SMED30029123

Overview
NameSMED30029123
Smed IDSMED30029123
Length (bp)641
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029123

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30029123 SmedASXL_042503SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neuronSMED30029123 dd_Smed_v4_13734_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30029123 dd_Smed_v4_13734_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30029123 vs. Ensembl Mouse
Match: Senp8 (SUMO/sentrin specific peptidase 8 [Source:MGI Symbol;Acc:MGI:1918849])

HSP 1 Score: 46.9802 bits (110), Expect = 3.790e-6
Identity = 45/179 (25.14%), Postives = 73/179 (40.78%), Query Frame = 3
Query:   99 SIRDPKIWFTDDDI----DYFLDSHIRNSDFAPIKCFIVDILR------TNPNE-DIFPIPETVFKAQIILCPLN------IDKSHWILFVYCKESLTSYYIDPIFQYRHKLSNKTHALQITMALNQLFNLKAAMTFHPHNDFLFQENTYDCGPY-ICAYAMMISREWQRFPEGFVEII 581
            S+ DP  W  D  I    +YF +S     D +   CFI   +       ++P E  +F  P  +   +++   +N         +HW L VY ++  + ++ D      H  SN  HA Q+   L      K             QEN+YDCG Y IC    +    ++R PE  ++++
Sbjct:   19 SLLDPPSWLNDHIIGFAFEYFANSQFH--DCSDHVCFISPEVTQFIKCTSSPAEIAMFLEPLDLPHKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYD-----SHSRSNSIHAKQVAEKLKAFLGSKGDKLVFVEEKAPAQENSYDCGMYVICNTEALCQSLFRRQPESPLQLL 190          
BLAST of SMED30029123 vs. Ensembl Mouse
Match: Senp8 (SUMO/sentrin specific peptidase 8 [Source:MGI Symbol;Acc:MGI:1918849])

HSP 1 Score: 46.9802 bits (110), Expect = 4.615e-6
Identity = 45/179 (25.14%), Postives = 73/179 (40.78%), Query Frame = 3
Query:   99 SIRDPKIWFTDDDI----DYFLDSHIRNSDFAPIKCFIVDILR------TNPNE-DIFPIPETVFKAQIILCPLN------IDKSHWILFVYCKESLTSYYIDPIFQYRHKLSNKTHALQITMALNQLFNLKAAMTFHPHNDFLFQENTYDCGPY-ICAYAMMISREWQRFPEGFVEII 581
            S+ DP  W  D  I    +YF +S     D +   CFI   +       ++P E  +F  P  +   +++   +N         +HW L VY ++  + ++ D      H  SN  HA Q+   L      K             QEN+YDCG Y IC    +    ++R PE  ++++
Sbjct:   19 SLLDPPSWLNDHIIGFAFEYFANSQFH--DCSDHVCFISPEVTQFIKCTSSPAEIAMFLEPLDLPHKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYD-----SHSRSNSIHAKQVAEKLKAFLGSKGDKLVFVEEKAPAQENSYDCGMYVICNTEALCQSLFRRQPESPLQLL 190          
BLAST of SMED30029123 vs. Ensembl Mouse
Match: Senp8 (SUMO/sentrin specific peptidase 8 [Source:MGI Symbol;Acc:MGI:1918849])

HSP 1 Score: 46.9802 bits (110), Expect = 4.615e-6
Identity = 45/179 (25.14%), Postives = 73/179 (40.78%), Query Frame = 3
Query:   99 SIRDPKIWFTDDDI----DYFLDSHIRNSDFAPIKCFIVDILR------TNPNE-DIFPIPETVFKAQIILCPLN------IDKSHWILFVYCKESLTSYYIDPIFQYRHKLSNKTHALQITMALNQLFNLKAAMTFHPHNDFLFQENTYDCGPY-ICAYAMMISREWQRFPEGFVEII 581
            S+ DP  W  D  I    +YF +S     D +   CFI   +       ++P E  +F  P  +   +++   +N         +HW L VY ++  + ++ D      H  SN  HA Q+   L      K             QEN+YDCG Y IC    +    ++R PE  ++++
Sbjct:   19 SLLDPPSWLNDHIIGFAFEYFANSQFH--DCSDHVCFISPEVTQFIKCTSSPAEIAMFLEPLDLPHKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYD-----SHSRSNSIHAKQVAEKLKAFLGSKGDKLVFVEEKAPAQENSYDCGMYVICNTEALCQSLFRRQPESPLQLL 190          
BLAST of SMED30029123 vs. Ensembl Mouse
Match: Senp8 (SUMO/sentrin specific peptidase 8 [Source:MGI Symbol;Acc:MGI:1918849])

