPKHYTCPQGSIYPKSCGPLLQGTNTPSCTPSVELIVLICVTSIVALFVIVIIIYAIRKKRGRYLYRGLSNTFSEPSPFVSRKNTSIYSGY 946
            MKIFIQCISYCFGILTVLGYVCLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQG+FSNIKGSINCTECPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTFANFSKSIKCTKCQPNYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLCKKGKYNNKPGNPCLPCKYGYFAAIAGNIKCYICPAGFYCQYANEIPTSCPKHYTCPQGSIYPKSCGPLLQGTNTPSCTPSVELIVLICVTSIVALFVIVIIIYAIRKKRGRYLYRGLSNTFSEPSPFVSRKNTSIYSGY
Sbjct:    1 MKIFIQCISYCFGILTVLGYVCLSCPPGSFIDNFTRNCTLCEPGHYSDDFNKTNCTECPQGSFSNIKGSINCTECPPGLFSNTTGSKNCTQCPPGSFSNTTGSTNCTVCWPGTFANFSKSIKCTKCQPNYFNRNEGQQSCIKCPAGTDQKKSGSTSCLLCKKGKYNNKPGNPCLPCKYGYFAAIAGNIKCYICPAGFYCQYANEIPTSCPKHYTCPQGSIYPKSCGPLLQGTNTPSCTPSVELIVLICVTSIVALFVIVIIIYAIRKKRGRYLYRGLSNTFSEPSPFVSRKNTSIYSGY 299          
The following BLAST results are available for this feature:
BLAST of SMED30029137 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SCUBE18.359e-1130.41signal peptide, CUB domain and EGF like domain con... [more]
SVEP13.818e-826.19sushi, von Willebrand factor type A, EGF and pentr... [more]
SVEP13.886e-826.19sushi, von Willebrand factor type A, EGF and pentr... [more]
SCUBE34.255e-727.81signal peptide, CUB domain and EGF like domain con... [more]
SCUBE21.648e-629.61signal peptide, CUB domain and EGF like domain con... [more]
back to top
BLAST of SMED30029137 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
clec-785.590e-1130.43C-type LECtin [Source:UniProtKB/TrEMBL;Acc:Q20531... [more]
F58E6.137.546e-827.37pep chromosome:WBcel235:V:9745240:9749228:1 gene:W... [more]
F58E6.131.237e-727.08pep chromosome:WBcel235:V:9745657:9749228:1 gene:W... [more]
back to top
BLAST of SMED30029137 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
uif5.699e-1028.16gene:FBgn0031879 transcript:FBtr0307072[more]
uif5.699e-1028.16gene:FBgn0031879 transcript:FBtr0302162[more]
uif5.699e-1028.16gene:FBgn0031879 transcript:FBtr0307074[more]
uif5.699e-1028.16gene:FBgn0031879 transcript:FBtr0307073[more]
uif6.115e-1028.16gene:FBgn0031879 transcript:FBtr0339664[more]
back to top
BLAST of SMED30029137 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-21a6.57.749e-2830.38si:dkey-21a6.5 [Source:ZFIN;Acc:ZDB-GENE-131121-25... [more]
scube11.139e-1031.33signal peptide, CUB domain, EGF-like 1 [Source:ZFI... [more]
scube11.246e-1031.33signal peptide, CUB domain, EGF-like 1 [Source:ZFI... [more]
scube24.174e-1029.94signal peptide, CUB domain, EGF-like 2 [Source:NCB... [more]
scube33.335e-930.87signal peptide, CUB domain, EGF-like 3 [Source:ZFI... [more]
back to top
BLAST of SMED30029137 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SCUBE11.962e-1231.82signal peptide, CUB domain, EGF-like 1 [Source:NCB... [more]
SCUBE12.159e-1231.82signal peptide, CUB domain, EGF-like 1 [Source:NCB... [more]
SCUBE12.285e-1231.82signal peptide, CUB domain, EGF-like 1 [Source:NCB... [more]
SCUBE12.486e-1231.82signal peptide, CUB domain, EGF-like 1 [Source:NCB... [more]
SCUBE12.505e-1231.82signal peptide, CUB domain, EGF-like 1 [Source:NCB... [more]
back to top
BLAST of SMED30029137 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Scube15.274e-1031.54signal peptide, CUB domain, EGF-like 1 [Source:MGI... [more]
Scube16.340e-1031.54signal peptide, CUB domain, EGF-like 1 [Source:MGI... [more]
