Glutamate receptor ionotropic

Overview
NameGlutamate receptor ionotropic
Smed IDSMED30029127
Length (bp)3097
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glutamate receptor ionotropic (SMED30029127) t-SNE clustered cells

Violin plots show distribution of expression levels for Glutamate receptor ionotropic (SMED30029127) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glutamate receptor ionotropic (SMED30029127) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glutamate receptor ionotropic (SMED30029127) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029127

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30029127SMESG000022851.1 SmedASXL_015563SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30029127SMESG000022851.1 dd_Smed_v4_14655_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30029127SMESG000022851.1 dd_Smed_v4_14655_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30029127SMESG000022851.1 dd_Smed_v6_14655_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glutamate receptor ionotropic vs. Ensembl Human
Match: GRIK2 (glutamate ionotropic receptor kainate type subunit 2 [Source:HGNC Symbol;Acc:HGNC:4580])

HSP 1 Score: 398.282 bits (1022), Expect = 2.077e-123
Identity = 216/471 (45.86%), Postives = 311/471 (66.03%), Query Frame = 1
Query: 1321 DFNFESIYLGESHLERISYWSKKAGFKPILNRAETMRDR---LLTQIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPC---FNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKS-DHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIE 2709
            DF+ + I L E  LE+I  W   +G    LN  E+ + +   +   + N++  VTT+ + P+V++++ D+   PL GNDRF G  +DLLR LS +  F Y I  V+D  YG+ ++  G+WNGM+ ELI+++ADLAVA L ITY RE+VIDF+ P+M+LG+SI+ +K   +   +  F+ PLS ++W+ +L AY+ VS  LF++ R +PYEWY  HPC    + VEN F++LNSFWF VG+LMQQG ++ PKA STR++G IWWFF LI+ISSYTANLAAFLT+ER+++ I S ++L+ Q K++YG +  G+T +FFK S ISTY KMW FM S   S+ V +  +GIQ+VL  +YAF++EST  E+  QRNCNL  +GGL+DS+GY +G P G+   RD ++ +IL+LQ+E  L   +  W  R N    C E  +   +    LG++ +GG F  L  GL +S  V+  E
Sbjct:  348 DFDLDVISLKEEGLEKIGTWDPASG----LNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDK---PLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDANGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSP-YRDKITIAILQLQEEGKLHMMKEKW-WRGN---GCPEEESKEAS---ALGVQNIGGIFIVLAAGLVLSVFVAVGE 803          
BLAST of Glutamate receptor ionotropic vs. Ensembl Human
Match: GRIK2 (glutamate ionotropic receptor kainate type subunit 2 [Source:HGNC Symbol;Acc:HGNC:4580])

HSP 1 Score: 399.053 bits (1024), Expect = 2.098e-123
Identity = 216/471 (45.86%), Postives = 311/471 (66.03%), Query Frame = 1
Query: 1321 DFNFESIYLGESHLERISYWSKKAGFKPILNRAETMRDR---LLTQIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPC---FNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKS-DHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIE 2709
            DF+ + I L E  LE+I  W   +G    LN  E+ + +   +   + N++  VTT+ + P+V++++ D+   PL GNDRF G  +DLLR LS +  F Y I  V+D  YG+ ++  G+WNGM+ ELI+++ADLAVA L ITY RE+VIDF+ P+M+LG+SI+ +K   +   +  F+ PLS ++W+ +L AY+ VS  LF++ R +PYEWY  HPC    + VEN F++LNSFWF VG+LMQQG ++ PKA STR++G IWWFF LI+ISSYTANLAAFLT+ER+++ I S ++L+ Q K++YG +  G+T +FFK S ISTY KMW FM S   S+ V +  +GIQ+VL  +YAF++EST  E+  QRNCNL  +GGL+DS+GY +G P G+   RD ++ +IL+LQ+E  L   +  W  R N    C E  +   +    LG++ +GG F  L  GL +S  V+  E
Sbjct:  348 DFDLDVISLKEEGLEKIGTWDPASG----LNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDK---PLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDANGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSP-YRDKITIAILQLQEEGKLHMMKEKW-WRGN---GCPEEESKEAS---ALGVQNIGGIFIVLAAGLVLSVFVAVGE 803          
BLAST of Glutamate receptor ionotropic vs. Ensembl Human
Match: GRIK2 (glutamate ionotropic receptor kainate type subunit 2 [Source:HGNC Symbol;Acc:HGNC:4580])

HSP 1 Score: 399.438 bits (1025), Expect = 2.444e-123
Identity = 227/514 (44.16%), Postives = 335/514 (65.18%), Query Frame = 1
Query: 1321 DFNFESIYLGESHLERISYWSKKAGFKPILNRAETMRDR---LLTQIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPC---FNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKS-DHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIEMTIWAXXXXXXXXXXXVYDVIDSQIKMAFGQCHR---FKPNSP 2829
            DF+ + I L E  LE+I  W   +G    LN  E+ + +   +   + N++  VTT+ + P+V++++ D+   PL GNDRF G  +DLLR LS +  F Y I  V+D  YG+ ++  G+WNGM+ ELI+++ADLAVA L ITY RE+VIDF+ P+M+LG+SI+ +K   +   +  F+ PLS ++W+ +L AY+ VS  LF++ R +PYEWY  HPC    + VEN F++LNSFWF VG+LMQQG ++ PKA STR++G IWWFF LI+ISSYTANLAAFLT+ER+++ I S ++L+ Q K++YG +  G+T +FFK S ISTY KMW FM S   S+ V +  +GIQ+VL  +YAF++EST  E+  QRNCNL  +GGL+DS+GY +G P G+   RD ++ +IL+LQ+E  L   +  W  R N    C E  +   +    LG++ +GG F  L  GL +S  V+  E  ++ SK++ + +KRS    +  +++M+  +C R    KP +P
Sbjct:  348 DFDLDVISLKEEGLEKIGTWDPASG----LNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDK---PLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDANGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSP-YRDKITIAILQLQEEGKLHMMKEKW-WRGN---GCPEEESKEAS---ALGVQNIGGIFIVLAAGLVLSVFVAVGEF-LYKSKKNAQLEKRSFCSAMVEELRMSL-KCQRRLKHKPQAP 844          
BLAST of Glutamate receptor ionotropic vs. Ensembl Human
Match: GRIK2 (glutamate ionotropic receptor kainate type subunit 2 [Source:HGNC Symbol;Acc:HGNC:4580])

HSP 1 Score: 399.438 bits (1025), Expect = 5.415e-123
Identity = 227/514 (44.16%), Postives = 335/514 (65.18%), Query Frame = 1
Query: 1321 DFNFESIYLGESHLERISYWSKKAGFKPILNRAETMRDR---LLTQIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPC---FNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKS-DHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIEMTIWAXXXXXXXXXXXVYDVIDSQIKMAFGQCHR---FKPNSP 2829
            DF+ + I L E  LE+I  W   +G    LN  E+ + +   +   + N++  VTT+ + P+V++++ D+   PL GNDRF G  +DLLR LS +  F Y I  V+D  YG+ ++  G+WNGM+ ELI+++ADLAVA L ITY RE+VIDF+ P+M+LG+SI+ +K   +   +  F+ PLS ++W+ +L AY+ VS  LF++ R +PYEWY  HPC    + VEN F++LNSFWF VG+LMQQG ++ PKA STR++G IWWFF LI+ISSYTANLAAFLT+ER+++ I S ++L+ Q K++YG +  G+T +FFK S ISTY KMW FM S   S+ V +  +GIQ+VL  +YAF++EST  E+  QRNCNL  +GGL+DS+GY +G P G+   RD ++ +IL+LQ+E  L   +  W  R N    C E  +   +    LG++ +GG F  L  GL +S  V+  E  ++ SK++ + +KRS    +  +++M+  +C R    KP +P
Sbjct:  386 DFDLDVISLKEEGLEKIGTWDPASG----LNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDK---PLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDANGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSP-YRDKITIAILQLQEEGKLHMMKEKW-WRGN---GCPEEESKEAS---ALGVQNIGGIFIVLAAGLVLSVFVAVGEF-LYKSKKNAQLEKRSFCSAMVEELRMSL-KCQRRLKHKPQAP 882          
BLAST of Glutamate receptor ionotropic vs. Ensembl Human
Match: GRIK2 (glutamate ionotropic receptor kainate type subunit 2 [Source:HGNC Symbol;Acc:HGNC:4580])

HSP 1 Score: 398.282 bits (1022), Expect = 6.544e-123
Identity = 216/471 (45.86%), Postives = 311/471 (66.03%), Query Frame = 1
Query: 1321 DFNFESIYLGESHLERISYWSKKAGFKPILNRAETMRDR---LLTQIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPC---FNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKS-DHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIE 2709
            DF+ + I L E  LE+I  W   +G    LN  E+ + +   +   + N++  VTT+ + P+V++++ D+   PL GNDRF G  +DLLR LS +  F Y I  V+D  YG+ ++  G+WNGM+ ELI+++ADLAVA L ITY RE+VIDF+ P+M+LG+SI+ +K   +   +  F+ PLS ++W+ +L AY+ VS  LF++ R +PYEWY  HPC    + VEN F++LNSFWF VG+LMQQG ++ PKA STR++G IWWFF LI+ISSYTANLAAFLT+ER+++ I S ++L+ Q K++YG +  G+T +FFK S ISTY KMW FM S   S+ V +  +GIQ+VL  +YAF++EST  E+  QRNCNL  +GGL+DS+GY +G P G+   RD ++ +IL+LQ+E  L   +  W  R N    C E  +   +    LG++ +GG F  L  GL +S  V+  E
Sbjct:  386 DFDLDVISLKEEGLEKIGTWDPASG----LNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDK---PLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDANGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSP-YRDKITIAILQLQEEGKLHMMKEKW-WRGN---GCPEEESKEAS---ALGVQNIGGIFIVLAAGLVLSVFVAVGE 841          
BLAST of Glutamate receptor ionotropic vs. Ensembl Celegans
Match: glr-3 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q21415])

HSP 1 Score: 344.739 bits (883), Expect = 8.290e-104
Identity = 181/425 (42.59%), Postives = 270/425 (63.53%), Query Frame = 1
Query: 1450 IHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXX-XQFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVK---HPCFNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKSDHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIEM 2712
            +  K  +++   + PFVM          +  N  + G  +DLL  ++ + +F Y I +V+D  YGS  E+ GKW+GM+GEL   +ADLAVASLTI+Y R  VIDFT P+M LG+SI+ KK         +FM PLST VW+M   +Y VVS+ ++++ +++PYE + +   +  +  V+NQFS+ NSFWFTV SLMQQG ++ P+A STR++  IWWFF LI+ISSYTANLAA LT  R++  I + ++L+ Q K+KYGT+  GST SFF  S I TY++MW  M S   LFV ++ +GI +V   +YA+++ES++ EY  +R+C LM +GGL+D +GY IGLP G+   R+L+S +ILRLQ++  L   +  W    ++   C       P  ++Q   E +GG F  L++GL ++ ++   E+
Sbjct:  398 LEGKHLKISVYLEAPFVM----------ITSNGSYEGYCIDLLHKIANILKFTYTIQKVRDNAYGS-KESNGKWSGMVGELQRGDADLAVASLTISYGRSEVIDFTVPYMHLGISILFKKPRIRDSDWFKFMDPLSTQVWIMTFASYFVVSVAIWIIAKISPYEQFERDEDNGQYKPVDNQFSLRNSFWFTVCSLMQQGSELCPRAASTRLLTGIWWFFALILISSYTANLAAVLTTRRMETPIENADDLAAQTKIKYGTLGRGSTMSFFNESKIETYERMWQLMSSSPGLFVQSSKEGIARVKSSDYAYLMESSMLEYAVERDCELMQIGGLIDQKGYGIGLPKGSP-YRELISTAILRLQEKTELTELKEKWWKDKSVV--C-----EQPKRKDQDDGESIGGIFIILVVGLVLTAVLVIFEL 803          
BLAST of Glutamate receptor ionotropic vs. Ensembl Celegans
Match: glr-4 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q17697])

HSP 1 Score: 331.643 bits (849), Expect = 1.458e-98
Identity = 183/469 (39.02%), Postives = 286/469 (60.98%), Query Frame = 1
Query: 1354 SHLERISYWSKKAGF---KPILNRAETMRDRLLTQIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXXQ---FMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWY----VKHPCFNKVENQ---FSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKSDH-SLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIEMTI 2718
            S   ++  WS+K G+       NR E   D     +     RV    + PFV+            G +++ G  +DLL  ++++ +FNY I  V+D TYG + + +G+WNG+IG L  +EADL+++++TITY R  V+DFT P+M LG+SI++ ++   T       F+ PLS  VW+ +L +Y +VS ++ ++ + +PYEWY    +    F  ++NQ   F+VLNSFWFT+GSLMQQG D+ P+A +TR+I  +WW F  I+ISSYTA LAAFLT+ER+   I S ++L+ Q K++YG +  GST  FF+ S I  Y++MW+ M+S    +FV+++ +GI +V  G YA+++ES++ EYY +R+C L  +GGLLDS+GY I LP G+  LRD+LS ++L+LQ+  +LE+ +  W        SC    +   T       + + G F+ L+ GL V+ +++C E  I
Sbjct:  370 SQFVKLGNWSEKRGWNFDSRYANRWEFDIDPDSEDLEGLHLRVVVYLEEPFVIK----------TGENQYEGFCIDLLNEMTQVLKFNYTIIEVQDGTYG-IEDESGRWNGIIGALQRHEADLSLSAVTITYSRAEVVDFTLPFMHLGISILLARTSEETDKGSLWTFLEPLSLTVWISLLISYCIVSYSMHILAKFSPYEWYNLERIDERDFENIKNQKNQFTVLNSFWFTMGSLMQQGSDVIPRAAATRLIAVVWWMFTQIIISSYTAQLAAFLTVERMSTPIESTQDLANQQKIRYGVLKSGSTMDFFRESKIPMYERMWSVMESSSPGVFVNSSREGIARVKSGGYAYMMESSMLEYYLERDCELQSIGGLLDSKGYGIALPKGSP-LRDILSRTVLQLQERTILEALKNKWWRDRREGPSCGPPPSEKATNSKP---QNIFGIFYVLLTGLIVAFLLACGEYCI 823          
BLAST of Glutamate receptor ionotropic vs. Ensembl Celegans
Match: glr-4 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q17697])

HSP 1 Score: 332.413 bits (851), Expect = 3.271e-98
Identity = 183/469 (39.02%), Postives = 286/469 (60.98%), Query Frame = 1
Query: 1354 SHLERISYWSKKAGF---KPILNRAETMRDRLLTQIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXXQ---FMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWY----VKHPCFNKVENQ---FSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKSDH-SLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIEMTI 2718
            S   ++  WS+K G+       NR E   D     +     RV    + PFV+            G +++ G  +DLL  ++++ +FNY I  V+D TYG + + +G+WNG+IG L  +EADL+++++TITY R  V+DFT P+M LG+SI++ ++   T       F+ PLS  VW+ +L +Y +VS ++ ++ + +PYEWY    +    F  ++NQ   F+VLNSFWFT+GSLMQQG D+ P+A +TR+I  +WW F  I+ISSYTA LAAFLT+ER+   I S ++L+ Q K++YG +  GST  FF+ S I  Y++MW+ M+S    +FV+++ +GI +V  G YA+++ES++ EYY +R+C L  +GGLLDS+GY I LP G+  LRD+LS ++L+LQ+  +LE+ +  W        SC    +   T       + + G F+ L+ GL V+ +++C E  I
Sbjct:  370 SQFVKLGNWSEKRGWNFDSRYANRWEFDIDPDSEDLEGLHLRVVVYLEEPFVIK----------TGENQYEGFCIDLLNEMTQVLKFNYTIIEVQDGTYG-IEDESGRWNGIIGALQRHEADLSLSAVTITYSRAEVVDFTLPFMHLGISILLARTSEETDKGSLWTFLEPLSLTVWISLLISYCIVSYSMHILAKFSPYEWYNLERIDERDFENIKNQKNQFTVLNSFWFTMGSLMQQGSDVIPRAAATRLIAVVWWMFTQIIISSYTAQLAAFLTVERMSTPIESTQDLANQQKIRYGVLKSGSTMDFFRESKIPMYERMWSVMESSSPGVFVNSSREGIARVKSGGYAYMMESSMLEYYLERDCELQSIGGLLDSKGYGIALPKGSP-LRDILSRTVLQLQERTILEALKNKWWRDRREGPSCGPPPSEKATNSKP---QNIFGIFYVLLTGLIVAFLLACGEYCI 823          
BLAST of Glutamate receptor ionotropic vs. Ensembl Celegans
Match: glr-1 (Glutamate receptor 1 [Source:UniProtKB/Swiss-Prot;Acc:P34299])

HSP 1 Score: 291.967 bits (746), Expect = 1.178e-83
Identity = 190/513 (37.04%), Postives = 283/513 (55.17%), Query Frame = 1
Query: 1201 NKTLGKRSGFISPFSWFDEFNVSLANDVKVFTDPNLNYCFDFNFESIYLGESHLERISYWSKKAGFKPILNRAETMRDRLLTQIHNKTFRVTTLEDPPFVMYREFDEHG--APLKGNDRFIGMAMDLLRALSE-MKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPCFNK--VENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKSD-HSLFVDNTAKGIQKVLD--GNYAFILESTLNEYYCQRN-CNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIE 2709
            N  +G + G ++    FD F      DV +  D   N    FN + +            W +  GF      A+  R        N+   +T L  P  ++ RE  E       +GN++F G  +DLL+ L++ ++ FNY    +K  T     +  G W+GMIGEL++  A   VASLTI  +RERV+DF+ P+M+ G+SI+IKK       +  FM PLST +W+ ++ AYI VS+ +FLV R +PYEW V+        + N FSV N  WFT+ + MQQG DI P++ S R+  + WWFF +I++SSYTANLAAFLT+E++Q  I SVE+L+ Q K+KYG   GGST SFFK S++  Y++MW +M+S    +FV + A+GI++V    G YAF+LE+T NEY   R  C+ M +G  L+S GY I  P G++  +D ++ +IL LQ+   L+     W        +       + +    L L K+ G F+ L+ G+ +S + +  E
Sbjct:  384 NMKIGHKEGTLTGNIEFDRFGNRKNFDVSI-VDLVSNTKATFNSKEVLA----------WRQGVGFFSNRTVAQHSRKSQNDHKDNQVIVLTNLVAPFVMIKRECLEMANLTECQGNNKFEGFCIDLLKLLADKIEEFNY---EIKLGTKAGSKQADGSWDGMIGELLSGRAHAVVASLTINQERERVVDFSKPFMTTGISIMIKKPDKQEFSVFSFMQPLSTEIWMYIIFAYIGVSVVIFLVSRFSPYEWRVEETSRGGFTISNDFSVYNCLWFTLAAFMQQGTDILPRSISGRIASSAWWFFTMIIVSSYTANLAAFLTLEKMQAPIESVEDLAKQSKIKYGIQGGGSTASFFKYSSVQIYQRMWRYMESQVPPVFVASYAEGIERVRSHKGRYAFLLEATANEYENTRKPCDTMKVGANLNSIGYGIATPFGSD-WKDHINLAILALQERGELKKLENKWWYDRGQCDAGITVDGSSAS----LNLSKVAGIFYILMGGMVISMLAALGE 877          
BLAST of Glutamate receptor ionotropic vs. Ensembl Celegans
Match: glr-5 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:O01623])

HSP 1 Score: 283.878 bits (725), Expect = 5.853e-81
Identity = 165/473 (34.88%), Postives = 259/473 (54.76%), Query Frame = 1
Query: 1360 LERISYWSKKAGFKPILN---RAETMRDRLLTQIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPCFNKVE------------------NQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKSDHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIEM 2712
            L+ I +W         ++   +A+  R+  ++      FRVTT+ + P+VM ++   +   L  N +F G  +DLL  LS+   F Y IH VKD  YG+     G W+GM+GE++  EA++AVA LT+ Y R   +DFT P++SLG+SI+ K        L  F+ PLS  +W  +  + I V++ ++ V  +TPYEW +   C    E                  N +S  N+ W+ + ++++ GCD  P+A STR++G  WW F L++IS+YTANLAA LT+ R    I ++++L+ Q  + YGTI GGST  FF+ S I+ + KMW +MK D  +FV +  KG+++ L  NYA+++EST  EY  Q+NCNL  +GG+L S+GY I L   +    D +S  IL   K  ++E  +  W    +   +C   ++     R  L +  + G F  L +G+ ++ IV   E+
Sbjct:  401 LDDIGFWEPATNVHVNMSGDSKAQLQRNVQVSDELKPHFRVTTIMERPYVMLKK---NHYELDANSKFEGFCIDLLAELSKDLGFTYTIHAVKDGKYGNDKYGNGSWDGMMGEILRGEAEMAVAPLTVNYRRSEAVDFTKPFLSLGISILYKVPDDQQPDLFSFLNPLSWQIWTAIATSIITVTLGMYFVANVTPYEWNLNFSCCTAHEPHPAAAFATNQEAPIVMSNNYSFWNTVWYVLSTMLKGGCDFGPRAVSTRLLGGTWWVFYLVIISAYTANLAAVLTVSRPYIPIKNLDDLANQTTISYGTIRGGSTMQFFQESRIAAHVKMWQYMK-DKDVFVTSNGKGVERALSMNYAYLMESTSLEYETQQNCNLTQIGGVLGSKGYGIALAKKSE-WTDRISRQILLYAKRGIIEMKKTKWW--RSKGAACASTASAVKHDRFALSMYNVAGLFITLGVGIVLAAIVVIFEL 866          
BLAST of Glutamate receptor ionotropic vs. Ensembl Fly
Match: KaiR1D (gene:FBgn0038837 transcript:FBtr0083987)