HSP 1 Score: 46.9802 bits (110), Expect = 4.615e-6
Identity = 45/179 (25.14%), Postives = 73/179 (40.78%), Query Frame = 3
Query:   99 SIRDPKIWFTDDDI----DYFLDSHIRNSDFAPIKCFIVDILR------TNPNE-DIFPIPETVFKAQIILCPLN------IDKSHWILFVYCKESLTSYYIDPIFQYRHKLSNKTHALQITMALNQLFNLKAAMTFHPHNDFLFQENTYDCGPY-ICAYAMMISREWQRFPEGFVEII 581
            S+ DP  W  D  I    +YF +S     D +   CFI   +       ++P E  +F  P  +   +++   +N         +HW L VY ++  + ++ D      H  SN  HA Q+   L      K             QEN+YDCG Y IC    +    ++R PE  ++++
Sbjct:   19 SLLDPPSWLNDHIIGFAFEYFANSQFH--DCSDHVCFISPEVTQFIKCTSSPAEIAMFLEPLDLPHKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYD-----SHSRSNSIHAKQVAEKLKAFLGSKGDKLVFVEEKAPAQENSYDCGMYVICNTEALCQSLFRRQPESPLQLL 190          
BLAST of SMED30029123 vs. Ensembl Mouse
Match: Senp8 (SUMO/sentrin specific peptidase 8 [Source:MGI Symbol;Acc:MGI:1918849])

HSP 1 Score: 46.9802 bits (110), Expect = 4.615e-6
Identity = 45/179 (25.14%), Postives = 73/179 (40.78%), Query Frame = 3
Query:   99 SIRDPKIWFTDDDI----DYFLDSHIRNSDFAPIKCFIVDILR------TNPNE-DIFPIPETVFKAQIILCPLN------IDKSHWILFVYCKESLTSYYIDPIFQYRHKLSNKTHALQITMALNQLFNLKAAMTFHPHNDFLFQENTYDCGPY-ICAYAMMISREWQRFPEGFVEII 581
            S+ DP  W  D  I    +YF +S     D +   CFI   +       ++P E  +F  P  +   +++   +N         +HW L VY ++  + ++ D      H  SN  HA Q+   L      K             QEN+YDCG Y IC    +    ++R PE  ++++
Sbjct:   19 SLLDPPSWLNDHIIGFAFEYFANSQFH--DCSDHVCFISPEVTQFIKCTSSPAEIAMFLEPLDLPHKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYD-----SHSRSNSIHAKQVAEKLKAFLGSKGDKLVFVEEKAPAQENSYDCGMYVICNTEALCQSLFRRQPESPLQLL 190          
BLAST of SMED30029123 vs. TrEMBL
Match: G3AHZ2 (ULP_PROTEASE domain-containing protein OS=Spathaspora passalidarum (strain NRRL Y-27907 / 11-Y1) OX=619300 GN=SPAPADRAFT_148983 PE=4 SV=1)

HSP 1 Score: 58.151 bits (139), Expect = 3.119e-6
Identity = 55/192 (28.65%), Postives = 88/192 (45.83%), Query Frame = 3
Query:   66 INITCNDEKLFSIRDPKIWFTDDDIDYFLDSHIRN--SDFAPIKCFIVD--------ILRTNPNEDIFPIPETVFKAQIILCPLNIDKSHWILFVYCKESLTSYYIDPI----FQYRHKLSNKTHALQITMALNQLFNLKAAMTFHPHNDFLFQE-NTYDCGPYICAYAMMI-SREWQRFPEGFVEIIRKEV 593
            I IT  D  L +++D + W  D+ IDY+L+  +++    FA    F  +        + R    + + P     F+  +IL P+NI  +HW L V      T  Y D +          ++N  H +   M  N++ +     T HPH+    Q+ N YDCG + C  A  I SRE  RF +  ++IIR+ +
Sbjct:  318 IEITTKD--LQTLQDGR-WLNDNIIDYYLNLIMKDYPKVFAWTTHFYSNLETKGYKGVERWGKRKKLNP-----FEKDMILVPVNISSTHWALTVIDNVKATITYYDSLDSQSIGNTAAVTNLNHYM--NMEANRVGHAPVEYTLHPHHKQTPQQKNGYDCGVFTCTAAKFIASREGLRFGQRDMKIIRRRM 499          
BLAST of SMED30029123 vs. Planmine SMEST
Match: SMESG000021486.1 (SMESG000021486.1)