Scube16.519e-1031.54signal peptide, CUB domain, EGF-like 1 [Source:MGI... [more]
Scube17.772e-1031.54signal peptide, CUB domain, EGF-like 1 [Source:MGI... [more]
Scube32.614e-727.81signal peptide, CUB domain, EGF-like 3 [Source:MGI... [more]
back to top
BLAST of SMED30029137 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8IWY4|SCUB1_HUMAN4.014e-1030.41Signal peptide, CUB and EGF-like domain-containing... [more]
sp|Q5G872|SCUB2_DANRE3.123e-929.94Signal peptide, CUB and EGF-like domain-containing... [more]
sp|Q6NZL8|SCUB1_MOUSE5.436e-931.54Signal peptide, CUB and EGF-like domain-containing... [more]
sp|Q4LDE5|SVEP1_HUMAN1.834e-726.19Sushi, von Willebrand factor type A, EGF and pentr... [more]
sp|Q66PY1|SCUB3_MOUSE1.855e-627.81Signal peptide, CUB and EGF-like domain-containing... [more]
back to top
BLAST of SMED30029137 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267EIF86.948e-3533.73Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GG541.073e-3333.33Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8J2J34.519e-3133.33Uncharacterized protein OS=Macrostomum lignano OX=... [more]
W5MJ729.491e-3131.35Si:dkey-21a6.5 OS=Lepisosteus oculatus OX=7918 PE=... [more]
M3XHA27.309e-2932.12TNFR-Cys domain-containing protein OS=Latimeria ch... [more]
back to top
BLAST of SMED30029137 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-21a6.52.259e-2029.07si:dkey-21a6.5 [Source:ZFIN;Acc:ZDB-GENE-131121-25... [more]
svep14.595e-1133.33sushi, von Willebrand factor type A, EGF and pentr... [more]
scube11.778e-1030.87signal peptide, CUB domain and EGF like domain con... [more]
scube12.063e-1030.87signal peptide, CUB domain and EGF like domain con... [more]
scube12.123e-1030.87signal peptide, CUB domain and EGF like domain con... [more]
back to top
BLAST of SMED30029137 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029137 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029137 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO491281.321e-2434.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471871.043e-1633.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO449451.702e-1135.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO347032.173e-1027.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458052.901e-929.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30029137 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-21a6.55.653e-1226.48laminin subunit gamma-2 [Source:NCBI gene;Acc:1011... [more]
scube21.189e-1127.43signal peptide, CUB domain and EGF like domain con... [more]
scube15.801e-928.86signal peptide, CUB and EGF-like domain-containing... [more]
scube16.439e-928.86signal peptide, CUB and EGF-like domain-containing... [more]
scube16.768e-928.86signal peptide, CUB and EGF-like domain-containing... [more]
back to top
BLAST of SMED30029137 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000021130.10.000e+099.67SMESG000021130.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029137 ID=SMED30029137|Name=SMED30029137|organism=Schmidtea mediterranea sexual|type=transcript|length=1053bp
TATTAACTGAAGAGGTTACTAAGGATAAATGATTTGAAAATAGGAAAACA
TGAAAATATTTATTCAATGTATTTCGTATTGTTTCGGCATTTTAACCGTT
TTAGGCTACGTTTGTCTTTCATGTCCACCAGGATCCTTTATCGATAATTT
TACAAGGAATTGCACACTTTGTGAACCAGGACATTACTCAGATGATTTTA
ACAAAACAAATTGTACTGAATGCCCCCAGGGCACATTCAGTAACATAAAA
GGCAGTATAAATTGTACTGAATGTCCTCCGGGTTTATTCAGTAACACGAC