HSP 1 Score: 384.415 bits (986), Expect = 2.861e-118
Identity = 208/477 (43.61%), Postives = 304/477 (63.73%), Query Frame = 1
Query: 1321 DFNFESIYLGESHLERISYWSKKAGFKPILNRAETMRDRLL-TQIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPCF-----NKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKSDH-SLFVDNTAKGIQKVL--DGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIEMTIW 2721
            DF  + + L  + + +I  W+          R  + + + +   + NKT  VTT+   P+ M +E      PL GND+F G A+DL+  +S+   FNY I  V D +YGSLN+ TG+WNGMI EL+   ADLA+A LTIT++RE+ +DFTTP+M+LG+SI+ +K I     L  F++PLS +VW+ M  AY+ VS+ LF++ + TPYEW    P +      KVE+QF++LN  WF +GSLMQQGCD  PKA STRM+  IWWFF LIMISSYTANLAAFLT+ER+ + I S E+L+ Q ++KYG + GGST +FF++S ISTY++MW+FM+S   S+F  +  +G+++V    G+YAF++EST  EY  +RNC L  +GG+LD++ Y I  P  N+  R  ++  IL+LQ+E  L   +  W         C   ++ + +  N+LGL  +GG F  L+ G+ V+C+++  E  +W
Sbjct:  369 DFMLDIVELTPAGIRKIGTWNSTLPDGINFTRTFSQKQQEIEANLKNKTLVVTTILSNPYCMRKE---SAIPLSGNDQFEGYAVDLIHEISKSLGFNYKIQLVPDGSYGSLNKLTGEWNGMIRELLEQRADLAIADLTITFEREQAVDFTTPFMNLGVSILYRKPIKQPPNLFSFLSPLSLDVWIYMATAYLGVSVLLFILAKFTPYEW----PAYTDAHGEKVESQFTLLNCMWFAIGSLMQQGCDFLPKALSTRMVAGIWWFFTLIMISSYTANLAAFLTVERMDSPIESAEDLAKQTRIKYGALKGGSTAAFFRDSKISTYQRMWSFMESARPSVFTASNGEGVERVAKGKGSYAFLMESTSIEYVTERNCELTQVGGMLDTKSYGIATPP-NSPYRTAINSVILKLQEEGKLHILKTKWWKEKRGGGKCRVETSKSSSAANELGLANVGGVFVVLMGGMGVACVIAVCEF-VW 836          
BLAST of Glutamate receptor ionotropic vs. Ensembl Fly
Match: CG11155 (gene:FBgn0039927 transcript:FBtr0333701)

HSP 1 Score: 378.252 bits (970), Expect = 2.094e-115
Identity = 264/755 (34.97%), Postives = 403/755 (53.38%), Query Frame = 1
Query:  712 LRDLVYSDQHV---WNEALIIYDQS-QVFSTFRNVMETTEKVFHFRHWTSDRATNA-RIIKNFRHVRTFIVDMNDKNVHSFFLLAAGLQL----LNAMTTTVIIMDRDNLIESIRDFAFMAANITVIRPTLYDSKLFKTISN---KINYQKID------FPQKIVKVLLQHLYLVMNNQKGNKTLGKRSGFISPFS------WFDEFNVSLANDVKVFTDPNLNYCFDF--------NFESIYLGESHLERISYWSKKAGFKPILNRAETMRDRLLTQIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPCFNK---VENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKSDH-SLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIEMTIWAXXXXXXXXXXXVYDVIDSQIKMAFGQCH----RFKPNSPST-NSSSI 2850
            L  L Y D  V   W +  IIY++   +F+   +  ET  +++  R  + D      R I+  + +   IVD N  ++ SFF     LQ+     + M TT  +   D     + DF + + NIT  R    DSK +  + N   K+ +  +D      + Q    ++   +Y   N          ++ +I   S      W D   +SL N +       L     F          + + L +  ++++ YW    G    ++      D   + I N T  V T E+ P+VM +E D++   L GN RF G  +DLL+A++    F Y I  V D  YG     T  WNG++ EL+   ADLAVAS+TI Y RE VIDFT P+M+LG+ I+ K   S    L  FM PL+  +WL +L AYI+VS  LF++ R +PYEW   HPC+ +   VENQFS+ NSFWF  G+ ++QG  ++PKATSTR++G  W+FF LI+ISSYTANLAAFLT+ER+ + I S  +L+ Q ++ YGT+ GGST +FF++S I  Y+KMW +M++   ++FV     GI++V++G+YAF++EST+ +Y  QR+CNL  +GGLLDS+GY I  P G+   RD +S +IL LQ++ +++     W    N    C        +  N LG+E +GG F  L+ GL ++ +V+  E   W S++++  + +S+   +  +++ A   CH    R +P   S  N SS+
Sbjct:  158 LLTLAYRDIMVYLNWTKVAIIYEEDYGLFNLMHSSTETKAEMY-IRQASPDSYRQVLRAIRQ-KEIYKIIVDTNPSHIKSFFRSILQLQMNDHRYHYMFTTFDLETYD-----LEDFRYNSVNITAFRLVDVDSKRYLEVINQMQKLQHNGLDTINGSPYIQTESALMFDSVYAFANGLHFLNLDNHQNFYIKNLSCTSDQTWND--GISLYNQINAAITDGLTGTVQFVEGRRNIFKLDILKLKQEKIQKVGYWHPDDGVN--ISDPTAFYD---SNIANITLVVMTREERPYVMVKE-DKN---LTGNLRFEGFCIDLLKAIATQVGFQYKIELVPDNMYGVYIPETNSWNGIVQELMERRADLAVASMTINYARESVIDFTKPFMNLGIGILFKVPTSQPTRLFSFMNPLAIEIWLYVLAAYILVSFALFVMARFSPYEWKNPHPCYKETDIVENQFSISNSFWFITGTFLRQGSGLNPKATSTRIVGGCWFFFCLIIISSYTANLAAFLTVERMISPIESASDLAEQTEISYGTLEGGSTMTFFRDSKIGIYQKMWRYMENRKTAVFVKTYEDGIKRVMEGSYAFLMESTMLDYAVQRDCNLTQIGGLLDSKGYGIATPKGSP-WRDKISLAILELQEKGIIQILYDKWW--KNTGDVCNRDDKSKESKANALGVENIGGVFVVLLCGLALAVVVAIFEFC-WNSRKNLNTENQSLCSEMAEELRFAM-HCHGSKSRHRPRKRSCLNCSSV 889          
BLAST of Glutamate receptor ionotropic vs. Ensembl Fly
Match: CG11155 (gene:FBgn0039927 transcript:FBtr0089195)

HSP 1 Score: 378.252 bits (970), Expect = 2.094e-115
Identity = 264/755 (34.97%), Postives = 403/755 (53.38%), Query Frame = 1
Query:  712 LRDLVYSDQHV---WNEALIIYDQS-QVFSTFRNVMETTEKVFHFRHWTSDRATNA-RIIKNFRHVRTFIVDMNDKNVHSFFLLAAGLQL----LNAMTTTVIIMDRDNLIESIRDFAFMAANITVIRPTLYDSKLFKTISN---KINYQKID------FPQKIVKVLLQHLYLVMNNQKGNKTLGKRSGFISPFS------WFDEFNVSLANDVKVFTDPNLNYCFDF--------NFESIYLGESHLERISYWSKKAGFKPILNRAETMRDRLLTQIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPCFNK---VENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKSDH-SLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIEMTIWAXXXXXXXXXXXVYDVIDSQIKMAFGQCH----RFKPNSPST-NSSSI 2850
            L  L Y D  V   W +  IIY++   +F+   +  ET  +++  R  + D      R I+  + +   IVD N  ++ SFF     LQ+     + M TT  +   D     + DF + + NIT  R    DSK +  + N   K+ +  +D      + Q    ++   +Y   N          ++ +I   S      W D   +SL N +       L     F          + + L +  ++++ YW    G    ++      D   + I N T  V T E+ P+VM +E D++   L GN RF G  +DLL+A++    F Y I  V D  YG     T  WNG++ EL+   ADLAVAS+TI Y RE VIDFT P+M+LG+ I+ K   S    L  FM PL+  +WL +L AYI+VS  LF++ R +PYEW   HPC+ +   VENQFS+ NSFWF  G+ ++QG  ++PKATSTR++G  W+FF LI+ISSYTANLAAFLT+ER+ + I S  +L+ Q ++ YGT+ GGST +FF++S I  Y+KMW +M++   ++FV     GI++V++G+YAF++EST+ +Y  QR+CNL  +GGLLDS+GY I  P G+   RD +S +IL LQ++ +++     W    N    C        +  N LG+E +GG F  L+ GL ++ +V+  E   W S++++  + +S+   +  +++ A   CH    R +P   S  N SS+
Sbjct:  158 LLTLAYRDIMVYLNWTKVAIIYEEDYGLFNLMHSSTETKAEMY-IRQASPDSYRQVLRAIRQ-KEIYKIIVDTNPSHIKSFFRSILQLQMNDHRYHYMFTTFDLETYD-----LEDFRYNSVNITAFRLVDVDSKRYLEVINQMQKLQHNGLDTINGSPYIQTESALMFDSVYAFANGLHFLNLDNHQNFYIKNLSCTSDQTWND--GISLYNQINAAITDGLTGTVQFVEGRRNIFKLDILKLKQEKIQKVGYWHPDDGVN--ISDPTAFYD---SNIANITLVVMTREERPYVMVKE-DKN---LTGNLRFEGFCIDLLKAIATQVGFQYKIELVPDNMYGVYIPETNSWNGIVQELMERRADLAVASMTINYARESVIDFTKPFMNLGIGILFKVPTSQPTRLFSFMNPLAIEIWLYVLAAYILVSFALFVMARFSPYEWKNPHPCYKETDIVENQFSISNSFWFITGTFLRQGSGLNPKATSTRIVGGCWFFFCLIIISSYTANLAAFLTVERMISPIESASDLAEQTEISYGTLEGGSTMTFFRDSKIGIYQKMWRYMENRKTAVFVKTYEDGIKRVMEGSYAFLMESTMLDYAVQRDCNLTQIGGLLDSKGYGIATPKGSP-WRDKISLAILELQEKGIIQILYDKWW--KNTGDVCNRDDKSKESKANALGVENIGGVFVVLLCGLALAVVVAIFEFC-WNSRKNLNTENQSLCSEMAEELRFAM-HCHGSKSRHRPRKRSCLNCSSV 889          
BLAST of Glutamate receptor ionotropic vs. Ensembl Fly
Match: Ekar (gene:FBgn0039916 transcript:FBtr0110906)

HSP 1 Score: 336.265 bits (861), Expect = 6.303e-100
Identity = 184/423 (43.50%), Postives = 269/423 (63.59%), Query Frame = 1
Query: 1456 NKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPCFNK---VENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKSDH-SLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIE 2709
            N T  V T+ + P+VM      +G    GN+RF G  +D+L  +S    F+Y++  V D  YG+ +  TG+WNGM+ +L+  +ADLAV S+TITY RE VIDFT P+M+LG+SI+ K   S    L  FM PL+  +W+ +L AY +VS+ +++VG+++P EW   + C  +   + NQFS+ +SFWFT+G+ MQQ  DI P+A STR+I + W FF LI+++SYTANLAAFLT ER+ N I + E+L+ Q ++ YGT+  GST +FF++S I TYKK+W  M +   S F      GI++V  GNYAF++EST+ +Y  QR+CNL  +GGLLD++GY I  P G+   RD +S +IL LQ+   ++     W    N  ++C   +    +  N LGLE +GG F  LI G+ V+ +V+  E
Sbjct:  402 NVTLVVITILETPYVMMH----YGKNFTGNERFYGFCVDILETISREVGFDYILDLVPDRKYGAKDPETGEWNGMVAQLMKYKADLAVGSMTITYARESVIDFTKPFMNLGISILFKVPTSEPTRLFSFMNPLAIEIWIYVLIAYFLVSLCIYIVGKLSPIEWKCINACDLENISIGNQFSLTDSFWFTIGTFMQQSPDIYPRAMSTRIISSTWGFFSLIIVASYTANLAAFLTTERMINPIENAEDLASQTEISYGTLDSGSTMTFFRDSVIETYKKIWRSMDNKKPSAFTTTYEDGIKRVNQGNYAFLMESTMLDYIVQRDCNLTQIGGLLDTKGYGIATPKGSP-WRDKISLAILELQERGDIQMLYDKWW--KNTDETCTRKNTSKQSKANSLGLESIGGVFVVLIAGIIVAAVVAFFE 817          
BLAST of Glutamate receptor ionotropic vs. Ensembl Fly
Match: Ekar (gene:FBgn0039916 transcript:FBtr0344874)

HSP 1 Score: 331.257 bits (848), Expect = 3.780e-98
Identity = 184/423 (43.50%), Postives = 268/423 (63.36%), Query Frame = 1
Query: 1456 NKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPCFNK---VENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKSDH-SLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIE 2709
            N T  V T+ + P+VM      +G    GN+RF G  +D+L  +S    F+Y++  V D  YG+ +  TG+WNGM+ +L+   ADLAV S+TITY RE VIDFT P+M+LG+SI+ K   S    L  FM PL+  +W+ +L AY +VS+ +++VG+++P EW   + C  +   + NQFS+ +SFWFT+G+ MQQ  DI P+A STR+I + W FF LI+++SYTANLAAFLT ER+ N I + E+L+ Q ++ YGT+  GST +FF++S I TYKK+W  M +   S F      GI++V  GNYAF++EST+ +Y  QR+CNL  +GGLLD++GY I  P G+   RD +S +IL LQ+   ++     W    N  ++C   +    +  N LGLE +GG F  LI G+ V+ +V+  E
Sbjct:  402 NVTLVVITILETPYVMMH----YGKNFTGNERFYGFCVDILETISREVGFDYILDLVPDRKYGAKDPETGEWNGMVAQLMK-YADLAVGSMTITYARESVIDFTKPFMNLGISILFKVPTSEPTRLFSFMNPLAIEIWIYVLIAYFLVSLCIYIVGKLSPIEWKCINACDLENISIGNQFSLTDSFWFTIGTFMQQSPDIYPRAMSTRIISSTWGFFSLIIVASYTANLAAFLTTERMINPIENAEDLASQTEISYGTLDSGSTMTFFRDSVIETYKKIWRSMDNKKPSAFTTTYEDGIKRVNQGNYAFLMESTMLDYIVQRDCNLTQIGGLLDTKGYGIATPKGSP-WRDKISLAILELQERGDIQMLYDKWW--KNTDETCTRKNTSKQSKANSLGLESIGGVFVVLIAGIIVAAVVAFFE 816          
BLAST of Glutamate receptor ionotropic vs. Ensembl Zebrafish
Match: GRIK2 (glutamate receptor, ionotropic, kainate 2 [Source:NCBI gene;Acc:556013])

HSP 1 Score: 397.512 bits (1020), Expect = 1.686e-122
Identity = 214/471 (45.44%), Postives = 312/471 (66.24%), Query Frame = 1
Query: 1321 DFNFESIYLGESHLERISYWSKKAGFKPILNRAETMRDR---LLTQIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPC---FNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKS-DHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIE 2709
            DF+ + I L E  LE+I  W   +G    LN  E  + +   +   + N++  V+T+ + P+VM+++ D+   PL GNDRF G  +DLLR L+ +  F Y +  V+D  YG+ +E++G+WNGM+ EL++++ADLAVA L ITY RE+VIDF+ P+M+LG+SI+ +K   +   +  F+ PLS ++W+ +L AY+ VS  LF++ R +PYEWY  HPC    + VEN F++LNSFWF VG+LMQQG ++ PKA STR++G IWWFF LI+ISSYTANLAAFLT+ER+++ I S ++L+ Q K++YG +  GST +FFK + ISTY KMW FM S  HS+ V +  +GI++VL  +YAF++EST  E+  QRNCNL  +GGL+DS+ Y +G P G+   RD ++ +IL+LQ+E  L   +  W  R N    C E  N   +    LG++ +GG F  L  GL +S  V+  E
Sbjct:  386 DFDLDVISLKEEGLEKIGTWDPASG----LNMTENQKGKTANVTDSLSNRSLVVSTILEEPYVMFKKSDK---PLYGNDRFEGYCVDLLRELAAILGFGYELRLVEDGRYGAQDESSGQWNGMVRELMDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGVVEDGSTMTFFKKTKISTYDKMWEFMSSRRHSVMVKSIEEGIERVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKAYGVGTPMGSP-YRDKITIAILQLQEEGKLHMMKEKW-WRGN---GCPEEENKEAS---ALGVQNIGGIFIVLAAGLVLSVFVAVGE 841          
BLAST of Glutamate receptor ionotropic vs. Ensembl Zebrafish
Match: GRIK2 (glutamate receptor, ionotropic, kainate 2 [Source:NCBI gene;Acc:556013])

HSP 1 Score: 397.512 bits (1020), Expect = 1.686e-122
Identity = 214/471 (45.44%), Postives = 312/471 (66.24%), Query Frame = 1
Query: 1321 DFNFESIYLGESHLERISYWSKKAGFKPILNRAETMRDR---LLTQIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPC---FNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKS-DHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIE 2709
            DF+ + I L E  LE+I  W   +G    LN  E  + +   +   + N++  V+T+ + P+VM+++ D+   PL GNDRF G  +DLLR L+ +  F Y +  V+D  YG+ +E++G+WNGM+ EL++++ADLAVA L ITY RE+VIDF+ P+M+LG+SI+ +K   +   +  F+ PLS ++W+ +L AY+ VS  LF++ R +PYEWY  HPC    + VEN F++LNSFWF VG+LMQQG ++ PKA STR++G IWWFF LI+ISSYTANLAAFLT+ER+++ I S ++L+ Q K++YG +  GST +FFK + ISTY KMW FM S  HS+ V +  +GI++VL  +YAF++EST  E+  QRNCNL  +GGL+DS+ Y +G P G+   RD ++ +IL+LQ+E  L   +  W  R N    C E  N   +    LG++ +GG F  L  GL +S  V+  E
Sbjct:  386 DFDLDVISLKEEGLEKIGTWDPASG----LNMTENQKGKTANVTDSLSNRSLVVSTILEEPYVMFKKSDK---PLYGNDRFEGYCVDLLRELAAILGFGYELRLVEDGRYGAQDESSGQWNGMVRELMDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGVVEDGSTMTFFKKTKISTYDKMWEFMSSRRHSVMVKSIEEGIERVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKAYGVGTPMGSP-YRDKITIAILQLQEEGKLHMMKEKW-WRGN---GCPEEENKEAS---ALGVQNIGGIFIVLAAGLVLSVFVAVGE 841          
BLAST of Glutamate receptor ionotropic vs. Ensembl Zebrafish
Match: grik1b (glutamate receptor, ionotropic, kainate 1b [Source:ZFIN;Acc:ZDB-GENE-070821-1])

HSP 1 Score: 380.948 bits (977), Expect = 6.233e-117
Identity = 219/484 (45.25%), Postives = 308/484 (63.64%), Query Frame = 1
Query: 1321 DFNFESIYLGESHLER-------------ISYWSKKAGFKPILNRAETMRDR---LLTQIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPC---FNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKS-DHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIE 2709
            DF+ + I L E  LE+             I  W+   G    LN  ++ +D+   +   + N+T  VTT+ + P+VMY++ D+   PL GNDRF G  +DLL+ LS +  F+Y +  V D  YG+ N+  G+WNGM+ ELI++ ADLAVA LTITY RE+VIDF+ P+M+LG+SI+  K   +   +  F+ PLS ++W+ +L A + VS  LF++ R TPYEWY  HPC    + VEN F+++NS WF VG+LMQQG ++ PKA STR++G IWWFF LI+ISSYTANLAAFLT+ER+ + I S ++L+ Q K++YG +  GST +FFK S ISTY+KMW FM S  ++  V N  +GIQ+VL  +YA ++EST  EY  QRNCNL  +GGL+DS+GY +G P G+   RD ++ +IL+LQ+E  L   +  W  R N    C E  +   +    LG+E +GG F  L  GL +S  V+  E
Sbjct:  348 DFDLDIISLKEDGLEKPLESGRFNKVWKKIGVWNSNTG----LNLTDSNKDKNTNVTDSMANRTLIVTTILENPYVMYKKSDK---PLYGNDRFEGYCLDLLKELSNILGFSYEVKLVTDGKYGAQNDK-GEWNGMVRELIDHVADLAVAPLTITYVREKVIDFSKPFMTLGISILYHKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLINSVWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMDSPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRKNTALVKNNREGIQRVLTTDYALLMESTSIEYISQRNCNLTQIGGLIDSKGYGVGTPIGSP-YRDKVTIAILQLQEEGKLHMMKEKW-WRGN---GCPEEDSKEAS---ALGVENIGGIFIVLAAGLVLSVFVAIGE 815          
BLAST of Glutamate receptor ionotropic vs. Ensembl Zebrafish
Match: grik1b (glutamate receptor, ionotropic, kainate 1b [Source:ZFIN;Acc:ZDB-GENE-070821-1])

HSP 1 Score: 380.563 bits (976), Expect = 1.757e-116
Identity = 219/484 (45.25%), Postives = 308/484 (63.64%), Query Frame = 1
Query: 1321 DFNFESIYLGESHLER-------------ISYWSKKAGFKPILNRAETMRDR---LLTQIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPC---FNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKS-DHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIE 2709
            DF+ + I L E  LE+             I  W+   G    LN  ++ +D+   +   + N+T  VTT+ + P+VMY++ D+   PL GNDRF G  +DLL+ LS +  F+Y +  V D  YG+ N+  G+WNGM+ ELI++ ADLAVA LTITY RE+VIDF+ P+M+LG+SI+  K   +   +  F+ PLS ++W+ +L A + VS  LF++ R TPYEWY  HPC    + VEN F+++NS WF VG+LMQQG ++ PKA STR++G IWWFF LI+ISSYTANLAAFLT+ER+ + I S ++L+ Q K++YG +  GST +FFK S ISTY+KMW FM S  ++  V N  +GIQ+VL  +YA ++EST  EY  QRNCNL  +GGL+DS+GY +G P G+   RD ++ +IL+LQ+E  L   +  W  R N    C E  +   +    LG+E +GG F  L  GL +S  V+  E
Sbjct:  387 DFDLDIISLKEDGLEKPLESGRFNKVWKKIGVWNSNTG----LNLTDSNKDKNTNVTDSMANRTLIVTTILENPYVMYKKSDK---PLYGNDRFEGYCLDLLKELSNILGFSYEVKLVTDGKYGAQNDK-GEWNGMVRELIDHVADLAVAPLTITYVREKVIDFSKPFMTLGISILYHKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLINSVWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMDSPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRKNTALVKNNREGIQRVLTTDYALLMESTSIEYISQRNCNLTQIGGLIDSKGYGVGTPIGSP-YRDKVTIAILQLQEEGKLHMMKEKW-WRGN---GCPEEDSKEAS---ALGVENIGGIFIVLAAGLVLSVFVAIGE 854          
BLAST of Glutamate receptor ionotropic vs. Ensembl Zebrafish
Match: grik4 (glutamate receptor, ionotropic, kainate 4 [Source:ZFIN;Acc:ZDB-GENE-070821-5])