HSP 1 Score: 307.375 bits (786), Expect = 2.179e-96
Identity = 145/197 (73.60%), Postives = 165/197 (83.76%), Query Frame = 3
Query:   54 ADSTINITCNDEKLF-SIRDPKIWFTDDDIDYFLDSHIRNSDFAPIKCFIVDILRTNPNEDIFPIPETVFKAQIILCPLNIDKSHWILFVYCKESLTSYYIDPIFQYRHKLSNKTHALQITMALNQLFNLKAAMTFHPHNDFLFQENTYDCGPYICAYAMMISREWQRFPEGFVEIIRKEVHQFNLFSQLKHPKISG 641
            ADSTI I   ++ L  S RDP IWFTDDDID +L +HI + +FA I CFIV+ILRTNP ED+FPIPE VFKAQIILCPLNIDK+HWILFVYCK SLTSY+IDPI QYRH+  NKT+ALQ+TMALNQLFNLKAAMTFHPH +FL+QEN+YDCGPYICAYAMMIS  WQ FP+ F++IIRKEVHQ  LF Q K  K+SG
Sbjct: 2332 ADSTIKIIEINKPLNESDRDPTIWFTDDDIDLYLKNHISSLEFASINCFIVEILRTNPGEDLFPIPEKVFKAQIILCPLNIDKTHWILFVYCKNSLTSYFIDPILQYRHRFVNKTYALQVTMALNQLFNLKAAMTFHPHENFLYQENSYDCGPYICAYAMMISGVWQSFPDHFIDIIRKEVHQLQLFCQQKDQKVSG 2528          

HSP 2 Score: 304.679 bits (779), Expect = 2.242e-95
Identity = 137/179 (76.54%), Postives = 155/179 (86.59%), Query Frame = 3
Query:  105 RDPKIWFTDDDIDYFLDSHIRNSDFAPIKCFIVDILRTNPNEDIFPIPETVFKAQIILCPLNIDKSHWILFVYCKESLTSYYIDPIFQYRHKLSNKTHALQITMALNQLFNLKAAMTFHPHNDFLFQENTYDCGPYICAYAMMISREWQRFPEGFVEIIRKEVHQFNLFSQLKHPKISG 641
            RDP IWFTDDDID +L +HI + +FA I CFIV+ILRTNP ED+FPIPE VFKAQIILCPLNIDK+HWILFVYCK SLTSY+IDPI QYRH+  NKT+ALQ+TMALNQLFNLKAAMTFHPH +FL+QEN+YDCGPYICAYAMMIS  WQ FP+ F++IIRKEVHQ  LF Q K  K+SG
Sbjct: 4663 RDPTIWFTDDDIDLYLKNHISSLEFASINCFIVEILRTNPGEDLFPIPEKVFKAQIILCPLNIDKTHWILFVYCKNSLTSYFIDPILQYRHRFVNKTYALQVTMALNQLFNLKAAMTFHPHENFLYQENSYDCGPYICAYAMMISGVWQSFPDHFIDIIRKEVHQLQLFCQQKDQKVSG 4841          

HSP 3 Score: 204.527 bits (519), Expect = 1.831e-60
Identity = 88/174 (50.57%), Postives = 131/174 (75.29%), Query Frame = 3
Query:   78 CNDEKLFSIRDPKIWFTDDDIDYFLDSHIRNSDFAPIKCFIVDILRTNPNEDIFPIPETVFKAQIILCPLNIDKSHWILFVYCKESLTSYYIDPIFQYRHKLSNKTHALQITMALNQLFNLKAAMTFHPHNDFLFQENTYDCGPYICAYAMMISREWQRFPEGFVEIIRKEVHQ 599
            CN       RDP+IWF+D+DID++L++HI N     IKCFIV+IL +N  E++  IP ++  A+++ CPLNI+ SHWILFVYCK+S +SY+IDPI + R+ L NK  AL+I +ALN+ FNLK A++++PH +  +Q N +DCGP+ CAYA++IS++   FP+GF++ IR++VH+
Sbjct:  184 CNKYLTIDNRDPEIWFSDNDIDWYLETHIDNPMHGYIKCFIVNILCSNIQEEVVAIPRSISNAEMVFCPLNINNSHWILFVYCKKSHSSYFIDPILKNRNNLINKQMALKINIALNRFFNLKIAVSYNPHKNLQYQNNNFDCGPFTCAYAVIISKDLDNFPDGFIDEIRRDVHR 357          
BLAST of SMED30029123 vs. Planmine SMEST
Match: SMESG000021486.1 (SMESG000021486.1)