AGGCAGTAAAAACTGTACTCAATGCCCCCCGGGTTCATTCAGTAACACGA
CGGGCAGTACAAATTGTACAGTCTGTTGGCCTGGGACATTTGCAAATTTC
TCAAAATCCATAAAATGCACCAAATGCCAACCAAATTATTTTAATAGGAA
TGAAGGACAACAATCTTGTATCAAATGCCCCGCTGGGACAGACCAGAAGA
AGAGTGGAAGTACTTCATGTTTATTGTGTAAAAAAGGTAAATATAACAAC
AAACCTGGCAACCCATGCCTACCATGCAAATACGGTTATTTCGCAGCTAT
TGCTGGAAATATAAAGTGTTATATTTGCCCAGCTGGATTCTACTGCCAGT
ATGCAAATGAAATTCCTACAAGCTGTCCAAAGCATTACACATGTCCACAA
GGTTCAATATATCCAAAATCATGTGGACCATTGCTACAAGGTACAAATAC
ACCCAGCTGCACTCCTTCAGTAGAATTAATTGTTCTTATCTGTGTCACAT
CCATAGTTGCTTTATTTGTCATCGTCATTATAATTTATGCAATCAGAAAA
AAGAGAGGTAGATATTTGTATAGAGGTCTCTCGAATACATTCTCGGAGCC
AAGCCCATTTGTAAGTCGAAAGAACACTTCCATTTATTCTGGATATTGAG
TTTTATTTTCATTATTATTTTTACTGTAACTGTTATTTAACAGATTTTTT
GATTTTTTAAAGATATTTTTTTATAAAATTCAATTTTTCGTTTTCAAAAA
AAA
back to top

protein sequence of SMED30029137-orf-1

>SMED30029137-orf-1 ID=SMED30029137-orf-1|Name=SMED30029137-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=300bp
MKIFIQCISYCFGILTVLGYVCLSCPPGSFIDNFTRNCTLCEPGHYSDDF
NKTNCTECPQGTFSNIKGSINCTECPPGLFSNTTGSKNCTQCPPGSFSNT
TGSTNCTVCWPGTFANFSKSIKCTKCQPNYFNRNEGQQSCIKCPAGTDQK
KSGSTSCLLCKKGKYNNKPGNPCLPCKYGYFAAIAGNIKCYICPAGFYCQ
YANEIPTSCPKHYTCPQGSIYPKSCGPLLQGTNTPSCTPSVELIVLICVT
SIVALFVIVIIIYAIRKKRGRYLYRGLSNTFSEPSPFVSRKNTSIYSGY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR011641Tyr-kin_ephrin_A/B_rcpt-like
IPR009030Growth_fac_rcpt_cys_sf
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
GO:0042802identical protein binding
GO:0046982protein heterodimerization activity
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005615extracellular space
GO:0005886plasma membrane
GO:0009897external side of plasma membrane
GO:0009986cell surface
GO:0016020membrane
GO:0019897extrinsic component of plasma membrane
Vocabulary: biological process
TermDefinition
GO:0006954inflammatory response
GO:0007165signal transduction
GO:0007512adult heart development
GO:0007596blood coagulation
GO:0009791post-embryonic development
GO:0030154cell differentiation
GO:0045446endothelial cell differentiation
GO:0045880positive regulation of smoothened signaling pathway
GO:0051260protein homooligomerization
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011641Tyrosine-protein kinase ephrin type A/B receptor-likeSMARTSM01411GCC2_GCC3_2coord: 61..109
e-value: 4.2E-9
score: 46.2
coord: 112..160
e-value: 3.1E-8
score: 43.4
coord: 19..58
e-value: 0.014
score: 24.6
coord: 163..209
e-value: 0.0026
score: 27.0
IPR011641Tyrosine-protein kinase ephrin type A/B receptor-likePFAMPF07699Ephrin_rec_likecoord: 112..160
e-value: 2.6E-9
score: 36.7
coord: 61..109
e-value: 1.5E-7
score: 31.0
coord: 28..69
e-value: 1.4E-6
score: 27.9
NoneNo IPR availableGENE3DG3DSA:2.10.50.10coord: 71..118
e-value: 3.5E-11
score: 44.9
coord: 119..172
e-value: 1.0E-8
score: 37.1
coord: 25..70
e-value: 1.1E-6
score: 30.5
NoneNo IPR availablePANTHERPTHR46967FAMILY NOT NAMEDcoord: 72..210
coord: 22..131
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.724
NoneNo IPR availableTMHMMTMhelixcoord: 9..31
NoneNo IPR availableTMHMMTMhelixcoord: 243..265
IPR009030Growth factor receptor cysteine-rich domain superfamilySUPERFAMILYSSF57184Growth factor receptor domaincoord: 6..146
IPR009030Growth factor receptor cysteine-rich domain superfamilySUPERFAMILYSSF57184Growth factor receptor domaincoord: 104..221