HSP 1 Score: 382.874 bits (982), Expect = 2.136e-116
Identity = 216/465 (46.45%), Postives = 300/465 (64.52%), Query Frame = 1
Query: 1360 LERISYWSKKAGFK-----PILNRAETMRDRLLTQIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPCFNK----VENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKSDH-SLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIEMTIW 2721
            L +I  W  + G       P LN  +T+         N T  +TT+ + P+VM R   +    L+GNDR+ G  +D+L+ L+++ +F Y I  V D  YG +    G W GM+GELI+ +ADLAVA+LTIT +RE+VIDF+ P+M+LG+SI+ +  I        F+ P S  VWL ML AY+ VS  LFLV R+TPYEWY  HPC       + NQ+S+ NSFWF VG  MQQG  I+P+A STR +  +WW F LI+ISSYTANLAAFLT++R++  I SV++L+ Q  ++YGT++GGST +FF+NS   TY++MWNFM S   S+FV +T +GI +VL+ NYA++LEST+NEYY QRNCNL  +GGLLD++GY IG+P G +V RD    +ILRLQ+E  LE  +R W   ++  K   E  + A      LG+E +GG F  L+ GL V+  ++ +E  +W
Sbjct:  386 LRQIGQWHSEQGLSMERKLPSLNVTDTL--------FNTTLTITTILENPYVMLRANHQE---LEGNDRYEGFCVDMLKELADILKFKYRIRLVGDGVYG-VPGANGTWTGMVGELISRKADLAVAALTITAEREKVIDFSKPFMTLGISIMYRVHIGRRPGYFSFLDPFSPGVWLFMLLAYLAVSCVLFLVARLTPYEWYNPHPCLKGRCSLLINQYSLGNSFWFPVGGFMQQGSTIAPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPIESVDDLADQTAIEYGTMHGGSTMTFFQNSRYQTYQRMWNFMYSKQPSVFVKSTEEGIARVLNSNYAYLLESTMNEYYRQRNCNLTQIGGLLDTKGYGIGMPLG-SVYRDEFDLAILRLQEENRLEILKRKW---WDGGKCPKEEDHRA----KGLGMENIGGIFVVLVCGLLVAIFMAVLEF-VW 829          
BLAST of Glutamate receptor ionotropic vs. Ensembl Xenopus
Match: ugt2a1 (UDP glucuronosyltransferase 2 family, polypeptide A1, complex locus [Source:Xenbase;Acc:XB-GENE-954008])

HSP 1 Score: 402.905 bits (1034), Expect = 4.740e-125
Identity = 218/470 (46.38%), Postives = 311/470 (66.17%), Query Frame = 1
Query: 1321 DFNFESIYLGESHLERISYWSKKAGFKPILNRAETMRDR---LLTQIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPC---FNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKSDHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIE 2709
            DF+ + I L E  LE++  W+   G    LN  ET R R   +   + N+T  VTT+ + P+VM++  D    PL G DRF G  +DLL+ ++E+  F+Y I  V+D  YGS +E  G+WNG++ ELI+++ADLAVA LTIT+ RE+VIDF+ P+M+LG+SI+ +K+  +   +  F+ PLS ++W+ +L AY+ VS  LF++ R +PYEWY  HPC    + VEN F++LNSFWF VG+LMQQG ++ PKA STR+IG IWWFF LI+ISSYTANLAAFLT+ER+++ I S ++L+ Q K++YG +  G+T +FFK S+IST++KMW FM S  S  V +  +GIQ+VL  +YA ++EST  EY  QRNCNL  +GGL+DS+GY IG P G+   RD +S +IL+LQ+   +   +  W      +  C E  N   +    LG++ MGG F  L  GL +S +V+  E
Sbjct:  361 DFDLDIISLKEDGLEKVGTWNPSDG----LNITETARGRGPNISESLTNRTLIVTTVLEEPYVMFKRSD---TPLFGKDRFEGFCIDLLKKIAEILGFDYDIRLVEDAKYGSQDEK-GQWNGLVKELIDHKADLAVAPLTITHVREKVIDFSKPFMTLGISILYRKANGTAPSVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYDAHPCNPGTDVVENNFTLLNSFWFAVGALMQQGSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMESAIDSADDLAKQTKIEYGAVVDGATMNFFKKSHISTFEKMWAFMSSRPSALVKSNEEGIQRVLSADYALLMESTAIEYITQRNCNLTQIGGLIDSKGYGIGTPMGSP-YRDRISIAILQLQEADEIHKMKERWW----RSGGCPEEKNKEAS---ALGIQNMGGIFIVLAGGLILSVVVAMAE 814          
BLAST of Glutamate receptor ionotropic vs. Ensembl Xenopus
Match: ugt2a1 (UDP glucuronosyltransferase 2 family, polypeptide A1, complex locus [Source:Xenbase;Acc:XB-GENE-954008])

HSP 1 Score: 402.905 bits (1034), Expect = 6.644e-125
Identity = 218/470 (46.38%), Postives = 311/470 (66.17%), Query Frame = 1
Query: 1321 DFNFESIYLGESHLERISYWSKKAGFKPILNRAETMRDR---LLTQIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPC---FNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKSDHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIE 2709
            DF+ + I L E  LE++  W+   G    LN  ET R R   +   + N+T  VTT+ + P+VM++  D    PL G DRF G  +DLL+ ++E+  F+Y I  V+D  YGS +E  G+WNG++ ELI+++ADLAVA LTIT+ RE+VIDF+ P+M+LG+SI+ +K+  +   +  F+ PLS ++W+ +L AY+ VS  LF++ R +PYEWY  HPC    + VEN F++LNSFWF VG+LMQQG ++ PKA STR+IG IWWFF LI+ISSYTANLAAFLT+ER+++ I S ++L+ Q K++YG +  G+T +FFK S+IST++KMW FM S  S  V +  +GIQ+VL  +YA ++EST  EY  QRNCNL  +GGL+DS+GY IG P G+   RD +S +IL+LQ+   +   +  W      +  C E  N   +    LG++ MGG F  L  GL +S +V+  E
Sbjct:  351 DFDLDIISLKEDGLEKVGTWNPSDG----LNITETARGRGPNISESLTNRTLIVTTVLEEPYVMFKRSD---TPLFGKDRFEGFCIDLLKKIAEILGFDYDIRLVEDAKYGSQDEK-GQWNGLVKELIDHKADLAVAPLTITHVREKVIDFSKPFMTLGISILYRKANGTAPSVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYDAHPCNPGTDVVENNFTLLNSFWFAVGALMQQGSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMESAIDSADDLAKQTKIEYGAVVDGATMNFFKKSHISTFEKMWAFMSSRPSALVKSNEEGIQRVLSADYALLMESTAIEYITQRNCNLTQIGGLIDSKGYGIGTPMGSP-YRDRISIAILQLQEADEIHKMKERWW----RSGGCPEEKNKEAS---ALGIQNMGGIFIVLAGGLILSVVVAMAE 804          
BLAST of Glutamate receptor ionotropic vs. Ensembl Xenopus
Match: ugt2a1 (UDP glucuronosyltransferase 2 family, polypeptide A1, complex locus [Source:Xenbase;Acc:XB-GENE-954008])

HSP 1 Score: 403.29 bits (1035), Expect = 1.162e-124
Identity = 218/470 (46.38%), Postives = 311/470 (66.17%), Query Frame = 1
Query: 1321 DFNFESIYLGESHLERISYWSKKAGFKPILNRAETMRDR---LLTQIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPC---FNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKSDHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIE 2709
            DF+ + I L E  LE++  W+   G    LN  ET R R   +   + N+T  VTT+ + P+VM++  D    PL G DRF G  +DLL+ ++E+  F+Y I  V+D  YGS +E  G+WNG++ ELI+++ADLAVA LTIT+ RE+VIDF+ P+M+LG+SI+ +K+  +   +  F+ PLS ++W+ +L AY+ VS  LF++ R +PYEWY  HPC    + VEN F++LNSFWF VG+LMQQG ++ PKA STR+IG IWWFF LI+ISSYTANLAAFLT+ER+++ I S ++L+ Q K++YG +  G+T +FFK S+IST++KMW FM S  S  V +  +GIQ+VL  +YA ++EST  EY  QRNCNL  +GGL+DS+GY IG P G+   RD +S +IL+LQ+   +   +  W      +  C E  N   +    LG++ MGG F  L  GL +S +V+  E
Sbjct:  357 DFDLDIISLKEDGLEKVGTWNPSDG----LNITETARGRGPNISESLTNRTLIVTTVLEEPYVMFKRSD---TPLFGKDRFEGFCIDLLKKIAEILGFDYDIRLVEDAKYGSQDEK-GQWNGLVKELIDHKADLAVAPLTITHVREKVIDFSKPFMTLGISILYRKANGTAPSVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYDAHPCNPGTDVVENNFTLLNSFWFAVGALMQQGSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMESAIDSADDLAKQTKIEYGAVVDGATMNFFKKSHISTFEKMWAFMSSRPSALVKSNEEGIQRVLSADYALLMESTAIEYITQRNCNLTQIGGLIDSKGYGIGTPMGSP-YRDRISIAILQLQEADEIHKMKERWW----RSGGCPEEKNKEAS---ALGIQNMGGIFIVLAGGLILSVVVAMAE 810          
BLAST of Glutamate receptor ionotropic vs. Ensembl Xenopus
Match: ugt2a1 (UDP glucuronosyltransferase 2 family, polypeptide A1, complex locus [Source:Xenbase;Acc:XB-GENE-954008])

HSP 1 Score: 402.905 bits (1034), Expect = 1.677e-124
Identity = 218/470 (46.38%), Postives = 311/470 (66.17%), Query Frame = 1
Query: 1321 DFNFESIYLGESHLERISYWSKKAGFKPILNRAETMRDR---LLTQIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPC---FNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKSDHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIE 2709
            DF+ + I L E  LE++  W+   G    LN  ET R R   +   + N+T  VTT+ + P+VM++  D    PL G DRF G  +DLL+ ++E+  F+Y I  V+D  YGS +E  G+WNG++ ELI+++ADLAVA LTIT+ RE+VIDF+ P+M+LG+SI+ +K+  +   +  F+ PLS ++W+ +L AY+ VS  LF++ R +PYEWY  HPC    + VEN F++LNSFWF VG+LMQQG ++ PKA STR+IG IWWFF LI+ISSYTANLAAFLT+ER+++ I S ++L+ Q K++YG +  G+T +FFK S+IST++KMW FM S  S  V +  +GIQ+VL  +YA ++EST  EY  QRNCNL  +GGL+DS+GY IG P G+   RD +S +IL+LQ+   +   +  W      +  C E  N   +    LG++ MGG F  L  GL +S +V+  E
Sbjct:  361 DFDLDIISLKEDGLEKVGTWNPSDG----LNITETARGRGPNISESLTNRTLIVTTVLEEPYVMFKRSD---TPLFGKDRFEGFCIDLLKKIAEILGFDYDIRLVEDAKYGSQDEK-GQWNGLVKELIDHKADLAVAPLTITHVREKVIDFSKPFMTLGISILYRKANGTAPSVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYDAHPCNPGTDVVENNFTLLNSFWFAVGALMQQGSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMESAIDSADDLAKQTKIEYGAVVDGATMNFFKKSHISTFEKMWAFMSSRPSALVKSNEEGIQRVLSADYALLMESTAIEYITQRNCNLTQIGGLIDSKGYGIGTPMGSP-YRDRISIAILQLQEADEIHKMKERWW----RSGGCPEEKNKEAS---ALGIQNMGGIFIVLAGGLILSVVVAMAE 814          
BLAST of Glutamate receptor ionotropic vs. Ensembl Xenopus
Match: ugt2a1 (UDP glucuronosyltransferase 2 family, polypeptide A1, complex locus [Source:Xenbase;Acc:XB-GENE-954008])

HSP 1 Score: 403.29 bits (1035), Expect = 1.829e-124
Identity = 218/470 (46.38%), Postives = 311/470 (66.17%), Query Frame = 1
Query: 1321 DFNFESIYLGESHLERISYWSKKAGFKPILNRAETMRDR---LLTQIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPC---FNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKSDHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIE 2709
            DF+ + I L E  LE++  W+   G    LN  ET R R   +   + N+T  VTT+ + P+VM++  D    PL G DRF G  +DLL+ ++E+  F+Y I  V+D  YGS +E  G+WNG++ ELI+++ADLAVA LTIT+ RE+VIDF+ P+M+LG+SI+ +K+  +   +  F+ PLS ++W+ +L AY+ VS  LF++ R +PYEWY  HPC    + VEN F++LNSFWF VG+LMQQG ++ PKA STR+IG IWWFF LI+ISSYTANLAAFLT+ER+++ I S ++L+ Q K++YG +  G+T +FFK S+IST++KMW FM S  S  V +  +GIQ+VL  +YA ++EST  EY  QRNCNL  +GGL+DS+GY IG P G+   RD +S +IL+LQ+   +   +  W      +  C E  N   +    LG++ MGG F  L  GL +S +V+  E
Sbjct:  379 DFDLDIISLKEDGLEKVGTWNPSDG----LNITETARGRGPNISESLTNRTLIVTTVLEEPYVMFKRSD---TPLFGKDRFEGFCIDLLKKIAEILGFDYDIRLVEDAKYGSQDEK-GQWNGLVKELIDHKADLAVAPLTITHVREKVIDFSKPFMTLGISILYRKANGTAPSVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYDAHPCNPGTDVVENNFTLLNSFWFAVGALMQQGSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMESAIDSADDLAKQTKIEYGAVVDGATMNFFKKSHISTFEKMWAFMSSRPSALVKSNEEGIQRVLSADYALLMESTAIEYITQRNCNLTQIGGLIDSKGYGIGTPMGSP-YRDRISIAILQLQEADEIHKMKERWW----RSGGCPEEKNKEAS---ALGIQNMGGIFIVLAGGLILSVVVAMAE 832          
BLAST of Glutamate receptor ionotropic vs. Ensembl Mouse
Match: Grik1 (glutamate receptor, ionotropic, kainate 1 [Source:MGI Symbol;Acc:MGI:95814])

HSP 1 Score: 398.282 bits (1022), Expect = 1.878e-123
Identity = 224/471 (47.56%), Postives = 309/471 (65.61%), Query Frame = 1
Query: 1321 DFNFESIYLGESHLERISYWSKKAGFKPILNRAETMRDR---LLTQIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPC---FNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKS-DHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIE 2709
            DF+ + I L E   E+I  W+  +G    LN  +  RDR   +   + N+T  VTT+ + P+VMYR+ D+   PL GNDRF G  +DLL+ LS +  F Y +  V D  YG+ N+  G+WNGM+ ELI++ ADLAVA LTITY RE+VIDF+ P+M+LG+SI+ +K   +   +  F+ PLS ++W+ +L A + VS  LF++ R TPYEWY  HPC    + VEN F++LNSFWF VG+LMQQG ++ PKA STR++G IWWFF LI+ISSYTANLAAFLT+ER+++ I S ++L+ Q K++YG +  GST +FFK S ISTY+KMW FM S   S  V N+ +GIQ+VL  +YA ++EST  EY  QRNCNL  +GGL+DS+GY +G P G+   RD ++ +IL+LQ+E  L   +  W  R N    C E  +   +    LG+E +GG F  L  GL +S  V+  E
Sbjct:  316 DFDLDIISLKEEGTEKIGIWNSNSG----LNMTDGNRDRSNNITDSLANRTLIVTTILEEPYVMYRKSDK---PLYGNDRFEGYCLDLLKELSNILGFLYDVKLVPDGKYGAQNDK-GEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSP-YRDKITIAILQLQEEGKLHMMKEKW-WRGN---GCPEEDSKEAS---ALGVENIGGIFIVLAAGLVLSVFVAIGE 770          
BLAST of Glutamate receptor ionotropic vs. Ensembl Mouse
Match: Grik2 (glutamate receptor, ionotropic, kainate 2 (beta 2) [Source:MGI Symbol;Acc:MGI:95815])

HSP 1 Score: 399.438 bits (1025), Expect = 3.641e-123
Identity = 227/514 (44.16%), Postives = 335/514 (65.18%), Query Frame = 1
Query: 1321 DFNFESIYLGESHLERISYWSKKAGFKPILNRAETMRDR---LLTQIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPC---FNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKS-DHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIEMTIWAXXXXXXXXXXXVYDVIDSQIKMAFGQCHR---FKPNSP 2829
            DF+ + I L E  LE+I  W   +G    LN  E+ + +   +   + N++  VTT+ + P+V++++ D+   PL GNDRF G  +DLLR LS +  F Y I  V+D  YG+ ++  G+WNGM+ ELI+++ADLAVA L ITY RE+VIDF+ P+M+LG+SI+ +K   +   +  F+ PLS ++W+ +L AY+ VS  LF++ R +PYEWY  HPC    + VEN F++LNSFWF VG+LMQQG ++ PKA STR++G IWWFF LI+ISSYTANLAAFLT+ER+++ I S ++L+ Q K++YG +  G+T +FFK S ISTY KMW FM S   S+ V +  +GIQ+VL  +YAF++EST  E+  QRNCNL  +GGL+DS+GY +G P G+   RD ++ +IL+LQ+E  L   +  W  R N    C E  +   +    LG++ +GG F  L  GL +S  V+  E  ++ SK++ + +KRS    +  +++M+  +C R    KP +P
Sbjct:  386 DFDLDVISLKEEGLEKIGTWDPSSG----LNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDK---PLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSP-YRDKITIAILQLQEEGKLHMMKEKW-WRGN---GCPEEESKEAS---ALGVQNIGGIFIVLAAGLVLSVFVAVGEF-LYKSKKNAQLEKRSFCSAMVEELRMSL-KCQRRLKHKPQAP 882          
BLAST of Glutamate receptor ionotropic vs. Ensembl Mouse
Match: Grik2 (glutamate receptor, ionotropic, kainate 2 (beta 2) [Source:MGI Symbol;Acc:MGI:95815])

HSP 1 Score: 399.438 bits (1025), Expect = 3.641e-123
Identity = 227/514 (44.16%), Postives = 335/514 (65.18%), Query Frame = 1
Query: 1321 DFNFESIYLGESHLERISYWSKKAGFKPILNRAETMRDR---LLTQIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPC---FNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKS-DHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIEMTIWAXXXXXXXXXXXVYDVIDSQIKMAFGQCHR---FKPNSP 2829
            DF+ + I L E  LE+I  W   +G    LN  E+ + +   +   + N++  VTT+ + P+V++++ D+   PL GNDRF G  +DLLR LS +  F Y I  V+D  YG+ ++  G+WNGM+ ELI+++ADLAVA L ITY RE+VIDF+ P+M+LG+SI+ +K   +   +  F+ PLS ++W+ +L AY+ VS  LF++ R +PYEWY  HPC    + VEN F++LNSFWF VG+LMQQG ++ PKA STR++G IWWFF LI+ISSYTANLAAFLT+ER+++ I S ++L+ Q K++YG +  G+T +FFK S ISTY KMW FM S   S+ V +  +GIQ+VL  +YAF++EST  E+  QRNCNL  +GGL+DS+GY +G P G+   RD ++ +IL+LQ+E  L   +  W  R N    C E  +   +    LG++ +GG F  L  GL +S  V+  E  ++ SK++ + +KRS    +  +++M+  +C R    KP +P
Sbjct:  386 DFDLDVISLKEEGLEKIGTWDPSSG----LNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDK---PLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSP-YRDKITIAILQLQEEGKLHMMKEKW-WRGN---GCPEEESKEAS---ALGVQNIGGIFIVLAAGLVLSVFVAVGEF-LYKSKKNAQLEKRSFCSAMVEELRMSL-KCQRRLKHKPQAP 882          
BLAST of Glutamate receptor ionotropic vs. Ensembl Mouse
Match: Grik2 (glutamate receptor, ionotropic, kainate 2 (beta 2) [Source:MGI Symbol;Acc:MGI:95815])

HSP 1 Score: 398.282 bits (1022), Expect = 4.134e-123
Identity = 216/471 (45.86%), Postives = 311/471 (66.03%), Query Frame = 1
Query: 1321 DFNFESIYLGESHLERISYWSKKAGFKPILNRAETMRDR---LLTQIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPC---FNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKS-DHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIE 2709
            DF+ + I L E  LE+I  W   +G    LN  E+ + +   +   + N++  VTT+ + P+V++++ D+   PL GNDRF G  +DLLR LS +  F Y I  V+D  YG+ ++  G+WNGM+ ELI+++ADLAVA L ITY RE+VIDF+ P+M+LG+SI+ +K   +   +  F+ PLS ++W+ +L AY+ VS  LF++ R +PYEWY  HPC    + VEN F++LNSFWF VG+LMQQG ++ PKA STR++G IWWFF LI+ISSYTANLAAFLT+ER+++ I S ++L+ Q K++YG +  G+T +FFK S ISTY KMW FM S   S+ V +  +GIQ+VL  +YAF++EST  E+  QRNCNL  +GGL+DS+GY +G P G+   RD ++ +IL+LQ+E  L   +  W  R N    C E  +   +    LG++ +GG F  L  GL +S  V+  E
Sbjct:  386 DFDLDVISLKEEGLEKIGTWDPSSG----LNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDK---PLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSP-YRDKITIAILQLQEEGKLHMMKEKW-WRGN---GCPEEESKEAS---ALGVQNIGGIFIVLAAGLVLSVFVAVGE 841          
BLAST of Glutamate receptor ionotropic vs. Ensembl Mouse
Match: Grik2 (glutamate receptor, ionotropic, kainate 2 (beta 2) [Source:MGI Symbol;Acc:MGI:95815])