HSP 1 Score: 307.375 bits (786), Expect = 2.424e-96
Identity = 145/197 (73.60%), Postives = 165/197 (83.76%), Query Frame = 3
Query:   54 ADSTINITCNDEKLF-SIRDPKIWFTDDDIDYFLDSHIRNSDFAPIKCFIVDILRTNPNEDIFPIPETVFKAQIILCPLNIDKSHWILFVYCKESLTSYYIDPIFQYRHKLSNKTHALQITMALNQLFNLKAAMTFHPHNDFLFQENTYDCGPYICAYAMMISREWQRFPEGFVEIIRKEVHQFNLFSQLKHPKISG 641
            ADSTI I   ++ L  S RDP IWFTDDDID +L +HI + +FA I CFIV+ILRTNP ED+FPIPE VFKAQIILCPLNIDK+HWILFVYCK SLTSY+IDPI QYRH+  NKT+ALQ+TMALNQLFNLKAAMTFHPH +FL+QEN+YDCGPYICAYAMMIS  WQ FP+ F++IIRKEVHQ  LF Q K  K+SG
Sbjct: 2361 ADSTIKIIEINKPLNESDRDPTIWFTDDDIDLYLKNHISSLEFASINCFIVEILRTNPGEDLFPIPEKVFKAQIILCPLNIDKTHWILFVYCKNSLTSYFIDPILQYRHRFVNKTYALQVTMALNQLFNLKAAMTFHPHENFLYQENSYDCGPYICAYAMMISGVWQSFPDHFIDIIRKEVHQLQLFCQQKDQKVSG 2557          

HSP 2 Score: 307.375 bits (786), Expect = 2.424e-96
Identity = 145/197 (73.60%), Postives = 165/197 (83.76%), Query Frame = 3
Query:   54 ADSTINITCNDEKLF-SIRDPKIWFTDDDIDYFLDSHIRNSDFAPIKCFIVDILRTNPNEDIFPIPETVFKAQIILCPLNIDKSHWILFVYCKESLTSYYIDPIFQYRHKLSNKTHALQITMALNQLFNLKAAMTFHPHNDFLFQENTYDCGPYICAYAMMISREWQRFPEGFVEIIRKEVHQFNLFSQLKHPKISG 641
            ADSTI I   ++ L  S RDP IWFTDDDID +L +HI + +FA I CFIV+ILRTNP ED+FPIPE VFKAQIILCPLNIDK+HWILFVYCK SLTSY+IDPI QYRH+  NKT+ALQ+TMALNQLFNLKAAMTFHPH +FL+QEN+YDCGPYICAYAMMIS  WQ FP+ F++IIRKEVHQ  LF Q K  K+SG
Sbjct: 4703 ADSTIKIIEINKPLNESDRDPTIWFTDDDIDLYLKNHISSLEFASINCFIVEILRTNPGEDLFPIPEKVFKAQIILCPLNIDKTHWILFVYCKNSLTSYFIDPILQYRHRFVNKTYALQVTMALNQLFNLKAAMTFHPHENFLYQENSYDCGPYICAYAMMISGVWQSFPDHFIDIIRKEVHQLQLFCQQKDQKVSG 4899          

HSP 3 Score: 204.527 bits (519), Expect = 1.997e-60
Identity = 88/174 (50.57%), Postives = 131/174 (75.29%), Query Frame = 3
Query:   78 CNDEKLFSIRDPKIWFTDDDIDYFLDSHIRNSDFAPIKCFIVDILRTNPNEDIFPIPETVFKAQIILCPLNIDKSHWILFVYCKESLTSYYIDPIFQYRHKLSNKTHALQITMALNQLFNLKAAMTFHPHNDFLFQENTYDCGPYICAYAMMISREWQRFPEGFVEIIRKEVHQ 599
            CN       RDP+IWF+D+DID++L++HI N     IKCFIV+IL +N  E++  IP ++  A+++ CPLNI+ SHWILFVYCK+S +SY+IDPI + R+ L NK  AL+I +ALN+ FNLK A++++PH +  +Q N +DCGP+ CAYA++IS++   FP+GF++ IR++VH+
Sbjct:  184 CNKYLTIDNRDPEIWFSDNDIDWYLETHIDNPMHGYIKCFIVNILCSNIQEEVVAIPRSISNAEMVFCPLNINNSHWILFVYCKKSHSSYFIDPILKNRNNLINKQMALKINIALNRFFNLKIAVSYNPHKNLQYQNNNFDCGPFTCAYAVIISKDLDNFPDGFIDEIRRDVHR 357          
BLAST of SMED30029123 vs. Planmine SMEST
Match: SMESG000013454.1 (SMESG000013454.1)