HSP 1 Score: 398.282 bits (1022), Expect = 4.134e-123
Identity = 216/471 (45.86%), Postives = 311/471 (66.03%), Query Frame = 1
Query: 1321 DFNFESIYLGESHLERISYWSKKAGFKPILNRAETMRDR---LLTQIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPC---FNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKS-DHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIE 2709
            DF+ + I L E  LE+I  W   +G    LN  E+ + +   +   + N++  VTT+ + P+V++++ D+   PL GNDRF G  +DLLR LS +  F Y I  V+D  YG+ ++  G+WNGM+ ELI+++ADLAVA L ITY RE+VIDF+ P+M+LG+SI+ +K   +   +  F+ PLS ++W+ +L AY+ VS  LF++ R +PYEWY  HPC    + VEN F++LNSFWF VG+LMQQG ++ PKA STR++G IWWFF LI+ISSYTANLAAFLT+ER+++ I S ++L+ Q K++YG +  G+T +FFK S ISTY KMW FM S   S+ V +  +GIQ+VL  +YAF++EST  E+  QRNCNL  +GGL+DS+GY +G P G+   RD ++ +IL+LQ+E  L   +  W  R N    C E  +   +    LG++ +GG F  L  GL +S  V+  E
Sbjct:  386 DFDLDVISLKEEGLEKIGTWDPSSG----LNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDK---PLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSP-YRDKITIAILQLQEEGKLHMMKEKW-WRGN---GCPEEESKEAS---ALGVQNIGGIFIVLAAGLVLSVFVAVGE 841          
BLAST of Glutamate receptor ionotropic vs. UniProt/SwissProt
Match: sp|P39087|GRIK2_MOUSE (Glutamate receptor ionotropic, kainate 2 OS=Mus musculus OX=10090 GN=Grik2 PE=1 SV=4)

HSP 1 Score: 399.438 bits (1025), Expect = 2.547e-122
Identity = 227/514 (44.16%), Postives = 335/514 (65.18%), Query Frame = 1
Query: 1321 DFNFESIYLGESHLERISYWSKKAGFKPILNRAETMRDR---LLTQIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPC---FNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKS-DHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIEMTIWAXXXXXXXXXXXVYDVIDSQIKMAFGQCHR---FKPNSP 2829
            DF+ + I L E  LE+I  W   +G    LN  E+ + +   +   + N++  VTT+ + P+V++++ D+   PL GNDRF G  +DLLR LS +  F Y I  V+D  YG+ ++  G+WNGM+ ELI+++ADLAVA L ITY RE+VIDF+ P+M+LG+SI+ +K   +   +  F+ PLS ++W+ +L AY+ VS  LF++ R +PYEWY  HPC    + VEN F++LNSFWF VG+LMQQG ++ PKA STR++G IWWFF LI+ISSYTANLAAFLT+ER+++ I S ++L+ Q K++YG +  G+T +FFK S ISTY KMW FM S   S+ V +  +GIQ+VL  +YAF++EST  E+  QRNCNL  +GGL+DS+GY +G P G+   RD ++ +IL+LQ+E  L   +  W  R N    C E  +   +    LG++ +GG F  L  GL +S  V+  E  ++ SK++ + +KRS    +  +++M+  +C R    KP +P
Sbjct:  386 DFDLDVISLKEEGLEKIGTWDPSSG----LNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDK---PLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSP-YRDKITIAILQLQEEGKLHMMKEKW-WRGN---GCPEEESKEAS---ALGVQNIGGIFIVLAAGLVLSVFVAVGEF-LYKSKKNAQLEKRSFCSAMVEELRMSL-KCQRRLKHKPQAP 882          
BLAST of Glutamate receptor ionotropic vs. UniProt/SwissProt
Match: sp|Q13002|GRIK2_HUMAN (Glutamate receptor ionotropic, kainate 2 OS=Homo sapiens OX=9606 GN=GRIK2 PE=1 SV=1)

HSP 1 Score: 399.438 bits (1025), Expect = 2.600e-122
Identity = 227/514 (44.16%), Postives = 335/514 (65.18%), Query Frame = 1
Query: 1321 DFNFESIYLGESHLERISYWSKKAGFKPILNRAETMRDR---LLTQIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPC---FNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKS-DHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIEMTIWAXXXXXXXXXXXVYDVIDSQIKMAFGQCHR---FKPNSP 2829
            DF+ + I L E  LE+I  W   +G    LN  E+ + +   +   + N++  VTT+ + P+V++++ D+   PL GNDRF G  +DLLR LS +  F Y I  V+D  YG+ ++  G+WNGM+ ELI+++ADLAVA L ITY RE+VIDF+ P+M+LG+SI+ +K   +   +  F+ PLS ++W+ +L AY+ VS  LF++ R +PYEWY  HPC    + VEN F++LNSFWF VG+LMQQG ++ PKA STR++G IWWFF LI+ISSYTANLAAFLT+ER+++ I S ++L+ Q K++YG +  G+T +FFK S ISTY KMW FM S   S+ V +  +GIQ+VL  +YAF++EST  E+  QRNCNL  +GGL+DS+GY +G P G+   RD ++ +IL+LQ+E  L   +  W  R N    C E  +   +    LG++ +GG F  L  GL +S  V+  E  ++ SK++ + +KRS    +  +++M+  +C R    KP +P
Sbjct:  386 DFDLDVISLKEEGLEKIGTWDPASG----LNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDK---PLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDANGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSP-YRDKITIAILQLQEEGKLHMMKEKW-WRGN---GCPEEESKEAS---ALGVQNIGGIFIVLAAGLVLSVFVAVGEF-LYKSKKNAQLEKRSFCSAMVEELRMSL-KCQRRLKHKPQAP 882          
BLAST of Glutamate receptor ionotropic vs. UniProt/SwissProt
Match: sp|P42260|GRIK2_RAT (Glutamate receptor ionotropic, kainate 2 OS=Rattus norvegicus OX=10116 GN=Grik2 PE=1 SV=2)

HSP 1 Score: 399.438 bits (1025), Expect = 3.007e-122
Identity = 227/514 (44.16%), Postives = 335/514 (65.18%), Query Frame = 1
Query: 1321 DFNFESIYLGESHLERISYWSKKAGFKPILNRAETMRDR---LLTQIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPC---FNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKS-DHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIEMTIWAXXXXXXXXXXXVYDVIDSQIKMAFGQCHR---FKPNSP 2829
            DF+ + I L E  LE+I  W   +G    LN  E+ + +   +   + N++  VTT+ + P+V++++ D+   PL GNDRF G  +DLLR LS +  F Y I  V+D  YG+ ++  G+WNGM+ ELI+++ADLAVA L ITY RE+VIDF+ P+M+LG+SI+ +K   +   +  F+ PLS ++W+ +L AY+ VS  LF++ R +PYEWY  HPC    + VEN F++LNSFWF VG+LMQQG ++ PKA STR++G IWWFF LI+ISSYTANLAAFLT+ER+++ I S ++L+ Q K++YG +  G+T +FFK S ISTY KMW FM S   S+ V +  +GIQ+VL  +YAF++EST  E+  QRNCNL  +GGL+DS+GY +G P G+   RD ++ +IL+LQ+E  L   +  W  R N    C E  +   +    LG++ +GG F  L  GL +S  V+  E  ++ SK++ + +KRS    +  +++M+  +C R    KP +P
Sbjct:  386 DFDLDVISLKEEGLEKIGTWDPASG----LNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDK---PLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSP-YRDKITIAILQLQEEGKLHMMKEKW-WRGN---GCPEEESKEAS---ALGVQNIGGIFIVLAAGLVLSVFVAVGEF-LYKSKKNAQLEKRSFCSAMVEELRMSL-KCQRRLKHKPQAP 882          
BLAST of Glutamate receptor ionotropic vs. UniProt/SwissProt
Match: sp|P42264|GRIK3_RAT (Glutamate receptor ionotropic, kainate 3 OS=Rattus norvegicus OX=10116 GN=Grik3 PE=1 SV=1)

HSP 1 Score: 397.127 bits (1019), Expect = 2.623e-121
Identity = 218/470 (46.38%), Postives = 306/470 (65.11%), Query Frame = 1
Query: 1321 DFNFESIYLGESHLERISYWSKKAGFKPILNRAETMRDR---LLTQIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPC---FNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKSDHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIE 2709
            DF+ + I L E  LE++  WS   G    LN  E  + R   +   + N++  VTTL + PFVM+R+ D     L GNDRF G  +DLL+ L+ +  F+Y I  V+D  YG+ ++  G+WNGM+ ELI+++ADLAVA LTIT+ RE+ IDF+ P+M+LG+SI+ +K   +   +  F+ PLS ++W+ +L AY+ VS  LF++ R +PYEWY  HPC      VEN F++LNSFWF +GSLMQQG ++ PKA STR+IG IWWFF LI+ISSYTANLAAFLT+ER+++ I S ++L+ Q K++YG +  G+T +FFK S IST++KMW FM S  S  V N  +GIQ+ L  +YA ++EST  EY  QRNCNL  +GGL+DS+GY IG P G+   RD ++ +IL+LQ+E  L   +  W         C E  N   +    LG++K+GG F  L  GL +S +V+  E
Sbjct:  389 DFDLDIISLKEDGLEKVGVWSPADG----LNITEVAKGRGPNVTDSLTNRSLIVTTLLEEPFVMFRKSDR---TLYGNDRFEGYCIDLLKELAHILGFSYEIRLVEDGKYGAQDDK-GQWNGMVKELIDHKADLAVAPLTITHVREKAIDFSKPFMTLGVSILYRKPNGTNPSVFSFLNPLSPDIWMYVLLAYLGVSCVLFVIARFSPYEWYDAHPCNPGSEVVENNFTLLNSFWFGMGSLMQQGSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVKDGATMTFFKKSKISTFEKMWAFMSSKPSALVKNNEEGIQRTLTADYALLMESTTIEYITQRNCNLTQIGGLIDSKGYGIGTPMGSP-YRDKITIAILQLQEEDKLHIMKEKWW----RGSGCPEEENKEAS---ALGIQKIGGIFIVLAAGLVLSVLVAVGE 842          
BLAST of Glutamate receptor ionotropic vs. UniProt/SwissProt
Match: sp|Q13003|GRIK3_HUMAN (Glutamate receptor ionotropic, kainate 3 OS=Homo sapiens OX=9606 GN=GRIK3 PE=2 SV=3)

HSP 1 Score: 396.356 bits (1017), Expect = 4.314e-121
Identity = 217/470 (46.17%), Postives = 306/470 (65.11%), Query Frame = 1
Query: 1321 DFNFESIYLGESHLERISYWSKKAGFKPILNRAETMRDR---LLTQIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPC---FNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKSDHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIE 2709
            DF+ + I L E  LE++  WS   G    LN  E  + R   +   + N++  VTT+ + PFVM+R+ D     L GNDRF G  +DLL+ L+ +  F+Y I  V+D  YG+ ++  G+WNGM+ ELI+++ADLAVA LTIT+ RE+ IDF+ P+M+LG+SI+ +K   +   +  F+ PLS ++W+ +L AY+ VS  LF++ R +PYEWY  HPC      VEN F++LNSFWF +GSLMQQG ++ PKA STR+IG IWWFF LI+ISSYTANLAAFLT+ER+++ I S ++L+ Q K++YG +  G+T +FFK S IST++KMW FM S  S  V N  +GIQ+ L  +YA ++EST  EY  QRNCNL  +GGL+DS+GY IG P G+   RD ++ +IL+LQ+E  L   +  W         C E  N   +    LG++K+GG F  L  GL +S +V+  E
Sbjct:  389 DFDLDIISLKEDGLEKVGVWSPADG----LNITEVAKGRGPNVTDSLTNRSLIVTTVLEEPFVMFRKSDR---TLYGNDRFEGYCIDLLKELAHILGFSYEIRLVEDGKYGAQDDK-GQWNGMVKELIDHKADLAVAPLTITHVREKAIDFSKPFMTLGVSILYRKPNGTNPSVFSFLNPLSPDIWMYVLLAYLGVSCVLFVIARFSPYEWYDAHPCNPGSEVVENNFTLLNSFWFGMGSLMQQGSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVKDGATMTFFKKSKISTFEKMWAFMSSKPSALVKNNEEGIQRALTADYALLMESTTIEYVTQRNCNLTQIGGLIDSKGYGIGTPMGSP-YRDKITIAILQLQEEDKLHIMKEKWW----RGSGCPEEENKEAS---ALGIQKIGGIFIVLAAGLVLSVLVAVGE 842          
BLAST of Glutamate receptor ionotropic vs. TrEMBL
Match: Q8MMK2 (DjGluR2 (Fragment) OS=Dugesia japonica OX=6161 GN=DjGluR2 PE=2 SV=1)

HSP 1 Score: 860.907 bits (2223), Expect = 0.000e+0
Identity = 435/469 (92.75%), Postives = 454/469 (96.80%), Query Frame = 1
Query: 1684 GELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXXQFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPCFNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKSDHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIEMTIWAXXXXXXXXXXXVYDVIDSQIKMAFGQCHRFKPNSPSTNSSSIHDSPVLCNTFKAGSATITIPSMRRYLKSASHEELYQPLPLERALLMKCDYNKPNKYSCFYEPYQAANGVIAQDAHKVTSL 3090
            GELINNEADLAVASLTITYDRERVIDFTTPWMSLGLSIVIKKSISSTKLLQFMAPLSTNVWLMMLGAYI VSITLFLVGRMTPYEWYVKHPC+N+VENQFS LNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQ KMKYGTIYGGSTYSFFKNSNISTYKKMWNFMK+DHSLFVDNTAKGIQKVL+GNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGL SGNNVLRDLLSESILRLQKEQVLESFRR WLLRYNLT+SC+EHSNHAPTIRNQLGLEKMGGAFFGL+IGLTVSC+VSCIEMTIWASKR+M+ KKR+V D+ID+QIK+AFGQCHRFKP  PSTNSSSI DSPVL +TFKAGSATITIPSMRR+LKSASHEELYQPLPLERALLMKCDYNKPNKYSCFY+ Y  ANG+I +DAHKVTSL
Sbjct:    1 GELINNEADLAVASLTITYDRERVIDFTTPWMSLGLSIVIKKSISSTKLLQFMAPLSTNVWLMMLGAYIAVSITLFLVGRMTPYEWYVKHPCYNRVENQFSFLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQTKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKNDHSLFVDNTAKGIQKVLEGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLASGNNVLRDLLSESILRLQKEQVLESFRRQWLLRYNLTRSCYEHSNHAPTIRNQLGLEKMGGAFFGLVIGLTVSCVVSCIEMTIWASKRAMRNKKRTVCDIIDNQIKLAFGQCHRFKPEIPSTNSSSIRDSPVLSSTFKAGSATITIPSMRRFLKSASHEELYQPLPLERALLMKCDYNKPNKYSCFYDTYHTANGLIGKDAHKVTSL 469          
BLAST of Glutamate receptor ionotropic vs. TrEMBL
Match: A0A5K4EQ59 (Putative glutamate receptor, kainate OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 590.497 bits (1521), Expect = 0.000e+0
Identity = 332/789 (42.08%), Postives = 480/789 (60.84%), Query Frame = 1
Query:  484 LKAKLEMESQLKMDCYQDYLIRLLAEKLNTTLFMVGKLSSCSND--------FSF-KNPAQFGDSRSM------SHVIFLVSVTTEYYRLMLRDLVYSDQHVWNEALIIYDQSQVFSTFRNVMETTEKVFHFRHWTSDRATNARIIKNFRHVRTFIVDMNDKNVHSFFLLAAGLQLLNAMTTTVIIMDRDNLIESIRDFAFMAANITVIR---PTL--------YDSKLFKTISNKINY------QKIDFPQKIV------KVLLQHLYLVMNNQKGNKTLGKRSGFISPFSWFDEFNVSLANDVKVFTDPNLNYCFDFNFESIYLGESHLERISYWSKKAGF---KPILNRAETMRDRLLTQIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXXQFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPCFNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKSDHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHA--PTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIEMTIW 2721
            L+   E E+  ++ CY+  L+  L+ +L   L  +  L  C           FSF K   + G+S           ++  +  +      +L++L+  ++ +W    I+Y+ S  F  +R  +E+ +     R W  +    A II+  +H+  F +D++ K++  FF +  G Q +N       I +  +L   +     +  NI ++R   P +          +++ ++I + ++        K+  P+ +        +L     L+++++ G     K    +  +      N  L + +       +N   D+  E I+L    L++++ WS K GF   +P+    ET   +   +  NKTF VTT+EDPPFV++  + + G  L+GND++ G AM+LL+ LS+M  F+Y+I  V D+ +G+ +E+ GKW+G+IG+L+  +ADLAVAS TITYDRERVIDFTTP+MSL LS++I+KS S   L QF APLS  VW+ +  AY VVS+TLFL+GR++PYEWY +HPC+ K++NQF++ NSFWFT GSLMQQ  DI P+ATSTR+IG IWWFFIL++ SSYTANLAAFLTI+R+Q DI SVE+L+ Q K+KYGTI+GGSTYSFFKNS+I TY++MWNFM  + SLFV+ T +GI +VL+G YA ILESTLNEYY QRNC L PLGGLLD RGY IGLP GNN LRDLLSESIL+LQK+Q LE  R+ WL RYN +  C+  S+H   P+ R++L L KM  AF GL +GL    +V   E+ +W
Sbjct:  145 LEQTAESEASERLRCYRRQLLMSLSSRLQLPLVTITDLEECPGSMIDSAIKWFSFSKTKHRSGNSHQRISNPYSPALVHSIGPSQILVAELLKNLIVLNEEIWKGFAIVYEHSGDFLKYRECLESLQTTALIRRWRENSFYKAHIIREIKHLEAFFLDLSAKSIEQFFQMM-GDQEVNPNYAQYFIFNDGSLESLMNSLQRVKGNIALVRFKIPGISHESESESLHTQMIRSIIDHLSTAMNLAGNKLQVPEHVTCTPVRSSLLKTPKGLLVSHKNGPHLTYKNGQLLHTY-----INQVLHSRIGYIDSSKINPILDYGLELIHLKNGRLQQLADWSLKRGFVYKQPV----ETSFPQGGMKHMNKTFIVTTIEDPPFVIFEPYRQ-GVHLEGNDQWTGFAMELLQHLSKMNHFDYIIKPVSDKKFGTFDESKGKWDGLIGDLVYKKADLAVASFTITYDRERVIDFTTPFMSLSLSVIIQKSNSDPGL-QFTAPLSNEVWISVGIAYFVVSLTLFLIGRVSPYEWYARHPCYPKIQNQFTMRNSFWFTAGSLMQQSSDIVPRATSTRIIGGIWWFFILVITSSYTANLAAFLTIDRMQADIESVEDLARQTKIKYGTIHGGSTYSFFKNSDIPTYQRMWNFMNQNKSLFVNKTEEGISRVLEGGYALILESTLNEYYAQRNCKLTPLGGLLDPRGYGIGLPIGNNGLRDLLSESILKLQKDQTLEKMRQYWLQRYNASVPCYLQSSHTNLPS-RSKLTLAKMSSAFIGLGVGLFFGILVWITEIVVW 920          
BLAST of Glutamate receptor ionotropic vs. TrEMBL
Match: G4V951 (Putative glutamate receptor, kainate OS=Schistosoma mansoni OX=6183 GN=Smp_140920 PE=3 SV=1)

HSP 1 Score: 590.497 bits (1521), Expect = 0.000e+0
Identity = 336/793 (42.37%), Postives = 473/793 (59.65%), Query Frame = 1
Query:  484 LKAKLEMESQLKMDCYQDYLIRLLAEKLNTTLFMVGKLSSCSND--------FSF-KNPAQFGDSRSM------SHVIFLVSVTTEYYRLMLRDLVYSDQHVWNEALIIYDQSQVFSTFRNVMETTEKVFHFRHWTSDRATNARIIKNFRHVRTFIVDMNDKNVHSFFLLAAGLQLLNAMTTTVIIMDRDNLIESIRDFAFMAANITVIRPTLYDSKLFKTISNKINYQKIDFPQKIVKVLLQHLYLVMNNQKGNK---------TLGKRSGFISPFSWFDE------------------FNVSLANDVKVFTDPNLNYCFDFNFESIYLGESHLERISYWSKKAGF---KPILNRAETMRDRLLTQIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXXQFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPCFNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKSDHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHA--PTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIEMTIW 2721
            L+   E E+  ++ CY+  L+  L+ +L   L  +  L  C           FSF K   + G+S           ++  +  +      +L++L+  ++ +W    I+Y+ S  F  +R  +E+ +     R W  +    A II+  +H+  F +D++ K++  FF +  G Q +N       I +  +L   +     +  NI ++R        FK        +      ++++ ++ HL   MN   GNK         T  + S   +P                         N  L + +       +N   D+  E I+L    L++++ WS K GF   +P+    ET   +   +  NKTF VTT+EDPPFV++  + + G  L+GND++ G AM+LL+ LS+M  F+Y+I  V D+ +G+ +E+ GKW+G+IG+L+  +ADLAVAS TITYDRERVIDFTTP+MSL LS++I+KS S   L QF APLS  VW+ +  AY VVS+TLFL+GR++PYEWY +HPC+ K++NQF++ NSFWFT GSLMQQ  DI P+ATSTR+IG IWWFFIL++ SSYTANLAAFLTI+R+Q DI SVE+L+ Q K+KYGTI+GGSTYSFFKNS+I TY++MWNFM  + SLFV+ T +GI +VL+G YA ILESTLNEYY QRNC L PLGGLLD RGY IGLP GNN LRDLLSESIL+LQK+Q LE  R+ WL RYN +  C+  S+H   P+ R++L L KM  AF GL +GL    +V   E+ +W
Sbjct:  109 LEQTAESEASERLRCYRRQLLMSLSSRLQLPLVTITDLEECPGSMIDSAIKWFSFSKTKHRSGNSHQRISNPYSPALVHSIGPSQILVAELLKNLIVLNEEIWKGFAIVYEHSGDFLKYRECLESLQTTALIRRWRENSFYKAHIIREIKHLEAFFLDLSAKSIEQFFQMM-GDQEVNPNYAQYFIFNDGSLESLMNSLQRVKGNIALVR--------FKIPGISHESESESLHTQMIRSIIDHLSTAMN-LAGNKLQVPEHVTCTPVRSSLLKTPKGLLVSHKNGPHLTYKNGQLLHTYINQVLHSRIGYIDSSKINPILDYGLELIHLKNGRLQQLADWSLKRGFVYKQPV----ETSFPQGGMKHMNKTFIVTTIEDPPFVIFEPYRQ-GVHLEGNDQWTGFAMELLQHLSKMNHFDYIIKPVSDKKFGTFDESKGKWDGLIGDLVYKKADLAVASFTITYDRERVIDFTTPFMSLSLSVIIQKSNSDPGL-QFTAPLSNEVWISVGIAYFVVSLTLFLIGRVSPYEWYARHPCYPKIQNQFTMRNSFWFTAGSLMQQSSDIVPRATSTRIIGGIWWFFILVITSSYTANLAAFLTIDRMQADIESVEDLARQTKIKYGTIHGGSTYSFFKNSDIPTYQRMWNFMNQNKSLFVNKTEEGISRVLEGGYALILESTLNEYYAQRNCKLTPLGGLLDPRGYGIGLPIGNNGLRDLLSESILKLQKDQTLEKMRQYWLQRYNASVPCYLQSSHTNLPS-RSKLTLAKMSSAFIGLGVGLFFGILVWITEIVVW 884          
BLAST of Glutamate receptor ionotropic vs. TrEMBL
Match: A0A4E0R7W9 (Glutamate receptor ionotropic kainate 3 OS=Fasciola hepatica OX=6192 GN=D915_004282 PE=3 SV=1)

HSP 1 Score: 579.711 bits (1493), Expect = 0.000e+0
Identity = 321/691 (46.45%), Postives = 450/691 (65.12%), Query Frame = 1
Query:  709 MLRDLVYSDQHVWNEALIIYDQSQVFSTFRNVMETTEKVFHFRHWTSDRATNARIIKNFRHVRTFIVDMNDKNVHSFFLLAAGLQLLNAMTTTVIIMDRDNLIESIRDFAFMAANITVIR---PTLYDSKLFKTISNKINYQKIDFPQKIVKVLLQHLYLV--MNNQKGNKTLGKRSGFI------SPF-------SWFDEFNVSLANDVKVFTDPNLNYCFDFNFESIYLGESHLERISYWSKKAGFK-PILNRAETMRDRLLTQIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXXQFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPCFNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKSDHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCF-EHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIEMTIW 2721
            +L+ +   ++ VW    I+Y+  + F  +R  +E  +     RHW ++  + A+I+++ +H++ F +D++  NV  FF +  G Q L+   +   I +   L   I     +   + ++R   P +  +   +++  +++   +D   + ++V+   L++   +  +    TL + +  I       P+       + + E N  L N V    +       D+  E I +      + + WS K GF+   +N  E    R  T + NKTF VTT+EDPPFV+Y  F + G  + G D++ G A++LL+ LSEM  F+YVI  V+D+ +G+ +E  G+W+GMIGELI  +A LAVASLTITYDRERVIDFTTP+MSL LS++I+KS +   L QF APLS  VW+ +L AY++VS+TLF +GR+TP EWY +HPC  +VENQF++LNSFWFTVGSLMQQGCDIS +ATSTR+IGTIWWFFILIM+SSYTANLAAFLTI+R++ DI +VE+L+ Q K+KYGT+YGGSTYSFFK+S+I TY++MW FM ++ SLFV+ T  GI + LDGNYAFILESTLNEYY QRNC L PLGGLLD RGY IGLP GNN  RDLLSESIL+LQK+Q LE  R+ WL RYN T  C+ ++S  +   R++L L KM  AF GL  GL +  +V  +EM++W
Sbjct:  224 LLKHITLLNEEVWKGFAIVYENERDFEKYRTTLEHIQTPALLRHWGTNSFSKAKIVRDIKHLQAFFLDLSTANVEQFFQML-GNQALDIQYSDYFIFNNGPLQPLIYALRKVKGKLMLVRYKVPGMGRNMGQQSLHRQLSKSVVDRYAEALRVIGPQLHVPEQIACKPVESTLLRTADGILVSHKNGPYNEYKHGQALYGEINKILQNSVGYVENQRSRKVLDYGVELIRVDGDVARKYADWSMKNGFQFTFMNETELSSPR--THLENKTFIVTTIEDPPFVIYEPFRQ-GKAMHGKDQWTGFAIELLKHLSEMNHFDYVIKPVEDKKFGTFDENKGRWDGMIGELIYKKAHLAVASLTITYDRERVIDFTTPFMSLSLSVIIRKSNTDPGL-QFTAPLSREVWISVLVAYLLVSLTLFFLGRVTPNEWYARHPCSPRVENQFTLLNSFWFTVGSLMQQGCDISLRATSTRIIGTIWWFFILIMVSSYTANLAAFLTIDRMETDIENVEDLTRQTKIKYGTLYGGSTYSFFKHSDIPTYQRMWEFMNANKSLFVNKTEDGIVRALDGNYAFILESTLNEYYSQRNCLLTPLGGLLDPRGYGIGLPIGNNGFRDLLSESILKLQKDQTLEKMRQFWLQRYNATVPCYLQNSQSSIPSRSKLTLSKMSSAFIGLGAGLLLGVLVWIMEMSVW 909          
BLAST of Glutamate receptor ionotropic vs. TrEMBL
Match: A0A2H1CEY8 (Ligand-gated ion channel OS=Fasciola hepatica OX=6192 GN=D915_06800 PE=3 SV=1)

HSP 1 Score: 578.941 bits (1491), Expect = 0.000e+0
Identity = 321/691 (46.45%), Postives = 449/691 (64.98%), Query Frame = 1
Query:  709 MLRDLVYSDQHVWNEALIIYDQSQVFSTFRNVMETTEKVFHFRHWTSDRATNARIIKNFRHVRTFIVDMNDKNVHSFFLLAAGLQLLNAMTTTVIIMDRDNLIESIRDFAFMAANITVIR---PTLYDSKLFKTISNKINYQKIDFPQKIVKVLLQHLYLV--MNNQKGNKTLGKRSGFI------SPF-------SWFDEFNVSLANDVKVFTDPNLNYCFDFNFESIYLGESHLERISYWSKKAGFK-PILNRAETMRDRLLTQIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXXQFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPCFNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKSDHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCF-EHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIEMTIW 2721
            +L+ +   ++ VW    I+Y+  + F  +R  +E  +     RHW ++  + A+I+++ +H++ F +D++  NV  FF +  G Q L+   +   I +   L   I     +   + ++R   P +  +   +++  +++   +D   + ++V+   L++   +  +    TL + +  I       P+       + + E N  L N V    +       D+  E I +      + + WS K GF+   +N  E    R  T + NKTF VTT+EDPPFV+Y  F   G  + G D++ G A++LL+ LSEM  F+YVI  V+D+ +G+ +E  G+W+GMIGELI  +A LAVASLTITYDRERVIDFTTP+MSL LS++I+KS +   L QF APLS  VW+ +L AY++VS+TLF +GR+TP EWY +HPC  +VENQF++LNSFWFTVGSLMQQGCDIS +ATSTR+IGTIWWFFILIM+SSYTANLAAFLTI+R++ DI +VE+L+ Q K+KYGT+YGGSTYSFFK+S+I TY++MW FM ++ SLFV+ T  GI + LDGNYAFILESTLNEYY QRNC L PLGGLLD RGY IGLP GNN  RDLLSESIL+LQK+Q LE  R+ WL RYN T  C+ ++S  +   R++L L KM  AF GL  GL +  +V  +EM++W
Sbjct:   56 LLKHITLLNEEVWKGFAIVYENERDFEKYRTTLEHIQTPALLRHWGTNSFSKAKIVRDIKHLQAFFLDLSTANVEQFFQML-GNQALDIQYSDYFIFNNGPLQPLIYALRKVKGKLMLVRYKVPGMGRNMGQQSLHRQLSKSVVDRYAEALRVIGPQLHVPEQIACKPVESTLLRTADGILVSHKNGPYNEYKHGQALYGEINKILQNSVGYVENQRSRKVLDYGVELIRVDGDVARKYADWSMKNGFQFTFMNETELSSPR--THLENKTFIVTTIEDPPFVIYEPF-RQGKAMHGKDQWTGFAIELLKHLSEMNHFDYVIKPVEDKKFGTFDENKGRWDGMIGELIYKKAHLAVASLTITYDRERVIDFTTPFMSLSLSVIIRKSNTDPGL-QFTAPLSREVWISVLVAYLLVSLTLFFLGRVTPNEWYARHPCSPRVENQFTLLNSFWFTVGSLMQQGCDISLRATSTRIIGTIWWFFILIMVSSYTANLAAFLTIDRMETDIENVEDLTRQTKIKYGTLYGGSTYSFFKHSDIPTYQRMWEFMNANKSLFVNKTEDGIVRALDGNYAFILESTLNEYYSQRNCLLTPLGGLLDPRGYGIGLPIGNNGFRDLLSESILKLQKDQTLEKMRQFWLQRYNATVPCYLQNSQSSIPSRSKLTLSKMSSAFIGLGAGLLLGVLVWIMEMSVW 741          
BLAST of Glutamate receptor ionotropic vs. Ensembl Cavefish
Match: GRIK2 (glutamate receptor ionotropic, kainate 2 [Source:NCBI gene;Acc:103047375])

HSP 1 Score: 399.438 bits (1025), Expect = 1.467e-123
Identity = 215/471 (45.65%), Postives = 313/471 (66.45%), Query Frame = 1
Query: 1321 DFNFESIYLGESHLERISYWSKKAGFKPILNRAETMRDRLLT---QIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPC---FNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKS-DHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIE 2709
            DF+ + I L E  LE+I  W   +G    LN +E+ + ++      + N+T  V+T+ + P+VM+++ D+   PL GNDRF G  +DLLR L+ +  F Y +  V+D  YG+  E+TG+WNG++ EL++++ADLAVA L ITY RE+VIDF+ P+M+LG+SI+ +K   +   +  F+ PLS ++W+ +L AY+ VS  LF++ R +PYEWY  HPC    + VEN F++LNSFWF VG+LMQQG ++ PKA STR++G IWWFF LI+ISSYTANLAAFLT+ER+++ I S ++L+ Q K++YG +  GST +FFK + ISTY KMW FM S  HS+ V +  +GIQ+VL  +YAF++EST  E+  QRNCNL  +GGL+DS+ Y +G P G+   RD ++ +IL+LQ+E  L   +  W  R N    C E  +   +    LG++ +GG F  L  GL +S  V+  E
Sbjct:  355 DFDLDVISLKEEGLEKIGTWDPVSG----LNMSESQKGKMANVTDSLTNRTLFVSTILEEPYVMFKKSDK---PLHGNDRFEGFCIDLLRELASILGFVYEVRLVEDGKYGAQEESTGQWNGLVRELMDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGVVEDGSTMTFFKKTKISTYDKMWEFMSSRRHSVMVKSVEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKAYGVGTPMGSP-YRDKITIAILQLQEEGKLHMMKEKW-WRGN---GCPEEESKEAS---ALGVQNIGGIFIVLAAGLVLSVFVAVGE 810          
BLAST of Glutamate receptor ionotropic vs. Ensembl Cavefish
Match: GRIK2 (glutamate receptor ionotropic, kainate 2 [Source:NCBI gene;Acc:103047375])

HSP 1 Score: 399.053 bits (1024), Expect = 1.957e-123
Identity = 215/471 (45.65%), Postives = 313/471 (66.45%), Query Frame = 1
Query: 1321 DFNFESIYLGESHLERISYWSKKAGFKPILNRAETMRDRLLT---QIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPC---FNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKS-DHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIE 2709
            DF+ + I L E  LE+I  W   +G    LN +E+ + ++      + N+T  V+T+ + P+VM+++ D+   PL GNDRF G  +DLLR L+ +  F Y +  V+D  YG+  E+TG+WNG++ EL++++ADLAVA L ITY RE+VIDF+ P+M+LG+SI+ +K   +   +  F+ PLS ++W+ +L AY+ VS  LF++ R +PYEWY  HPC    + VEN F++LNSFWF VG+LMQQG ++ PKA STR++G IWWFF LI+ISSYTANLAAFLT+ER+++ I S ++L+ Q K++YG +  GST +FFK + ISTY KMW FM S  HS+ V +  +GIQ+VL  +YAF++EST  E+  QRNCNL  +GGL+DS+ Y +G P G+   RD ++ +IL+LQ+E  L   +  W  R N    C E  +   +    LG++ +GG F  L  GL +S  V+  E
Sbjct:  387 DFDLDVISLKEEGLEKIGTWDPVSG----LNMSESQKGKMANVTDSLTNRTLFVSTILEEPYVMFKKSDK---PLHGNDRFEGFCIDLLRELASILGFVYEVRLVEDGKYGAQEESTGQWNGLVRELMDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGVVEDGSTMTFFKKTKISTYDKMWEFMSSRRHSVMVKSVEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKAYGVGTPMGSP-YRDKITIAILQLQEEGKLHMMKEKW-WRGN---GCPEEESKEAS---ALGVQNIGGIFIVLAAGLVLSVFVAVGE 842          
BLAST of Glutamate receptor ionotropic vs. Ensembl Cavefish
Match: GRIK2 (glutamate receptor ionotropic, kainate 2 [Source:NCBI gene;Acc:103047375])

HSP 1 Score: 398.667 bits (1023), Expect = 2.054e-123
Identity = 215/471 (45.65%), Postives = 313/471 (66.45%), Query Frame = 1
Query: 1321 DFNFESIYLGESHLERISYWSKKAGFKPILNRAETMRDRLLT---QIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPC---FNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKS-DHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIE 2709
            DF+ + I L E  LE+I  W   +G    LN +E+ + ++      + N+T  V+T+ + P+VM+++ D+   PL GNDRF G  +DLLR L+ +  F Y +  V+D  YG+  E+TG+WNG++ EL++++ADLAVA L ITY RE+VIDF+ P+M+LG+SI+ +K   +   +  F+ PLS ++W+ +L AY+ VS  LF++ R +PYEWY  HPC    + VEN F++LNSFWF VG+LMQQG ++ PKA STR++G IWWFF LI+ISSYTANLAAFLT+ER+++ I S ++L+ Q K++YG +  GST +FFK + ISTY KMW FM S  HS+ V +  +GIQ+VL  +YAF++EST  E+  QRNCNL  +GGL+DS+ Y +G P G+   RD ++ +IL+LQ+E  L   +  W  R N    C E  +   +    LG++ +GG F  L  GL +S  V+  E
Sbjct:  387 DFDLDVISLKEEGLEKIGTWDPVSG----LNMSESQKGKMANVTDSLTNRTLFVSTILEEPYVMFKKSDK---PLHGNDRFEGFCIDLLRELASILGFVYEVRLVEDGKYGAQEESTGQWNGLVRELMDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGVVEDGSTMTFFKKTKISTYDKMWEFMSSRRHSVMVKSVEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKAYGVGTPMGSP-YRDKITIAILQLQEEGKLHMMKEKW-WRGN---GCPEEESKEAS---ALGVQNIGGIFIVLAAGLVLSVFVAVGE 842          
BLAST of Glutamate receptor ionotropic vs. Ensembl Cavefish
Match: GRIK2 (glutamate receptor ionotropic, kainate 2 [Source:NCBI gene;Acc:103047375])

HSP 1 Score: 399.438 bits (1025), Expect = 2.867e-123
Identity = 215/471 (45.65%), Postives = 313/471 (66.45%), Query Frame = 1
Query: 1321 DFNFESIYLGESHLERISYWSKKAGFKPILNRAETMRDRLLT---QIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPC---FNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKS-DHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIE 2709
            DF+ + I L E  LE+I  W   +G    LN +E+ + ++      + N+T  V+T+ + P+VM+++ D+   PL GNDRF G  +DLLR L+ +  F Y +  V+D  YG+  E+TG+WNG++ EL++++ADLAVA L ITY RE+VIDF+ P+M+LG+SI+ +K   +   +  F+ PLS ++W+ +L AY+ VS  LF++ R +PYEWY  HPC    + VEN F++LNSFWF VG+LMQQG ++ PKA STR++G IWWFF LI+ISSYTANLAAFLT+ER+++ I S ++L+ Q K++YG +  GST +FFK + ISTY KMW FM S  HS+ V +  +GIQ+VL  +YAF++EST  E+  QRNCNL  +GGL+DS+ Y +G P G+   RD ++ +IL+LQ+E  L   +  W  R N    C E  +   +    LG++ +GG F  L  GL +S  V+  E
Sbjct:  387 DFDLDVISLKEEGLEKIGTWDPVSG----LNMSESQKGKMANVTDSLTNRTLFVSTILEEPYVMFKKSDK---PLHGNDRFEGFCIDLLRELASILGFVYEVRLVEDGKYGAQEESTGQWNGLVRELMDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGVVEDGSTMTFFKKTKISTYDKMWEFMSSRRHSVMVKSVEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKAYGVGTPMGSP-YRDKITIAILQLQEEGKLHMMKEKW-WRGN---GCPEEESKEAS---ALGVQNIGGIFIVLAAGLVLSVFVAVGE 842          
BLAST of Glutamate receptor ionotropic vs. Ensembl Cavefish
Match: ENSAMXT00000004586.2 (glutamate receptor ionotropic, kainate 2-like [Source:NCBI gene;Acc:103044887])

HSP 1 Score: 398.667 bits (1023), Expect = 5.704e-123
Identity = 217/472 (45.97%), Postives = 310/472 (65.68%), Query Frame = 1
Query: 1321 DFNFESIYLGESHLERISYWSKKAGFKPILNRAETMRDRLLT---QIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPC---FNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKS-DHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIEM 2712
            +F+ + I L E  LE+I  W    G    LN  E  + ++      + NK+ RV T+ + P+VM+++ D+   PL GNDRF G  +DLLR L+ +  F Y I  V+D  YG+L E+TG+WNGM+ EL++++ADLAVA L ITY RE+VIDF+ P+M+LG+SI+ +K   +   +  F+ PLS ++W+ +L AY+ VS  LF++ R +PYEWY  HPC    + VEN F++LNSFWF VG+LMQQG ++ PKA STR++G IWWFF LI+ISSYTANLAAFLT+ER+++ I S ++L+ Q K+ YG +  GST +FFK + ISTY KMW FM S   S+ V +  +GIQ+VL  +YAF++EST  E+  QRNCNL  +GGL+DS+ Y +G P G+   RD ++ +IL+LQ+E  L   +  W  R N    C E  +   +    LG++ +GG F  L  GL +S  V+  E+
Sbjct:  388 EFDLDVISLKEDGLEKIGTWEPVNG----LNMTEHHKSKMTNVTNSLSNKSLRVATILEEPYVMFKKSDK---PLCGNDRFEGYCVDLLRELASILGFRYEIQLVEDGKYGALEESTGQWNGMVRELMDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDMVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIPYGVVEDGSTMAFFKKTKISTYDKMWEFMNSRRQSVMVKSVEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKAYGVGTPMGSP-YRDKITIAILQLQEEGKLHMMKEKW-WRGN---GCPEEESKEAS---ALGVQNIGGIFIVLAAGLVLSVFVAVGEV 844          
BLAST of Glutamate receptor ionotropic vs. Ensembl Sea Lamprey
Match: gria1b (glutamate receptor, ionotropic, AMPA 1b [Source:ZFIN;Acc:ZDB-GENE-020125-2])

HSP 1 Score: 317.005 bits (811), Expect = 2.636e-97
Identity = 187/482 (38.80%), Postives = 282/482 (58.51%), Query Frame = 1
Query: 1366 RISYWSKKAGFKPILNRAETMRDRLLTQIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXX-XXXQFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEW-----------------------------YVKHPCFNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMK-SDHSLFVDNTAKGIQKVL--DGNYAFILESTLNEYYCQRN-CNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIE 2709
            +I YWS++A    I N+ E +      +  N+T  VTT+ D P+ M ++  E     +GND++ G  +DL + ++  ++F Y    V D  YG+ N  T  WNGM+GEL+   AD+A+A LTI+  RE VIDF+ P+MSLG+SI+IKK   S   ++ F+ PL+  +W+ ++ AYI VS+ LFLV R +PYEW                                     +  N+F + NS WF++G+ MQQGC+ISP++ S R++G +WWFF LI+ISSYTANLAAFLT+ER+ + I S ++L+ Q ++ YGT+  GST  FF+ S I  Y+KMW FMK ++  +FV   A G+ +V    G YA++LEST NEY  QR  C+ M +GG LDS+GY I  P G + LRD ++ ++L+L ++ +L+  +  W   +     C      +    + L L  + G F+ L+ GL ++ +V+ IE
Sbjct:    1 QIGYWSERARNLVITNQ-EMLGRNGSGKTGNRTVIVTTILDAPYFMLKKNHEQ---FEGNDKYEGYCVDLGQEIAIHEQFEYKWSVVPDGAYGARNPDTKVWNGMVGELVYGRADIAIAPLTISLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVISFLDPLAYEIWMCIIFAYIGVSVVLFLVSRFSPYEWQRDDDTDVEPNGNGGAGGGGGGGGSGGGAGGGSGGGGEPPNEFGIFNSLWFSLGAFMQQGCEISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESADDLAKQTEIAYGTLDSGSTKEFFQRSKIGVYEKMWLFMKDAEPKVFVRTNADGVSRVRKSKGKYAYLLESTTNEYTEQRKPCDTMKVGGNLDSKGYGIATPKG-SALRDAVNLAVLKLNEQGLLDKLKNKW---WYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIE 474          
BLAST of Glutamate receptor ionotropic vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005084.1 (pep scaffold:Pmarinus_7.0:GL476900:54926:87395:-1 gene:ENSPMAG00000004612.1 transcript:ENSPMAT00000005084.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 305.064 bits (780), Expect = 1.674e-95
Identity = 165/332 (49.70%), Postives = 230/332 (69.28%), Query Frame = 1
Query: 1696 NNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPC---FNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKSDHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGL 2679
            N++ADLAVA LTI Y RE+ IDF+ P+M+LG+SI+ +K   +   +  F+ PLS ++W+ +L AY+ VS  LF++ R +PYEWY  HPC    + VEN F++LNSFWF VG+LMQQG ++ PKA STR++G IWWFF LI+ISSYTANLAAFLT+ER+++ I+S ++L+ Q +++YG +  GST +FFK S ISTY+KMW FM S  +  + N  +GIQ+VL  +YA ++EST  EY  QRNCNL  +GGL+D++GY IG P G+   RD ++ +IL+LQ+E  L   +  W  R N      E SN A    + LG++ +GG F  L  GL
Sbjct:    7 NHKADLAVAPLTINYMREKAIDFSKPFMTLGISILYRKPNGTNPGIFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTMLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPISSADDLAKQTRIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQTALIKNNEEGIQRVLTTDYAMLMESTNIEYVTQRNCNLTQIGGLIDNKGYGIGTPLGSP-YRDKITIAILQLQEEGKLHMMKEKW-WRGNGCPE--EDSNEA----SALGVQNIGGIFIVLAAGL 330          
BLAST of Glutamate receptor ionotropic vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002503.1 (pep scaffold:Pmarinus_7.0:GL492163:1:1446:1 gene:ENSPMAG00000002286.1 transcript:ENSPMAT00000002503.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 217.624 bits (553), Expect = 1.494e-65
Identity = 100/187 (53.48%), Postives = 137/187 (73.26%), Query Frame = 1
Query: 1927 TPYEWYVKHPC---FNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKSDH-SLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSG 2475
            +PYEW   HPC    + +EN F++LNS WF VG+LMQQG ++ P+A STR++G IWWFF LI+ISSYTANLAAFLT+ER+++ I S ++L+ Q K++YG +  GST +FFK S ISTY+KMW FM S H +  V N  +GI + L  ++A ++EST  E+  QR CNL  +GGL+DS+GY +G+P G
Sbjct:    2 SPYEWKNPHPCNPDSDVLENNFTMLNSLWFGVGALMQQGSELMPRALSTRIVGGIWWFFTLILISSYTANLAAFLTVERMESPIGSADDLAKQTKIEYGAVRDGSTMTFFKKSRISTYEKMWAFMSSRHQTALVKNNEEGIHRALTTDFAMLMESTTIEHVTQRYCNLTQIGGLIDSKGYGVGMPLG 188          
BLAST of Glutamate receptor ionotropic vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007790.1 (pep scaffold:Pmarinus_7.0:GL476616:796957:798868:-1 gene:ENSPMAG00000007047.1 transcript:ENSPMAT00000007790.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 144.05 bits (362), Expect = 1.790e-37
Identity = 87/295 (29.49%), Postives = 154/295 (52.20%), Query Frame = 1
Query: 1834 QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWY--VKHPCFNKVENQ-FSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKSDHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIE 2709
            QF+ PL+T +W+ ML A   +S+ LF++  + P EWY   K    ++ + Q F+++NSFWF   ++++QG D  P + + ++I   WW F+L++ S+YTANLAAFLT E  Q  I S+++L+ Q+  +YGT  G     F  +S    Y  +W  ++ D+   V +  KG+++     Y FI E++      + +C+L+           A+  P G+ +  + +S ++  L+    L    R W  +    + C   SN      +Q+ ++   G F+ L++G+   C V  +E
Sbjct:   31 QFLEPLNTLLWISMLSACAGISVVLFVLSLLHPDEWYHLAKRKLVSREQGQSFNLVNSFWFVFSAMVKQGSDPLPLSMAGKIIVYTWWCFVLVVCSTYTANLAAFLTAEG-QTSIRSLKDLTRQMDARYGTYSGYRIVGFLNSSARDPYMTVWRHIR-DNRTMVASPKKGLEQAEKAGYIFIGEASAVFTAKKDHCDLIISDRRFFRHRLALPFPPGSRLAAE-VSRAVTELEDSGQLAELERQWFAQEG--QECVGLSN-----EHQIEMKDFKGVFYFLMMGIAAGCGVCFVE 315          
BLAST of Glutamate receptor ionotropic vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010716.1 (pep scaffold:Pmarinus_7.0:GL476465:413535:454465:1 gene:ENSPMAG00000009705.1 transcript:ENSPMAT00000010716.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 142.895 bits (359), Expect = 4.805e-35
Identity = 107/398 (26.88%), Postives = 202/398 (50.75%), Query Frame = 1
Query: 1558 GMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXXQFMAPLSTNVWLMMLGAYIVVS-ITLFLVGRMTPYEWYVKHPCFNKVEN-QFSVLNSFWFTVGSLMQQGCDI-SPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKM------KYGTIYGGSTYSFFKNSNISTYKKMWNFMKSDHSLFVDNTAKGIQK-VLDGNYAFILESTLNEYYCQRN--CNLMPLGG--LLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIE 2709
            G  +D+L+ LS+  +F Y ++ V +  +GS  +  G WNGMIGE++N  A +AV SLTI  +R  V+DF+ P++  G+S+++ +S  +     F+ P S +VW+MM    ++VS I +F+    +P  +  +     +     F++  S W     +      + +P+ T+++ + ++W FF +I ++SYTANLAAF+  E   + ++ + +   Q  +      ++GT+  GST    +N+    Y +M  +M   H   V++    ++   LD   AFI ++ +  Y   ++  C L+ +G   +  + GY I L   +   R  +  ++L+   +  ++    +W     LT  C  H      + +QL ++ M G F+ L++ + +S IV   E
Sbjct:  398 GFCIDILKKLSKTVKFTYDLYLVTNGKHGS--KINGVWNGMIGEVVNMRAHMAVGSLTINEERSEVVDFSVPFVETGISVMVPRSNGTVSPSAFLEPFSADVWVMMFILCLLVSGIAVFIFEYFSPVGYNRQLSAGKEFGGPAFTIGKSIWLLWAIVFNNSVPVENPRGTTSKFMVSVWAFFAVIFLASYTANLAAFMIQEDYIDQVSGLSDKKFQSPLEHSPPFRFGTVPNGSTERNIRNN----YLQMHGYMSKFHQKSVEDALMSLKAGKLD---AFIYDAAVLNYMAGKDEGCRLVTIGSGKVFVATGYGIALQKSSRWKR-AIDLALLQFIGDGEMDELEMIW-----LTGIC--HGERNDVMSSQLDIDNMAGVFYMLLVAMGLSFIVFVCE 778          
BLAST of Glutamate receptor ionotropic vs. Ensembl Nematostella
Match: EDO30203 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1G4])

HSP 1 Score: 253.062 bits (645), Expect = 8.053e-71
Identity = 166/492 (33.74%), Postives = 278/492 (56.50%), Query Frame = 1
Query: 1321 DFNFESIYLGESHLERISYWSKKAGFKPILNRAETM----RDRLLTQ----IHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFI--GMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVK--HPCFNKVENQF-------SVLNSFWFTVGSLMQQGCD-ISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKSDHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYC--QRNCN-LMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIEMTIWA 2724
            D  F+ + L     +++ YW+ + G   + N+ E +    R  + T     + N+T +V T+ + PF+    F +     +G  R I  G  ++LLR LSEM RF + ++ V D  +G+ +  T +WNG++ E++N  ADLAV SLTI+ +R++VIDFT P+M LGL+++IK   +  K     + P   ++W+ + G  I+V   L+L    +P+ +Y +    C  K+E ++       S++ + W TV   + Q  D + P ++S R+   ++WF +LI++S+YTANLAAFLTI+R  + I+SV++L+ Q  + YGT+      +FF+++++ ++  MW +M+  H+ FV+N+A+GI+KV++ NYAFI +S + E+    Q +C  L+  G +    GY  GL   +   +  LS +IL+L+    +E   R WL        C E +  A +  NQL  E + G F  LI G+ VSC+V  +E  IWA
Sbjct:  391 DVAFDVVNLRAFGFQKVGYWNVEEGLH-LDNKKEIVWPSGRVYVPTDSTHILENRTLKVVTIAEAPFI----FAQTQTNGQGETRVIIEGYCIELLRKLSEMLRFKFEVYLVPDNNFGAQDPVTKEWNGVVREVLNGRADLAVTSLTISPERQKVIDFTQPYMDLGLTVLIKPDPTEEKNPFAILRPFRYDLWMAIGGTMIIVGFFLWLFSTFSPFGFYGRCVQKCHTKIEPRYLKLHDTLSLVRALWSTVVYYVGQSSDHLHPVSSSGRITVAVYWFAMLIVMSTYTANLAAFLTIKRFTSPISSVDDLARQKDISYGTVLNSQPQAFFESASVPSFVTMWQYMRYHHT-FVNNSAEGIEKVMNENYAFIWDSAVLEFVAHNQISCGTLITSGSVFGRIGYGFGLAKDSPYTKQ-LSNAILQLRHAGYMEFLDRKWL---KANDKCAEAAEKAKS-ENQLTFEDLSGVFIVLIAGIGVSCVVLVLEW-IWA 870          
BLAST of Glutamate receptor ionotropic vs. Ensembl Nematostella
Match: EDO41291 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4J5])

HSP 1 Score: 235.728 bits (600), Expect = 8.353e-69
Identity = 146/416 (35.10%), Postives = 240/416 (57.69%), Query Frame = 1
Query: 1480 LEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPCFNKVE-NQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIER-LQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKSDHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRN-CNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSC--FEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIE 2709
            L+D PF+M +    + + LKGNDR+ G + DL+  LS    F Y I   K+ +YGS  E  G+W G+IGEL+  EAD+A+  +TIT +RE VIDF+ P++   +++++++       L  F+ P    +WL  LG   +VS+ ++ + R +P  +  +     + E ++FS+ NS WF V S++QQG D +P++TS R++   +W F LI+IS+YTANLAA+ T ER +++ I S+E+L  Q  +KYG   GGS ++FF  S +  Y  M+  MKS  + FV+ T  G+ K     +A++ +    +YY  R  CN M +  LLD++ YA+ +   N+   +L+S +IL L++E  +E  R  W   ++ +  C     ++ +P    +L L  + G F  L  G T+S ++  +E
Sbjct:    6 LQDEPFMMIKP---NASLLKGNDRYRGFSKDLMELLSRKLNFRYEICISKESSYGSKVE--GQWQGLIGELVREEADIALGPITITAEREEVIDFSKPFLDFRIAMILQQPTGEEVNLFAFLLPFDEKLWLTTLGVVGLVSLIVWFLDRFSPQGYKTQAEKSGEGEGDEFSLSNSLWFAVASILQQGGDNTPRSTSGRVLAAAFWLFTLILISTYTANLAAYFTGERGIRSKINSLEDLVSQSTVKYGVQEGGSLFTFFSESKVDIYATMFQQMKSQET-FVNGTQYGVLKARTQPFAYLTDQPSLDYYNMRKPCNTMLVKNLLDAKSYALAMRR-NSEWTNLISVAILELREEGEIEKSRLRW---WDDSSECPTGPSTDSSP---QRLELHSLAGVFIILGGGATISLVLLLVE 408          
BLAST of Glutamate receptor ionotropic vs. Ensembl Nematostella
Match: EDO46633 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPU4])

HSP 1 Score: 218.009 bits (554), Expect = 1.167e-58
Identity = 147/483 (30.43%), Postives = 243/483 (50.31%), Query Frame = 1
Query: 1339 IYLGESHLERISYWSKKAGF-----KPIL---NRAETMRDRLLTQIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXXQFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVK---------HPCFNKVENQFSVLNSFWFTVGSLMQQGCDIS-PKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKSDHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRN-CNLMPLGGLLDSRG-----YAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSC--FEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIE 2709
            I + E+  +++  W+ K G      K ++       T RD     + ++T RV + +  PF M       G      DRF G  +DLL  LSE+  FNY I+   D   G  N  TG W+G+I ELI   ADLAV  +TIT  R +VIDFT P+M+ G+ +V+    S     +F+ P  +++W+ + GA + + +  +L   ++P+ +Y +            + K +   S LNS W +    + QG D + P + S R    +WWF I I+ ++YTAN+AAFLT  R+Q  I  +E+LS Q ++ YG +    T +FF++S++  Y+ MW +MK   SL  D T   I++ L G YAFI ++ + EY  ++  C  + L G  D+R      Y   LP   +   +LLS  IL+L +  + ++    W++           E  +   +  +++G+  M G F  ++ G+ +  ++  +E
Sbjct:  333 INVKENEFDKVGEWNTKDGLMMDSDKTVVWMSGGPGTPRDSE-NVLADRTIRVVSFKGSPFTM-----PVGNVSSSVDRFEGAVIDLLDRLSEILHFNYTIYMSPDGRVGVENPVTGNWDGVINELIQERADLAVGPITITSHRWKVIDFTQPFMTSGIGVVMGTENSPKPYFRFLEPFKSDLWITIFGAVLGMGVVNWLFSVVSPFGFYGRCVQSINKRVKKSYLKQKYSLSFLNSIWSSAAYYLGQGPDGNHPVSASGRAAVAVWWFVITILGATYTANMAAFLTTTRMQTPIRRIEDLSSQTEIAYGCVENSLTQNFFQSSSVQRYQMMWEYMKLRRSLQPD-TYTAIERTLKGKYAFIHDAPILEYLARKTYCGRIKLIGGYDTRTFGNAHYGFALPK-KSPYTNLLSVEILKLVQSGIAKTMIEEWMIERTPCAPLDEAEEQDAKSSDTSKMGINNMLGVFIFMVAGIAIGGVLLLLE 807          
BLAST of Glutamate receptor ionotropic vs. Ensembl Nematostella
Match: EDO35545 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL56])

HSP 1 Score: 178.718 bits (452), Expect = 4.428e-46
Identity = 132/422 (31.28%), Postives = 220/422 (52.13%), Query Frame = 1
Query: 1465 FRVTTLEDPPFVMYREFDEHG--APLKGN------------DRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTG----KWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXXQFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPCFNKVENQFSVLNSFWFTVGSLMQQGC-DISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMK---YGTIYGGSTYSFFKNSNISTYKKMWNFMKSDHSLFVDNTAKGIQKVLDGNY-AFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFF 2661
             RV TL   PFV  +     G  + L  N            D   G  MDLL  L E   F Y +   +D +YGSL    G    +WNGM+GE+I  +ADL VA+LTI  +R   I+F+ P+   GL+I++KK+  S  L  F+ P   ++WL++L +  +V++ L+L+ R +P+  + K     K E   ++ ++ WF+ G L+  G  + +P++ S R++G +W  F +I+++SYTANLAAFL ++R +  ++ +++ +++   K   Y T+   S  ++F+         M+ FM+  +   V    +GI+KV +G   AFI +S +  Y   ++C L   G L    GY IG+P G+    + +S +IL   +  V+E     W+   + +K   E+++ A      LGL+ M G F 
Sbjct:  396 LRVVTLVGEPFVYVKPIPTSGRCSDLDTNTAKHVLCTGTVSDTDSGFCMDLLIRLGEKVNFTYSVSLSEDGSYGSLRRVNGSDTKQWNGMVGEVIQGKADLIVAALTINNERAEWIEFSKPFKYQGLTILVKKNEQSNSLDSFLRPFQIHLWLLVLLSVHIVAVILYLLDRFSPFGRF-KLARKEKEETALNLSSAMWFSWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPKAVVSGIDDPNLRNPSKQFIYATVANSSVDAYFRRQ--VELSSMYTFMEGYN---VKTAKEGIEKVKNGELKAFIWDSPVLYYEASKDCTLTTAGELFGRSGYGIGMPKGSP-WSNAISLAILNFHESGVMEELETTWI---DASKCNTENTSPA-----TLGLQHMLGVFI 802          
BLAST of Glutamate receptor ionotropic vs. Ensembl Nematostella
Match: EDO41293 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4J7])

HSP 1 Score: 159.073 bits (401), Expect = 2.456e-43
Identity = 97/293 (33.11%), Postives = 160/293 (54.61%), Query Frame = 1
Query: 1837 FMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPCFNKVE-NQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKSDHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRN-CNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIE 2709
            F+ P   ++W         V+I ++++ R +PY +  +     + E ++FS+ NS WF  GS++QQG D +P++ S R++   +W F LI+IS+YTANLAAF T +  ++ I S+E+L  Q   KYG   GGS +SFF+ S +  YKKM+  M + ++ FV  T +G+ +     +A++ +    +YY QR  CN M +  LLD++ YA+GL   N+   D +S +IL+L++E  +E  R  W   ++    C             L L  + G F  L  G  +S ++  +E
Sbjct:    4 FLMPFQKDLWACCCLVVGAVTILMWILDRFSPYGFRAEAKNTGEGEGDEFSLPNSLWFATGSILQQGGDNTPRSGSGRVLAASFWLFTLILISTYTANLAAFFTAQNSKSTINSLEDLVAQDVFKYGVQQGGSLFSFFEKSKVRIYKKMFGKMSTLNT-FVKGTDEGVNRSRTTPFAYLTDQPSLDYYNQRKPCNTMLVKNLLDAKSYALGLQR-NSEWTDGISVAILQLREEGEVERIRYKW---WDAMSECNLKDAVVSNQPMSLELHHLAGVFIILGGGAGISLVILLME 291          
BLAST of Glutamate receptor ionotropic vs. Ensembl Medaka
Match: GRIK2 (glutamate receptor ionotropic, kainate 2 [Source:NCBI gene;Acc:101173029])

HSP 1 Score: 403.29 bits (1035), Expect = 1.032e-124
Identity = 219/472 (46.40%), Postives = 313/472 (66.31%), Query Frame = 1
Query: 1321 DFNFESIYLGESHLERISYWSKKAGFKPILNRAETMRDR---LLTQIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPC---FNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKS-DHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIEM 2712
            DF+ + I L E  LE+I  W   +G    LN  ET + +   +   + NK+ RV+T+ + P+VM+++ D+   PL GNDRF G  +DLLR LS +  F Y +  V+D  YG+L+E+TG+WNGM+ EL++++ADLAVA L ITY RE+VIDF+ P+M+LG+SI+ +K   +   +  F+ PLS ++W+ +L A + VS  LF++ R +PYEWY  HPC    + VEN F++LNSFWF VG+LMQQG ++ PKA STR++G IWWFF LI+ISSYTANLAAFLT+ER+++ I S ++L+ Q K+ YG +  G+T +FFK + ISTY KMW FM S   S+ V N  +GIQ+VL  +YAF++EST  E+  QRNCNL  +GGL+DSR Y +G P G+   RD ++ +IL+LQ+E  L   +  W  R N    C E  +   +    LG++ +GG F  L  GL +S  V+  E+
Sbjct:  389 DFDLDVISLKEEGLEKIGTWDPPSG----LNMTETHKSKTSNITDSLANKSLRVSTILEEPYVMFKKSDK---PLYGNDRFEGYCIDLLRELSGILGFRYELRLVEDGKYGALDESTGQWNGMVRELMDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLACLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIPYGVVEDGATMTFFKKTKISTYDKMWEFMNSRRQSVMVKNVEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSRAYGVGTPMGSP-YRDKITIAILQLQEEGKLHMMKEKW-WRGN---GCPEEESKEAS---ALGVQNIGGIFIVLAAGLVLSVFVAVGEV 845          
BLAST of Glutamate receptor ionotropic vs. Ensembl Medaka
Match: GRIK2 (glutamate ionotropic receptor kainate type subunit 2 [Source:NCBI gene;Acc:101172189])

HSP 1 Score: 395.971 bits (1016), Expect = 6.178e-122
Identity = 222/513 (43.27%), Postives = 325/513 (63.35%), Query Frame = 1
Query: 1321 DFNFESIYLGESHLERISYWSKKAGFKPILNRAETMRDRLLT---QIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPC---FNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKS-DHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIEMTIWAXXXXXXXXXXXVYDVIDSQIKMAFGQCHRF--KPNSP 2829
            DF+ + I L E  LE+I  W   +G    LN  +  + + +     + N++  V+T+ + P+VM+R+ D    PL GNDRF G  +DLLR L+ +  F Y +  V+D  YG  +E +G+WNGM+ EL+++ ADLAVA L ITY RE+VIDF+ P+M+LG+SI+ +K   +   +  F++PLS ++W+ +L AY+ VS  LF++ R +PYEWY  +PC    + VEN F++LNSFWF VG+LMQQG ++ PKA STR++G IWWFF LI+ISSYTANLAAFLT+ER+++ I S ++L+ Q K++YG +  GST SFFK + ISTY KMW FM S  HS+ V +   GI +VL  +YAF+ EST  E+  QRNCNL  +GGL+DS+ Y +G P G+   RD ++ +IL+LQ+E  L   +  W  R N    C E  +      N LG++ +GG F  L  GL +S  V+  E    + + +  +K+     V+D +++++    HR   KP  P
Sbjct:  385 DFDLDVISLKEEGLEKIGIWDPSSG----LNMTDNQKGKTINVSDSLSNRSLIVSTILEEPYVMFRKSD---TPLYGNDRFEGYCIDLLRELASILGFTYEVRLVEDGKYGVQDENSGQWNGMVRELMDHRADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLSPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPYPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKVEYGVVEDGSTMSFFKKTKISTYDKMWEFMSSRRHSVMVGSVEDGIHRVLTSDYAFLTESTTIEFVTQRNCNLTQIGGLIDSKAYGVGTPMGSP-YRDKITIAILQLQEEGKLHMMKEKW-WRGN---GCPEEESKEA---NALGVQNIGGIFIVLAAGLVLSVFVAVGEFLYKSKQSAQLEKRSFCKTVVD-ELRVSLKCQHRLKHKPQPP 881          
BLAST of Glutamate receptor ionotropic vs. Ensembl Medaka
Match: grik1b (glutamate ionotropic receptor kainate type subunit 1 [Source:NCBI gene;Acc:101173645])

HSP 1 Score: 392.504 bits (1007), Expect = 3.705e-121
Identity = 221/471 (46.92%), Postives = 308/471 (65.39%), Query Frame = 1
Query: 1321 DFNFESIYLGESHLERISYWSKKAGFKPILNRAETMRD---RLLTQIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPC---FNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKS-DHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIE 2709
            +F+ + I L E  LE+I  W+ + G    LN  ET RD    +   + N+T  VTT+ + P+VMY++ D+   PL GNDRF G  +DLL+ LS +  F+Y +  V D  YG+ N+  G+WNGM+ ELI++ ADLAVA LTITY RE+VIDF+ P+M+LG+SI+  K   +   +  F+ PLS ++W+ +L A + VS  LF++ R TPYEWY  HPC    + VEN F+++NS WF VG+LMQQG ++ PKA STR++G IWWFF LI+ISSYTANLAAFLT+ER+ + I S ++L+ Q K++YG +  GST +FFK S ISTY+KMW FM S  ++  V N  +GIQ+VL  +YA ++EST  EY  QRNCNL  +GGL+DS+GY +G P G+   RD ++ +IL+LQ+E  L   +  W  R N    C E  +   +    LG+E +GG F  L  GL +S  V+  E
Sbjct:  376 EFDLDVISLKEDGLEKIGVWNSQMG----LNLTETSRDSSTNITDSMANRTLVVTTILENPYVMYKKSDK---PLYGNDRFEGYCLDLLKELSNILGFSYEVKLVSDGKYGAQNDK-GEWNGMVRELIDHVADLAVAPLTITYVREKVIDFSKPFMTLGISILYHKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLINSVWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMDSPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRKNTALVKNNREGIQRVLTTDYALLMESTSIEYISQRNCNLTQIGGLIDSKGYGVGTPIGSP-YRDKVTIAILQLQEEGKLHMMKEKW-WRGN---GCPEEDSKEAS---ALGVENIGGIFIVLAAGLVLSVFVAIGE 830          
BLAST of Glutamate receptor ionotropic vs. Ensembl Medaka
Match: GRIK2 (glutamate ionotropic receptor kainate type subunit 2 [Source:NCBI gene;Acc:101172189])

HSP 1 Score: 392.889 bits (1008), Expect = 4.340e-121
Identity = 214/471 (45.44%), Postives = 306/471 (64.97%), Query Frame = 1
Query: 1321 DFNFESIYLGESHLERISYWSKKAGFKPILNRAETMRDRLLT---QIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPC---FNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKS-DHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIE 2709
            DF+ + I L E  LE+I  W   +G    LN  +  + + +     + N++  V+T+ + P+VM+R+ D    PL GNDRF G  +DLLR L+ +  F Y +  V+D  YG  +E +G+WNGM+ EL+++ ADLAVA L ITY RE+VIDF+ P+M+LG+SI+ +K   +   +  F++PLS ++W+ +L AY+ VS  LF++ R +PYEWY  +PC    + VEN F++LNSFWF VG+LMQQG ++ PKA STR++G IWWFF LI+ISSYTANLAAFLT+ER+++ I S ++L+ Q K++YG +  GST SFFK + ISTY KMW FM S  HS+ V +   GI +VL  +YAF+ EST  E+  QRNCNL  +GGL+DS+ Y +G P G+   RD ++ +IL+LQ+E  L   +  W  R N    C E  +      N LG++ +GG F  L  GL +S  V+  E
Sbjct:  385 DFDLDVISLKEEGLEKIGIWDPSSG----LNMTDNQKGKTINVSDSLSNRSLIVSTILEEPYVMFRKSD---TPLYGNDRFEGYCIDLLRELASILGFTYEVRLVEDGKYGVQDENSGQWNGMVRELMDHRADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLSPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPYPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKVEYGVVEDGSTMSFFKKTKISTYDKMWEFMSSRRHSVMVGSVEDGIHRVLTSDYAFLTESTTIEFVTQRNCNLTQIGGLIDSKAYGVGTPMGSP-YRDKITIAILQLQEEGKLHMMKEKW-WRGN---GCPEEESKEA---NALGVQNIGGIFIVLAAGLVLSVFVAVGE 840          
BLAST of Glutamate receptor ionotropic vs. Ensembl Medaka
Match: GRIK2 (glutamate ionotropic receptor kainate type subunit 2 [Source:NCBI gene;Acc:101172189])

HSP 1 Score: 392.119 bits (1006), Expect = 7.377e-121
Identity = 214/471 (45.44%), Postives = 306/471 (64.97%), Query Frame = 1
Query: 1321 DFNFESIYLGESHLERISYWSKKAGFKPILNRAETMRDRLLT---QIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPC---FNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKS-DHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIE 2709
            DF+ + I L E  LE+I  W   +G    LN  +  + + +     + N++  V+T+ + P+VM+R+ D    PL GNDRF G  +DLLR L+ +  F Y +  V+D  YG  +E +G+WNGM+ EL+++ ADLAVA L ITY RE+VIDF+ P+M+LG+SI+ +K   +   +  F++PLS ++W+ +L AY+ VS  LF++ R +PYEWY  +PC    + VEN F++LNSFWF VG+LMQQG ++ PKA STR++G IWWFF LI+ISSYTANLAAFLT+ER+++ I S ++L+ Q K++YG +  GST SFFK + ISTY KMW FM S  HS+ V +   GI +VL  +YAF+ EST  E+  QRNCNL  +GGL+DS+ Y +G P G+   RD ++ +IL+LQ+E  L   +  W  R N    C E  +      N LG++ +GG F  L  GL +S  V+  E
Sbjct:  373 DFDLDVISLKEEGLEKIGIWDPSSG----LNMTDNQKGKTINVSDSLSNRSLIVSTILEEPYVMFRKSD---TPLYGNDRFEGYCIDLLRELASILGFTYEVRLVEDGKYGVQDENSGQWNGMVRELMDHRADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLSPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPYPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKVEYGVVEDGSTMSFFKKTKISTYDKMWEFMSSRRHSVMVGSVEDGIHRVLTSDYAFLTESTTIEFVTQRNCNLTQIGGLIDSKAYGVGTPMGSP-YRDKITIAILQLQEEGKLHMMKEKW-WRGN---GCPEEESKEA---NALGVQNIGGIFIVLAAGLVLSVFVAVGE 828          
BLAST of Glutamate receptor ionotropic vs. Planmine SMEST
Match: SMESG000022851.1 (SMESG000022851.1)

HSP 1 Score: 1918.66 bits (4969), Expect = 0.000e+0
Identity = 953/974 (97.84%), Postives = 958/974 (98.36%), Query Frame = 1
Query:  169 MNTNKLKFPHSQTTESSIPVLKKEIFVCLWLLMTTCFAKTGSISDKTVVNLALTLELNQIKVYQEILGKQDQPQTLIGSMIIEGSLIQDFLKLKDLVSKATNVILLKAKLEMESQLKMDCYQDYLIRLLAEKLNTTLFMVGKLSSCSNDFSFKNPAQFGDSRSMSHVIFLVSVTTEYYRLMLRDLVYSDQHVWNEALIIYDQSQVFSTFRNVMETTEKVFHFRHWTSDRATNARIIKNFRHVRTFIVDMNDKNVHSFFLLAAGLQLLNAMTTTVIIMDRDNLIESIRDFAFMAANITVIRPTLYDSKLFKTISNKINYQKIDFPQKIVKVLLQHLYLVMNNQKGNKTLGKRSGFISPFSWFDEFNVSLANDVKVFTDPNLNYCFDFNFESIYLGESHLERISYWSKKAGFKPILNRAETMRDRLLTQIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXXQFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPCFNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKSDHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIEMTIWAXXXXXXXXXXXVYDVIDSQIKMAFGQCHRFKPNSPSTNSSSIHDSPVLCNTFKAGSATITIPSMRRYLKSASHEELYQPLPLERALLMKCDYNKPNKYSCFYEPYQAANGVIAQDAHKVTSL 3090
            MNTNKLKFPHSQTT+SSIPVLKKEIFVCLWLLMTTCFAKTGSISDKTVVNLALTLELNQIKVYQEILGKQDQPQTLIGSMIIEGSLIQDFLKLKDLVSKATNVILLKAKLEMESQLKMDCYQDYLIRLL+EKLNTTLFMVGKLSSCSNDFSFKNPAQFGDSRS+SHVIFLVSVTTEYYRLMLRDLVYSDQHVWNEALIIYDQSQVFSTFRNVMETTEKVFHFRHWTSDRATNARIIKNFRHVRTFIVDMNDKNVHSFFLLAAGLQLLNAMTTTVIIMDRDNLIESIRDFAFMAANITVIRPTLYDSKLFKTISNKINYQKIDFPQKIVKVLLQHLYLVMNNQKGNKTLGKRSGFISPFSWFDEFNVSLANDVKVFTDPNLNYCFDFNFESIYLGESHLERISYWSKKAGFKPILNR ETMRDRLLTQIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMSLGLSIVIKKSISSTKLLQFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPCFNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQ KMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKSDHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIEMTIWASKR+MKKKKRSVYDVIDSQIKMAFGQCHRFKPNSPSTNSS+             GSATITIPSMRRYLKSASHEELYQPLPLERALLMKCDYNKPNKYSCFYEPYQAANGVI QDAHKVTSL
Sbjct:    1 MNTNKLKFPHSQTTDSSIPVLKKEIFVCLWLLMTTCFAKTGSISDKTVVNLALTLELNQIKVYQEILGKQDQPQTLIGSMIIEGSLIQDFLKLKDLVSKATNVILLKAKLEMESQLKMDCYQDYLIRLLSEKLNTTLFMVGKLSSCSNDFSFKNPAQFGDSRSISHVIFLVSVTTEYYRLMLRDLVYSDQHVWNEALIIYDQSQVFSTFRNVMETTEKVFHFRHWTSDRATNARIIKNFRHVRTFIVDMNDKNVHSFFLLAAGLQLLNAMTTTVIIMDRDNLIESIRDFAFMAANITVIRPTLYDSKLFKTISNKINYQKIDFPQKIVKVLLQHLYLVMNNQKGNKTLGKRSGFISPFSWFDEFNVSLANDVKVFTDPNLNYCFDFNFESIYLGESHLERISYWSKKAGFKPILNRTETMRDRLLTQIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMSLGLSIVIKKSISSTKLLQFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPCFNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQTKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKSDHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIEMTIWASKRAMKKKKRSVYDVIDSQIKMAFGQCHRFKPNSPSTNSST-------------GSATITIPSMRRYLKSASHEELYQPLPLERALLMKCDYNKPNKYSCFYEPYQAANGVITQDAHKVTSL 961          
BLAST of Glutamate receptor ionotropic vs. Planmine SMEST
Match: SMESG000005067.1 (SMESG000005067.1)

HSP 1 Score: 603.979 bits (1556), Expect = 0.000e+0
Identity = 341/854 (39.93%), Postives = 524/854 (61.36%), Query Frame = 1
Query:  277 FAKTGSISDKTVVNLALTLELNQIKVYQEILGKQDQPQTLIGSMIIEGSLIQDFLKLKDLVSKATNVILLKAKLEMESQLKMDCYQDYLIRLLAEKLNTTLFMVGKLSSCSNDFSFKNPAQFGDSRSMSHVIFLVSVTTEYYRLMLRDLVYSDQHVWNEALIIYDQSQVFSTFRNVMETTEKVFHFRHWTSDRATNARIIKNFRHVRTFIVDMNDKNVHSFFLLAAGLQLLNAMTTTVIIMDRDNLIESIRDFAFMAANITVIRPTLYDSKLFKTISNKINYQKIDFPQKIVKVLLQHLYLVMNNQKGNKTLGKRSGFISPFSWFDEFNVSLANDVKVFTDPNLNYCFDFNFESIYLGESHLERISYWSKKAGFKPILNRAETMRDRLLTQIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXXQFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPCFNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKSDHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIEMTIWAXXXXXXXXXXXVYDVIDSQIKMAFGQCHRFKPNSPSTN 2838
            +++T  I D  +VNL +  ++ QI V+++ L    Q    IG M   G+L++D  +LK++ +K+T+VIL +A +   S + +DCY    +R  +EK+ TT+F+  +L++C     F+         +  + + L S+TT+YY  ML DLV  +   WN   +IYD  +VFS+F   ME +E  F FR W  +   N  +I+  R +  F++D+N+  + SFF  A+GL++ N MTT +II++++  +E IR F  + +NIT+IRP LY +  +   +N    +   F  K+  V L+ L   +N ++ N+T   ++ FI   +W +EF  ++  ++      N NY  D +FES +L E++  + S WS   GF P     +T     L +  +K  RV+T+   PFV+YRE D++G P+ GN RF GM++D+L+ LS+M  F YV+H VKD  +G+ N+ TG W+GM+GE+INNEAD+AV  +TIT++R RVIDFT PWMS G+S +IKK   S     FM P S N+WLM+LG+YI+VS TLFLVGR++P+EW  K    NKV N FSVLN F++  GS+ +   D++ ++ STRM+ TIWW FI++ I SY+A L      E+   ++ ++++LS Q K+KYGT+  GSTYS F+ SNI  Y+++ +FM+ + S+ VDN  +GI+KVL G+YAFILES++ E+Y +R C+L P    L +RGY  GL SGN +L+  LSE ILRL++ Q+LES R  W  ++   ++C    N   +  +QL L+ M   F  LI+ L +S  V+C+E+ IWA ++  K  K +   VI  Q+++AF    R     PS++
Sbjct:    4 YSETAQIPDVMIVNLEIKPDIGQISVFRKSLLNTYQAVESIGKMKFSGNLLKDIYELKEIFNKSTSVILFQAYIAPNSIVLIDCYTQSFLREFSEKVKTTIFITSRLATC-----FETKINREWYLTNHNGVVLTSITTDYYGKMLSDLVSIEN--WNNVAVIYDHYEVFSSFYKAMEHSETKFIFRLW-KNIMNNIEMIQKLRQINIFVLDLNEDALKSFFHSASGLRIFNEMTTKIIIIEQNIELELIRMFVPLVSNITIIRPVLYKTYSYIYKNNDNPMEDFGFDHKLRGVFLKKLQTFLNERQMNETYLNKT-FIPAVAWIEEFIPTVTTEMPQIMVANQNYYLDTSFESAFLSENYFNKSSLWSYSGGFSPTSFTDKTKSMNQLPKFDDKILRVSTIASEPFVIYRETDDNGIPILGNSRFSGMSIDILKHLSQMNNFKYVLHLVKDFKFGTFNDKTGNWSGMVGEIINNEADIAVGPITITFERNRVIDFTIPWMSFGISAIIKKQSFSKN--SFMNPFSINLWLMILGSYIIVSFTLFLVGRLSPFEWCTKSADPNKVTNSFSVLNCFYYATGSVRRGNNDVTFRSFSTRMLSTIWWIFIILFIVSYSAKLVVLFLTEKDVYNVNTIKDLSRQTKIKYGTVRHGSTYSIFQKSNIEAYERIGDFMRKNPSVLVDNIQEGIEKVLKGDYAFILESSMKEFYSKRMCDLSPFTDRLFTRGYGFGLRSGNTILQQKLSEGILRLEEGQILESLRYQWFEQHGFIEACPSRLNGDFSQGHQLTLKNMKYFFITLIVLLIISFFVACLELIIWA-QKQSKIYKNTFSSVICGQLRLAFCNHKRSAYPIPSSD 845          
BLAST of Glutamate receptor ionotropic vs. Planmine SMEST
Match: SMESG000005067.1 (SMESG000005067.1)

HSP 1 Score: 597.816 bits (1540), Expect = 0.000e+0
Identity = 339/843 (40.21%), Postives = 517/843 (61.33%), Query Frame = 1
Query:  310 VVNLALTLELNQIKVYQEILGKQDQPQTLIGSMIIEGSLIQDFLKLKDLVSKATNVILLKAKLEMESQLKMDCYQDYLIRLLAEKLNTTLFMVGKLSSCSNDFSFKNPAQFGDSRSMSHVIFLVSVTTEYYRLMLRDLVYSDQHVWNEALIIYDQSQVFSTFRNVMETTEKVFHFRHWTSDRATNARIIKNFRHVRTFIVDMNDKNVHSFFLLAAGLQLLNAMTTTVIIMDRDNLIESIRDFAFMAANITVIRPTLYDSKLFKTISNKINYQKIDFPQKIVKVLLQHLYLVMNNQKGNKTLGKRSGFISPFSWFDEFNVSLANDVKVFTDPNLNYCFDFNFESIYLGESHLERISYWSKKAGFKPILNRAETMRDRLLTQIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXXQFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPCFNKVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKSDHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIEMTIWAXXXXXXXXXXXVYDVIDSQIKMAFGQCHRFKPNSPSTN 2838
            +VNL +  ++ QI V+++ L    Q    IG M   G+L++D  +LK++ +K+T+VIL +A +   S + +DCY    +R  +EK+ TT+F+  +L++C     F+         +  + + L S+TT+YY  ML DLV  +   WN   +IYD  +VFS+F   ME +E  F FR W  +   N  +I+  R +  F++D+N+  + SFF  A+GL++ N MTT +II++++  +E IR F  + +NIT+IRP LY +  +   +N    +   F  K+  V L+ L   +N ++ N+T   ++ FI   +W +EF  ++  ++      N NY  D +FES +L E++  + S WS   GF P     +T     L +  +K  RV+T+   PFV+YRE D++G P+ GN RF GM++D+L+ LS+M  F YV+H VKD  +G+ N+ TG W+GM+GE+INNEAD+AV  +TIT++R RVIDFT PWMS G+S +IKK   S     FM P S N+WLM+LG+YI+VS TLFLVGR++P+EW  K    NKV N FSVLN F++  GS+ +   D++ ++ STRM+ TIWW FI++ I SY+A L      E+   ++ ++++LS Q K+KYGT+  GSTYS F+ SNI  Y+++ +FM+ + S+ VDN  +GI+KVL G+YAFILES++ E+Y +R C+L P    L +RGY  GL SGN +L+  LSE ILRL++ Q+LES R  W  ++   ++C    N   +  +QL L+ M   F  LI+ L +S  V+C+E+ IWA K+S   K      VI  Q+++AF    R     PS++
Sbjct:    2 IVNLEIKPDIGQISVFRKSLLNTYQAVESIGKMKFSGNLLKDIYELKEIFNKSTSVILFQAYIAPNSIVLIDCYTQSFLREFSEKVKTTIFITSRLATC-----FETKINREWYLTNHNGVVLTSITTDYYGKMLSDLVSIEN--WNNVAVIYDHYEVFSSFYKAMEHSETKFIFRLW-KNIMNNIEMIQKLRQINIFVLDLNEDALKSFFHSASGLRIFNEMTTKIIIIEQNIELELIRMFVPLVSNITIIRPVLYKTYSYIYKNNDNPMEDFGFDHKLRGVFLKKLQTFLNERQMNETYLNKT-FIPAVAWIEEFIPTVTTEMPQIMVANQNYYLDTSFESAFLSENYFNKSSLWSYSGGFSPTSFTDKTKSMNQLPKFDDKILRVSTIASEPFVIYRETDDNGIPILGNSRFSGMSIDILKHLSQMNNFKYVLHLVKDFKFGTFNDKTGNWSGMVGEIINNEADIAVGPITITFERNRVIDFTIPWMSFGISAIIKKQSFSKN--SFMNPFSINLWLMILGSYIIVSFTLFLVGRLSPFEWCTKSADPNKVTNSFSVLNCFYYATGSVRRGNNDVTFRSFSTRMLSTIWWIFIILFIVSYSAKLVVLFLTEKDVYNVNTIKDLSRQTKIKYGTVRHGSTYSIFQKSNIEAYERIGDFMRKNPSVLVDNIQEGIEKVLKGDYAFILESSMKEFYSKRMCDLSPFTDRLFTRGYGFGLRSGNTILQQKLSEGILRLEEGQILESLRYQWFEQHGFIEACPSRLNGDFSQGHQLTLKNMKYFFITLIVLLIISFFVACLELIIWAQKQSKIYKNTFS-SVICGQLRLAFCNHKRSAYPIPSSD 832          
BLAST of Glutamate receptor ionotropic vs. Planmine SMEST
Match: SMESG000062485.1 (SMESG000062485.1)

HSP 1 Score: 430.639 bits (1106), Expect = 2.362e-137
Identity = 235/510 (46.08%), Postives = 335/510 (65.69%), Query Frame = 1
Query: 1354 SHLERISYWSKKAGFKPILNRAETMRDRLLTQIHNKTFRVTTLEDPPFVMYREFDEHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTG--KWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPCFNKVE---NQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKSDHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIEMTIWAXXXXXXXXXXXVYDVIDSQIKMAFGQCHRFKPNSPSTNSSSIHDSPV 2865
            S  E  + W+K       + +A+T    L  +I  +  RVTT+ DPPFV+  + D +G   K  D + G  + +L+ ++E + FN+ +  V+D+ YG L+   G  KW G++G LI+++ADLAV+SLTITYDRERVIDFTTP+M+LG+SI+ KK       L  F++PLS  VW  ++ +YI VS  LF++GR+TPYEWY   PC    E   N+F++LNS WFT+G+ MQQG DI PKATSTR+I  +WWFF LI+ISSYTANLAAFLT+ R+   I + E+LS Q+K+ YG + GG+TY+FF+ S+++TYKKM+ +M  + S+FV +  +GI++V + NYAFILEST NEYY QR+C+LM +GGLLDS+GY IGLP G+   RD +SESILRLQK Q +E+ RR +  +Y++ K C      A T  + LG+ ++GG F  L  G+ +  +V+  E+   A K+S  KK     +  +  ++M    C+R   N P  + SS   SP+
Sbjct:  112 SFFESFNTWNKTNRMG--IPKAKTDLKDLNLEISKQVLRVTTIIDPPFVISLKRDANGITPKSPDAWAGFCIQILKKIAEERGFNFTVEEVEDKKYGELDHEEGVPKWTGLVGALISHKADLAVSSLTITYDRERVIDFTTPFMNLGISIIYKKPAPKEVELFSFLSPLSVPVWGYVIASYISVSFVLFVIGRLTPYEWYNSSPCQKNPEFSSNRFNILNSMWFTIGTFMQQGIDIMPKATSTRIIAGMWWFFTLIIISSYTANLAAFLTVARMNVPIENAEDLSKQVKIPYGAVKGGATYTFFEKSDLATYKKMYKYMNRNPSVFVKSNKEGIERVKNTNYAFILESTTNEYYTQRDCDLMRVGGLLDSKGYGIGLPEGSR-YRDAISESILRLQKSQEIEALRRYYWRQYDIDKPCEAPEKSAST--SSLGINEVGGVFVMLFFGIAIGLLVAIFELFYKAWKKSKIKKTTICIEAKEI-LRMNIRSCYR-SSNKPPVDDSSNGSSPI 614          
BLAST of Glutamate receptor ionotropic vs. Planmine SMEST
Match: SMESG000005199.1 (SMESG000005199.1)

HSP 1 Score: 377.096 bits (967), Expect = 1.953e-114
Identity = 252/715 (35.24%), Postives = 393/715 (54.97%), Query Frame = 1
Query:  739 HVWNEALIIYDQSQVFSTFRNVMETTEKVFHFRHWTS-DRATNARIIKNF---RHVRTFIVDMNDKNVHSFFLLAAGLQLLNAMTTTVIIMDRDNLIESIRDFAFM-AANITVIRPTLYD------------SKLFKTI------SNKINYQK------------IDFPQKIVKVLLQHLYLVMNNQK--GNKTLGKRSGFISPFSWFDEFNVSLANDVKVFTDPNLNYCFDFNFESIYLGESHLERISYWSKKAGFKPILNRAETMRDRLLTQIHN--KTFRVTTLEDPPFVMYREFDEHGAPLKGN-----DRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNET------TGKWNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMXXXXXXXXXXXXXXXXXX-QFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPCFN--KVENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSYTANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNISTYKKMWNFMKSDHSLFVDNTAKGIQKVL--DGNYAFILESTLNEYYCQRNCNLMPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLRYNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIEMTI 2718
             +W + ++I+        F +++   E  F  R W   D   N ++++     +  R F+VD+    +  F ++A+   + +   +  I  D D  +  I  F      NIT    T +              KL ++I      S K + +K            ++F  K +  LL+   L++   K   N T    S  I+  +  +          K+  + N     ++N   + L E+  ++  +W+    F  +  R E      + +I N  +  +VTT+   PFV Y+E    G P + N     + + G  +DLLR +      N+ IH VKD  YG   E       + KWNGMIGELI  +A+LA+A +TI+Y+RE+V+DFTTP+MSLGLSI+  K       L  F++P+S  VW+ ++ AYI VS  +F +  +TPYEW   HPC +  +++NQF++LNS WFTVG+LM+QG +  P+A+STRM+   WWFF LI+IS+YTANLAAFLT+E+L   I SVE+L+ Q  +KYGT+ GG++++FF+ + I TY+KM+ FMK +  +FVD+T KG+ KV   +G YAF+LES +N++Y QR+C+LM +G LLDS+GY IG PSG + LRD +++SIL+LQK Q + +    W    N+T+ C   S  + ++  +L + ++GG F  L+ G   + IVS IE+ +
Sbjct:  153 EIWRDMILIHSSDNCILKFEHLLNQFESRFKMRQWVHHDLKKNKKLLRELGKSKKYRYFLVDIPYWQITDFLIMASVHNMTDPQFS-FIFTDWDASLVDIAAFKINNKVNITTFSITDHSIMERMTKTYENVEKLLESIVEMEKTSKKCDIEKAFMSKPAILFDTVNFLTKGIIRLLKSRPLIVRPMKCKSNDTWRLGSSLINAMTAAENL---YGITGKILFNENAQRK-NYNLSIMELTENGFQKGGFWNDDR-FVVLPKRIEPS----VVEIGNIVRPLKVTTIISQPFVFYKE----GEPDRQNYDTNMEAWNGFCIDLLREIGNDLGMNFTIHLVKDNKYGEAVENQTNPDGSEKWNGMIGELITKQAELAMAPMTISYEREKVVDFTTPFMSLGLSILFLKPKKEAPGLFSFLSPISFPVWVYIISAYIGVSFIIFFISHVTPYEWLQIHPCDDNSELDNQFNLLNSLWFTVGALMRQGLEFCPQASSTRMVSGAWWFFTLIIISTYTANLAAFLTVEQLILPIKSVEDLAQQTNIKYGTLKGGTSFTFFEKALIPTYQKMFKFMKKNREVFVDSTEKGVNKVRNSNGKYAFLLESAMNDFYSQRDCSLMRIGDLLDSKGYGIGFPSG-SPLRDHMTKSILKLQKSQKIANLIHKWWNEMNITEPC--DSKESGSVPTELNVYQIGGIFILLVGGFIFAAIVSIIELYV 850          
The following BLAST results are available for this feature:
BLAST of Glutamate receptor ionotropic vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIK22.077e-12345.86glutamate ionotropic receptor kainate type subunit... [more]
GRIK22.098e-12345.86glutamate ionotropic receptor kainate type subunit... [more]
GRIK22.444e-12344.16glutamate ionotropic receptor kainate type subunit... [more]
GRIK25.415e-12344.16glutamate ionotropic receptor kainate type subunit... [more]
GRIK26.544e-12345.86glutamate ionotropic receptor kainate type subunit... [more]
back to top
BLAST of Glutamate receptor ionotropic vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glr-38.290e-10442.59GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-41.458e-9839.02GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-43.271e-9839.02GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-11.178e-8337.04Glutamate receptor 1 [Source:UniProtKB/Swiss-Prot... [more]
glr-55.853e-8134.88GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
back to top
BLAST of Glutamate receptor ionotropic vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KaiR1D2.861e-11843.61gene:FBgn0038837 transcript:FBtr0083987[more]
CG111552.094e-11534.97gene:FBgn0039927 transcript:FBtr0333701[more]
CG111552.094e-11534.97gene:FBgn0039927 transcript:FBtr0089195[more]
Ekar6.303e-10043.50gene:FBgn0039916 transcript:FBtr0110906[more]
Ekar3.780e-9843.50gene:FBgn0039916 transcript:FBtr0344874[more]
back to top
BLAST of Glutamate receptor ionotropic vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIK21.686e-12245.44glutamate receptor, ionotropic, kainate 2 [Source:... [more]
GRIK21.686e-12245.44glutamate receptor, ionotropic, kainate 2 [Source:... [more]
grik1b6.233e-11745.25glutamate receptor, ionotropic, kainate 1b [Source... [more]
grik1b1.757e-11645.25glutamate receptor, ionotropic, kainate 1b [Source... [more]
grik42.136e-11646.45glutamate receptor, ionotropic, kainate 4 [Source:... [more]
back to top
BLAST of Glutamate receptor ionotropic vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ugt2a14.740e-12546.38UDP glucuronosyltransferase 2 family, polypeptide ... [more]
ugt2a16.644e-12546.38UDP glucuronosyltransferase 2 family, polypeptide ... [more]
ugt2a11.162e-12446.38UDP glucuronosyltransferase 2 family, polypeptide ... [more]
ugt2a11.677e-12446.38UDP glucuronosyltransferase 2 family, polypeptide ... [more]
ugt2a11.829e-12446.38UDP glucuronosyltransferase 2 family, polypeptide ... [more]
back to top
BLAST of Glutamate receptor ionotropic vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Grik11.878e-12347.56glutamate receptor, ionotropic, kainate 1 [Source:... [more]
Grik23.641e-12344.16glutamate receptor, ionotropic, kainate 2 (beta 2)... [more]
Grik23.641e-12344.16glutamate receptor, ionotropic, kainate 2 (beta 2)... [more]
Grik24.134e-12345.86glutamate receptor, ionotropic, kainate 2 (beta 2)... [more]
Grik24.134e-12345.86glutamate receptor, ionotropic, kainate 2 (beta 2)... [more]
back to top
BLAST of Glutamate receptor ionotropic vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P39087|GRIK2_MOUSE2.547e-12244.16Glutamate receptor ionotropic, kainate 2 OS=Mus mu... [more]
sp|Q13002|GRIK2_HUMAN2.600e-12244.16Glutamate receptor ionotropic, kainate 2 OS=Homo s... [more]
sp|P42260|GRIK2_RAT3.007e-12244.16Glutamate receptor ionotropic, kainate 2 OS=Rattus... [more]
sp|P42264|GRIK3_RAT2.623e-12146.38Glutamate receptor ionotropic, kainate 3 OS=Rattus... [more]
sp|Q13003|GRIK3_HUMAN4.314e-12146.17Glutamate receptor ionotropic, kainate 3 OS=Homo s... [more]
back to top
BLAST of Glutamate receptor ionotropic vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q8MMK20.000e+092.75DjGluR2 (Fragment) OS=Dugesia japonica OX=6161 GN=... [more]
A0A5K4EQ590.000e+042.08Putative glutamate receptor, kainate OS=Schistosom... [more]
G4V9510.000e+042.37Putative glutamate receptor, kainate OS=Schistosom... [more]
A0A4E0R7W90.000e+046.45Glutamate receptor ionotropic kainate 3 OS=Fasciol... [more]
A0A2H1CEY80.000e+046.45Ligand-gated ion channel OS=Fasciola hepatica OX=6... [more]
back to top
BLAST of Glutamate receptor ionotropic vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIK21.467e-12345.65glutamate receptor ionotropic, kainate 2 [Source:N... [more]
GRIK21.957e-12345.65glutamate receptor ionotropic, kainate 2 [Source:N... [more]
GRIK22.054e-12345.65glutamate receptor ionotropic, kainate 2 [Source:N... [more]
GRIK22.867e-12345.65glutamate receptor ionotropic, kainate 2 [Source:N... [more]
ENSAMXT00000004586.25.704e-12345.97glutamate receptor ionotropic, kainate 2-like [Sou... [more]
back to top
BLAST of Glutamate receptor ionotropic vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gria1b2.636e-9738.80glutamate receptor, ionotropic, AMPA 1b [Source:ZF... [more]
ENSPMAT00000005084.11.674e-9549.70pep scaffold:Pmarinus_7.0:GL476900:54926:87395:-1 ... [more]
ENSPMAT00000002503.11.494e-6553.48pep scaffold:Pmarinus_7.0:GL492163:1:1446:1 gene:E... [more]
ENSPMAT00000007790.11.790e-3729.49pep scaffold:Pmarinus_7.0:GL476616:796957:798868:-... [more]
ENSPMAT00000010716.14.805e-3526.88pep scaffold:Pmarinus_7.0:GL476465:413535:454465:1... [more]
back to top
BLAST of Glutamate receptor ionotropic vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutamate receptor ionotropic vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO302038.053e-7133.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412918.353e-6935.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466331.167e-5830.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355454.428e-4631.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412932.456e-4333.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glutamate receptor ionotropic vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIK21.032e-12446.40glutamate receptor ionotropic, kainate 2 [Source:N... [more]
GRIK26.178e-12243.27glutamate ionotropic receptor kainate type subunit... [more]
grik1b3.705e-12146.92glutamate ionotropic receptor kainate type subunit... [more]
GRIK24.340e-12145.44glutamate ionotropic receptor kainate type subunit... [more]
GRIK27.377e-12145.44glutamate ionotropic receptor kainate type subunit... [more]
back to top
BLAST of Glutamate receptor ionotropic vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022851.10.000e+097.84SMESG000022851.1[more]
SMESG000005067.10.000e+039.93SMESG000005067.1[more]
SMESG000005067.10.000e+040.21SMESG000005067.1[more]
SMESG000062485.12.362e-13746.08SMESG000062485.1[more]
SMESG000005199.11.953e-11435.24SMESG000005199.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029127 ID=SMED30029127|Name=Glutamate receptor ionotropic|organism=Schmidtea mediterranea sexual|type=transcript|length=3097bp
CGCCAATTGGAATAGTTTCTTTTCAATGCAAAATTATTTTGTTTAAATTT
ATACATGAATTTTCCTTCAAATATCTGTGACAATTTAGTGTTTTCAATCG
CTTTAAAAAAAAATATTTTAACAGATATTCTGAATATGTTTCATTGAAAT
GCAGAAACATTAAATCAAATGAATACAAACAAATTAAAGTTTCCACATTC
CCAAACAACTGAGAGTAGTATTCCGGTTTTGAAAAAAGAAATTTTCGTAT
GCTTATGGCTGCTTATGACGACTTGTTTTGCCAAAACTGGGTCCATATCC
GATAAAACTGTGGTTAATCTTGCCTTGACTTTGGAACTTAATCAGATCAA
AGTTTATCAAGAAATTCTTGGGAAACAAGATCAACCCCAAACTTTAATTG
GGTCTATGATTATAGAAGGAAGTTTAATACAAGATTTTCTCAAACTTAAA
GATCTTGTTTCCAAAGCGACAAATGTGATTCTTTTAAAAGCTAAATTAGA
AATGGAGTCTCAACTGAAAATGGATTGCTATCAAGATTATTTGATCAGAT
TACTCGCAGAAAAACTAAATACGACTCTCTTCATGGTCGGAAAGTTGTCA
TCTTGTTCCAATGATTTCTCTTTTAAAAATCCCGCTCAATTTGGTGACTC
TCGTTCAATGTCCCATGTGATTTTTCTAGTTTCAGTAACAACTGAATATT
ACAGATTAATGTTAAGAGATTTGGTTTATTCAGATCAACACGTTTGGAAT
GAGGCTCTCATTATTTATGATCAATCTCAAGTGTTTTCTACTTTTCGAAA
TGTCATGGAAACCACCGAAAAAGTATTCCATTTTCGACATTGGACTTCAG
ACCGAGCAACAAATGCACGGATCATTAAAAACTTCCGTCACGTTCGAACT
TTCATTGTCGATATGAATGATAAAAATGTGCATTCATTTTTTTTGTTGGC
GGCTGGTCTGCAATTGCTCAATGCTATGACGACAACAGTTATCATAATGG
ATAGAGATAATCTGATTGAATCTATTCGAGATTTTGCTTTCATGGCTGCC
AATATCACCGTAATCCGGCCGACGCTTTATGACAGTAAATTATTCAAAAC
GATTTCGAATAAAATAAATTACCAGAAAATTGATTTTCCTCAAAAAATTG
TGAAAGTTCTCCTTCAGCATTTGTATTTAGTAATGAATAATCAGAAAGGA
AATAAAACTTTAGGAAAAAGGTCCGGCTTCATTTCTCCATTTTCATGGTT
TGATGAATTCAACGTTTCATTGGCTAATGATGTGAAAGTTTTCACAGATC
CAAATTTGAACTATTGTTTTGATTTCAATTTTGAGTCAATCTATCTGGGA
GAAAGTCATTTGGAAAGGATTTCATACTGGTCAAAGAAAGCCGGCTTCAA
ACCGATATTAAACAGAGCTGAGACGATGAGAGACAGACTTCTCACTCAAA
TCCACAATAAGACATTTCGAGTGACGACTTTGGAAGATCCCCCTTTTGTC
ATGTATCGAGAATTTGATGAGCACGGTGCTCCATTAAAAGGAAACGATCG
ATTTATTGGAATGGCTATGGATCTCTTAAGAGCTTTGAGTGAAATGAAGA
GATTTAATTATGTAATACACCGAGTAAAGGATGAAACATATGGCAGTTTA
AATGAGACAACCGGGAAATGGAATGGAATGATAGGAGAGCTCATTAACAA
TGAAGCAGATTTGGCAGTGGCATCGCTGACAATAACATACGACCGAGAGC
GCGTTATCGATTTCACCACCCCTTGGATGAGTTTGGGACTGAGTATTGTA
ATTAAAAAATCAATTTCCAGCACTAAACTATTACAATTTATGGCACCATT
ATCGACGAATGTATGGTTGATGATGCTGGGTGCTTATATTGTGGTCAGTA
TCACACTGTTTCTGGTTGGTCGAATGACTCCTTATGAGTGGTACGTAAAA
CACCCTTGTTTTAATAAGGTTGAGAATCAGTTTTCTGTCTTGAATAGTTT
TTGGTTTACAGTTGGATCTTTAATGCAACAAGGTTGTGATATTTCTCCGA
AAGCTACATCGACCAGAATGATTGGCACGATTTGGTGGTTTTTCATTTTG
ATTATGATTTCATCTTATACTGCTAATTTGGCGGCTTTTCTTACAATTGA
ACGGTTGCAGAATGATATTACGAGTGTTGAGGAATTGTCCATGCAGATAA
AAATGAAATATGGAACAATTTATGGAGGTTCAACTTATTCATTTTTTAAA
AATTCAAATATTAGTACATACAAGAAAATGTGGAATTTCATGAAGAGTGA
CCATTCTCTGTTTGTAGACAACACTGCCAAAGGAATTCAGAAGGTACTTG
ATGGAAATTATGCTTTCATTCTTGAGTCAACTCTGAATGAATATTACTGT
CAAAGAAATTGCAATCTAATGCCGCTTGGGGGCCTATTGGACTCTCGTGG
TTATGCAATTGGATTACCATCAGGAAATAATGTCCTTCGAGATTTGTTAT
CTGAAAGTATTCTTCGCCTTCAAAAAGAACAAGTTTTGGAATCATTTCGC
AGACTTTGGCTTTTAAGATATAATTTAACAAAGTCTTGCTTTGAACATTC
CAATCACGCACCGACAATTCGAAACCAATTGGGTTTAGAGAAAATGGGAG
GAGCCTTTTTCGGATTGATAATTGGATTAACGGTTTCCTGTATTGTTTCC
TGCATAGAAATGACTATATGGGCTTCAAAGAGGTCAATGAAAAAGAAAAA
ACGCTCAGTCTATGATGTGATCGACAGTCAGATAAAAATGGCTTTTGGTC
AGTGTCATCGATTTAAACCGAACAGTCCTTCCACGAATTCCTCAAGTATT
CATGATTCTCCAGTTTTATGTAACACATTCAAAGCTGGTTCAGCCACCAT
TACCATTCCTTCCATGCGTCGATATCTCAAGTCTGCATCACACGAAGAAC
TCTATCAACCGCTTCCACTGGAACGCGCATTGCTTATGAAATGCGACTAT
AATAAACCTAATAAATATTCCTGTTTTTACGAACCTTATCAAGCAGCGAA
TGGTGTAATAGCCCAAGATGCTCACAAAGTTACATCTTTGTGATTTA
back to top

protein sequence of SMED30029127-orf-1

>SMED30029127-orf-1 ID=SMED30029127-orf-1|Name=SMED30029127-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=975bp
MNTNKLKFPHSQTTESSIPVLKKEIFVCLWLLMTTCFAKTGSISDKTVVN
LALTLELNQIKVYQEILGKQDQPQTLIGSMIIEGSLIQDFLKLKDLVSKA
TNVILLKAKLEMESQLKMDCYQDYLIRLLAEKLNTTLFMVGKLSSCSNDF
SFKNPAQFGDSRSMSHVIFLVSVTTEYYRLMLRDLVYSDQHVWNEALIIY
DQSQVFSTFRNVMETTEKVFHFRHWTSDRATNARIIKNFRHVRTFIVDMN
DKNVHSFFLLAAGLQLLNAMTTTVIIMDRDNLIESIRDFAFMAANITVIR
PTLYDSKLFKTISNKINYQKIDFPQKIVKVLLQHLYLVMNNQKGNKTLGK
RSGFISPFSWFDEFNVSLANDVKVFTDPNLNYCFDFNFESIYLGESHLER
ISYWSKKAGFKPILNRAETMRDRLLTQIHNKTFRVTTLEDPPFVMYREFD
EHGAPLKGNDRFIGMAMDLLRALSEMKRFNYVIHRVKDETYGSLNETTGK
WNGMIGELINNEADLAVASLTITYDRERVIDFTTPWMSLGLSIVIKKSIS
STKLLQFMAPLSTNVWLMMLGAYIVVSITLFLVGRMTPYEWYVKHPCFNK
VENQFSVLNSFWFTVGSLMQQGCDISPKATSTRMIGTIWWFFILIMISSY
TANLAAFLTIERLQNDITSVEELSMQIKMKYGTIYGGSTYSFFKNSNIST
YKKMWNFMKSDHSLFVDNTAKGIQKVLDGNYAFILESTLNEYYCQRNCNL
MPLGGLLDSRGYAIGLPSGNNVLRDLLSESILRLQKEQVLESFRRLWLLR
YNLTKSCFEHSNHAPTIRNQLGLEKMGGAFFGLIIGLTVSCIVSCIEMTI
WASKRSMKKKKRSVYDVIDSQIKMAFGQCHRFKPNSPSTNSSSIHDSPVL
CNTFKAGSATITIPSMRRYLKSASHEELYQPLPLERALLMKCDYNKPNKY
SCFYEPYQAANGVIAQDAHKVTSL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0015276ligand-gated ion channel activity
GO:0038023signaling receptor activity
GO:0004872receptor activity
GO:0005216ion channel activity
GO:0004970ionotropic glutamate receptor activity
GO:0005234extracellular-glutamate-gated ion channel activity
GO:0003700transcription factor activity, sequence-specific DNA binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001508Iono_rcpt_met
IPR001320Iontro_rcpt
IPR019594Glu/Gly-bd
IPR001831IV_Tat
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0006355regulation of transcription, DNA-templated
GO:0006810transport
GO:0034220ion transmembrane transport
GO:0035235ionotropic glutamate receptor signaling pathway
GO:0060079excitatory postsynaptic potential
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0042025host cell nucleus
GO:0005886plasma membrane
GO:0016021integral component of membrane
GO:0098794postsynapse
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001508Ionotropic glutamate receptor, metazoaPRINTSPR00177NMDARECEPTORcoord: 634..661
score: 50.36
coord: 826..850
score: 24.0
coord: 565..590
score: 30.38
IPR019594Ionotropic glutamate receptor, L-glutamate and glycine-binding domainSMARTSM00918Lig_chan_Glu_bd_2coord: 442..510
e-value: 5.4E-23
score: 92.4
IPR019594Ionotropic glutamate receptor, L-glutamate and glycine-binding domainPFAMPF10613Lig_chan-Glu_bdcoord: 431..547
e-value: 8.0E-39
score: 132.4
IPR001320Ionotropic glutamate receptorSMARTSM00079GluR_14coord: 432..800
e-value: 4.7E-81
score: 285.3
IPR001320Ionotropic glutamate receptorPFAMPF00060Lig_chancoord: 563..837
e-value: 7.9E-50
score: 168.6
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 459..819
e-value: 1.6E-125
score: 420.7
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 550..847
e-value: 1.6E-125
score: 420.7
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 540..762
e-value: 1.6E-125
score: 420.7
NoneNo IPR availablePANTHERPTHR18966:SF370coord: 182..858
NoneNo IPR availablePANTHERPTHR18966IONOTROPIC GLUTAMATE RECEPTORcoord: 182..858
NoneNo IPR availableSUPERFAMILYSSF53850Periplasmic binding protein-like IIcoord: 430..798
NoneNo IPR availableTMHMMTMhelixcoord: 830..852
NoneNo IPR availableTMHMMTMhelixcoord: 638..660
NoneNo IPR availableTMHMMTMhelixcoord: 562..584