HSP 1 Score: 266.544 bits (680), Expect = 4.979e-83
Identity = 133/212 (62.74%), Postives = 164/212 (77.36%), Query Frame = 3
Query:    6 VPAXXXXXXXXXXXXXADSTINITCNDEKLFSIRDPKIWFTDDDIDYFLDSHIRNSDFAPIKCFIVDILRTNPNEDIFPIPETVFKAQIILCPLNIDKSHWILFVYCKESLTSYYIDPIFQYRHKLSNKTHALQITMALNQLFNLKAAMTFHPHNDFLFQENTYDCGPYICAYAMMISREWQRFPEGFVEIIRKEVHQFNLFSQLKHPKISG 641
            VPASVS S    EET ADSTI         F  RDPKIWFTDDDIDY+L+SHI N +FAP+KCFIV+IL +N  ++IFP+P+ +FKAQIILCPLNI++SHWI+FVYCK +  SY++DPI + RH L NK+ AL+ITMALN LF+LKAA+TFHPH++ + Q+N YDCGPYICAYAM+IS+EWQ FP  F+E IRK VH+F        PK+SG
Sbjct:  431 VPASVSISVPISEETDADSTI-----INYFFPERDPKIWFTDDDIDYYLESHIGNPNFAPVKCFIVEILSSNCKDEIFPMPDNLFKAQIILCPLNINESHWIVFVYCKLTKISYFVDPILRKRHNLINKSSALKITMALNNLFDLKAAVTFHPHDNLVCQDNNYDCGPYICAYAMLISQEWQTFPNNFIETIRKNVHRFQTSKFQNPPKVSG 637          
BLAST of SMED30029123 vs. Planmine SMEST
Match: SMESG000078596.1 (SMESG000078596.1)

HSP 1 Score: 266.159 bits (679), Expect = 2.313e-82
Identity = 124/196 (63.27%), Postives = 156/196 (79.59%), Query Frame = 3
Query:   54 ADSTINITCNDEKLFSIRDPKIWFTDDDIDYFLDSHIRNSDFAPIKCFIVDILRTNPNEDIFPIPETVFKAQIILCPLNIDKSHWILFVYCKESLTSYYIDPIFQYRHKLSNKTHALQITMALNQLFNLKAAMTFHPHNDFLFQENTYDCGPYICAYAMMISREWQRFPEGFVEIIRKEVHQFNLFSQLKHPKISG 641
            ADSTIN        F  RDPKIWFTDDDIDY+L+SHI N +FAP+KCFIV+IL +N  ++IFP+P+ +FKAQIILCPLNI++SHWILFVYCK +  SY++DPIF+  H L NK+ AL+ITMALN LF+LKAA+TFHPH++ ++Q+N YDCGP+ICAYAM+IS+EWQ FP  F+E IRK VH+F        PK+SG
Sbjct:   80 ADSTINYY-----FFPERDPKIWFTDDDIDYYLESHIGNPNFAPVKCFIVEILSSNCKDEIFPMPDNLFKAQIILCPLNINESHWILFVYCKLTKISYFVDPIFRKWHNLINKSSALKITMALNNLFDLKAAVTFHPHDNLVYQDNNYDCGPHICAYAMLISQEWQTFPNNFIETIRKNVHRFQTSKFQNPPKVSG 270          
BLAST of SMED30029123 vs. Planmine SMEST
Match: SMESG000044750.1 (SMESG000044750.1)

HSP 1 Score: 264.618 bits (675), Expect = 2.103e-81
Identity = 123/196 (62.76%), Postives = 154/196 (78.57%), Query Frame = 3
Query:   54 ADSTINITCNDEKLFSIRDPKIWFTDDDIDYFLDSHIRNSDFAPIKCFIVDILRTNPNEDIFPIPETVFKAQIILCPLNIDKSHWILFVYCKESLTSYYIDPIFQYRHKLSNKTHALQITMALNQLFNLKAAMTFHPHNDFLFQENTYDCGPYICAYAMMISREWQRFPEGFVEIIRKEVHQFNLFSQLKHPKISG 641
            ADSTI         F  RD KIWFTDDDIDY+L+SHI N +FAP+KCFIV+IL +N  ++IFP+P+ +FKAQIILCPLNI++SHWILFVYCK +  SY++DPI + RH L NK+ AL+ITMALN LF+LKAA+TFHPH++ ++Q+N YDCGPYICAYAM+IS+EWQ FP  F+E IRK VH+F        PK+SG
Sbjct:  573 ADSTI-----INYFFPERDSKIWFTDDDIDYYLESHIGNPNFAPVKCFIVEILSSNCKDEIFPMPDNLFKAQIILCPLNINESHWILFVYCKLTKISYFVDPILRKRHNLINKSSALKITMALNNLFDLKAAVTFHPHDNLVYQDNNYDCGPYICAYAMLISQEWQTFPNNFIETIRKNVHRFQTTKFQNPPKVSG 763          
The following BLAST results are available for this feature:
BLAST of SMED30029123 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029123 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029123 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029123 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029123 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029123 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Senp83.790e-625.14SUMO/sentrin specific peptidase 8 [Source:MGI Symb... [more]
Senp84.615e-625.14SUMO/sentrin specific peptidase 8 [Source:MGI Symb... [more]
Senp84.615e-625.14SUMO/sentrin specific peptidase 8 [Source:MGI Symb... [more]
Senp84.615e-625.14SUMO/sentrin specific peptidase 8 [Source:MGI Symb... [more]
Senp84.615e-625.14SUMO/sentrin specific peptidase 8 [Source:MGI Symb... [more]
back to top
BLAST of SMED30029123 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029123 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 1
Match NameE-valueIdentityDescription
G3AHZ23.119e-628.65ULP_PROTEASE domain-containing protein OS=Spathasp... [more]
back to top
BLAST of SMED30029123 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029123 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029123 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029123 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029123 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30029123 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000021486.12.179e-9673.60SMESG000021486.1[more]
SMESG000021486.12.424e-9673.60SMESG000021486.1[more]
SMESG000013454.14.979e-8362.74SMESG000013454.1[more]
SMESG000078596.12.313e-8263.27SMESG000078596.1[more]
SMESG000044750.12.103e-8162.76SMESG000044750.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029123 ID=SMED30029123|Name=SMED30029123|organism=Schmidtea mediterranea sexual|type=transcript|length=641bp
GGTGCGTGCCTGCATCAGTCTCAACATCTACCTCAACCATGGAGGAGACT
GTTGCAGACAGCACAATAAATATAACTTGTAATGATGAAAAACTGTTTTC
CATACGCGATCCAAAGATCTGGTTTACTGATGATGATATTGACTATTTCC
TTGACAGTCACATCAGAAATTCAGACTTTGCGCCCATTAAATGCTTCATT
GTTGACATTTTGCGCACTAATCCTAACGAAGACATTTTTCCTATTCCGGA
AACTGTCTTTAAGGCACAAATCATATTGTGCCCTCTTAACATTGATAAAT
CCCACTGGATCTTGTTTGTCTACTGTAAGGAATCTCTAACTTCTTACTAT
ATTGATCCAATCTTCCAATACCGCCACAAACTTTCCAATAAGACACACGC
TCTTCAAATCACAATGGCACTAAACCAGCTCTTCAATCTCAAAGCCGCCA
TGACTTTTCACCCACACAATGACTTCTTGTTCCAAGAAAACACCTATGAC
TGTGGGCCATACATCTGTGCGTATGCTATGATGATAAGTCGAGAATGGCA
AAGGTTTCCGGAAGGCTTTGTCGAGATAATCAGGAAAGAGGTCCACCAAT
TCAACCTTTTCTCACAACTAAAACATCCTAAAATATCAGGA
back to top

protein sequence of SMED30029123-orf-1

>SMED30029123-orf-1 ID=SMED30029123-orf-1|Name=SMED30029123-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=213bp
CVPASVSTSTSTMEETVADSTINITCNDEKLFSIRDPKIWFTDDDIDYFL
DSHIRNSDFAPIKCFIVDILRTNPNEDIFPIPETVFKAQIILCPLNIDKS
HWILFVYCKESLTSYYIDPIFQYRHKLSNKTHALQITMALNQLFNLKAAM
TFHPHNDFLFQENTYDCGPYICAYAMMISREWQRFPEGFVEIIRKEVHQF
NLFSQLKHPKISG
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR003653Peptidase_C48_C
Vocabulary: molecular function
TermDefinition
GO:0008234cysteine-type peptidase activity
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis