Pol polyprotein

Overview
NamePol polyprotein
Smed IDSMED30029112
Length (bp)3885
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Pol polyprotein (SMED30029112) t-SNE clustered cells

Violin plots show distribution of expression levels for Pol polyprotein (SMED30029112) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Pol polyprotein (SMED30029112) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Pol polyprotein (SMED30029112) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029112

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30029112SMESG000074961.1 SmedASXL_008691SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30029112SMESG000074961.1 dd_Smed_v4_15720_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029112SMESG000074961.1 dd_Smed_v4_15720_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30029112SMESG000074961.1 dd_Smed_v4_15720_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30029112SMESG000074961.1 dd_Smed_v4_15720_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Pol polyprotein vs. Ensembl Zebrafish
Match: BX511082.1 (pep chromosome:GRCz11:9:14291932:14297132:1 gene:ENSDARG00000113678.1 transcript:ENSDART00000183119.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX511082.1)

HSP 1 Score: 151.754 bits (382), Expect = 2.122e-36
Identity = 94/299 (31.44%), Postives = 154/299 (51.51%), Query Frame = 1
Query: 2641 EDNHTKLINTIPKEIKEILEIYP-TVTNKLSVEKTIKCTTEHAIITNGNPFHAKVRQLDNSKLNITKQIFNDLLENKIMQHSNSKWSSALMFKEKPNNEWRACGDYRILNNITIPDKYPILIKNDVINSIYNPIFFSKVDL*KAYHQTPVREEDIKKTEIITPIGLFEYNRMPFALKNAAVTFQRFTDRILRN--NKNTIVYLNDILIASSSRPEHLQNIRDELETLNKHN*KINFKKCEFLKHEFKFLRHLLNENGTRPLENKFKAIKEFPXXXXXXXXXXFLGMINLYHKHIPKYSE 3528
            ++ H  L N +PKE  ++  ++  +    L   +   C  E  ++   +P   K+  L   +    ++  +D L  KI++ S+S   +   F +K +   R C DYR LN IT+ + YP+ + +     +    FF+K+DL  AYH   +RE D  KT   TP G FEY  +PF L NA   FQ   + +LR+  ++   VYL+DILI S S  EH+Q++R  L+ L ++   +  +KC F      FL H+++  G R    K +A+ ++P   + + L+RFLG  N Y + I  +S+
Sbjct:  478 QEEHMDLSN-VPKEYLDLKRVFSKSRAASLPPHRPYDCAIE--LLPGTSPPKGKLYSLSVPEREAMEKYISDSLAAKIIRPSSSPAGAGFFFVKKKDGSLRPCIDYRGLNAITVKNTYPLPLMSSAFERLQGASFFTKLDLRNAYHLVRIREGDEWKTAFNTPRGHFEYCVLPFGLSNAPAVFQALVNDVLRDMLDQFIYVYLDDILIFSHSLQEHVQHVRRVLQRLLENGLYVKAEKCVFHAQSVPFLGHIVSVEGMRMDPEKVQAVVDWPTPDSRKALQRFLGFANFYRRFIRNFSQ 773          
BLAST of Pol polyprotein vs. Ensembl Zebrafish
Match: CR855320.1 (pep chromosome:GRCz11:1:7956030:7961696:1 gene:ENSDARG00000099359.2 transcript:ENSDART00000159655.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR855320.1)

HSP 1 Score: 149.443 bits (376), Expect = 8.958e-36
Identity = 91/292 (31.16%), Postives = 150/292 (51.37%), Query Frame = 1
Query: 2662 INTIPKEIKEILEIYP-TVTNKLSVEKTIKCTTEHAIITNGNPFHAKVRQLDNSKLNITKQIFNDLLENKIMQHSNSKWSSALMFKEKPNNEWRACGDYRILNNITIPDKYPILIKNDVINSIYNPIFFSKVDL*KAYHQTPVREEDIKKTEIITPIGLFEYNRMPFALKNAAVTFQRFTDRILRN--NKNTIVYLNDILIASSSRPEHLQNIRDELETLNKHN*KINFKKCEFLKHEFKFLRHLLNENGTRPLENKFKAIKEFPXXXXXXXXXXFLGMINLYHKHIPKYSE 3528
            ++ +P+E  ++  ++  +    L   +   C  +  ++   +P   K+  L   +     +  +D L  KI++ S+S   +   F +K +   R C DYR LNNIT+ + YP+ + +     +    FF+K+DL  AYH   +R  D  K+   TP G FEY  +PF L NA   FQ F + +LR+  ++   VYL+DILI S S  EH+Q+IR  L+ L ++   +  +KC F      FL H+++  G R    K KA+  +P   + + L+RFLG  N Y + I  +S+
Sbjct:  486 LSNVPREYHDLKRVFSKSRAASLPPHRPYDCAID--LLPGTSPPKGKLYSLSAPEREAMGKYISDSLAAKIIRPSSSPAGAGFFFVKKKDGSLRPCIDYRGLNNITVKNTYPLPLMSSAFERLQGANFFTKLDLRNAYHLVRIRAGDEWKSAFNTPRGHFEYCVLPFGLSNAPAVFQAFVNDVLRDMIDQFIYVYLDDILIFSHSLQEHVQHIRRVLQRLLENGLYVKAEKCVFHAQSVPFLGHIVSVEGLRMDPEKIKAVVNWPTPDSRKALQRFLGFANFYRRFIRNFSQ 775          
BLAST of Pol polyprotein vs. Ensembl Zebrafish
Match: BX546500.1 (pep chromosome:GRCz11:23:12926092:12931693:-1 gene:ENSDARG00000086495.3 transcript:ENSDART00000122176.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX546500.1)

HSP 1 Score: 146.747 bits (369), Expect = 6.882e-35
Identity = 88/292 (30.14%), Postives = 152/292 (52.05%), Query Frame = 1
Query: 2662 INTIPKEIKEILEIYP-TVTNKLSVEKTIKCTTEHAIITNGNPFHAKVRQLDNSKLNITKQIFNDLLENKIMQHSNSKWSSALMFKEKPNNEWRACGDYRILNNITIPDKYPILIKNDVINSIYNPIFFSKVDL*KAYHQTPVREEDIKKTEIITPIGLFEYNRMPFALKNAAVTFQRFTDRILRN--NKNTIVYLNDILIASSSRPEHLQNIRDELETLNKHN*KINFKKCEFLKHEFKFLRHLLNENGTRPLENKFKAIKEFPXXXXXXXXXXFLGMINLYHKHIPKYSE 3528
            ++ +P+E  ++  ++  +    L   +   C  +  ++   +P   K+  L   +    ++  +D L  KI++ S+S   +   F +K +   R C DYR LN+IT+ + YP+ + +     +    FF+K+DL  AYH   +R  D  KT   TP G FEY  +PF L NA   FQ   + +LR+  ++   VYL+DILI S S  EH+Q++R  L+ L ++   +  +KC F     +FL H+++  G R    K +A+ ++P   + + L+RFLG  N Y + I  +S+
Sbjct:  458 LSNVPREYHDLKRVFSKSRAASLPPHRPYDCAID--LLPGTSPPKGKLYSLSVPEREAMEKYISDSLAAKIIRPSSSPAGAGFFFVKKKDGSLRPCIDYRGLNSITVKNTYPLPLMSSAFERLQGANFFTKLDLRNAYHLVRIRPGDEWKTAFNTPRGHFEYCVLPFGLSNAPAVFQALVNDVLRDMIDQFIYVYLDDILIFSHSLQEHVQHVRRVLQRLLENGLYVKAEKCVFHAQSVQFLGHIVSVEGMRMDPEKIQAVVDWPTPDSRKALQRFLGFANFYRRFIRNFSQ 747          
BLAST of Pol polyprotein vs. Ensembl Zebrafish
Match: BX511224.1 (pep chromosome:GRCz11:2:18017000:18022765:1 gene:ENSDARG00000113243.1 transcript:ENSDART00000186877.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX511224.1)

HSP 1 Score: 145.976 bits (367), Expect = 1.074e-34
Identity = 88/292 (30.14%), Postives = 151/292 (51.71%), Query Frame = 1
Query: 2662 INTIPKEIKEILEIYP-TVTNKLSVEKTIKCTTEHAIITNGNPFHAKVRQLDNSKLNITKQIFNDLLENKIMQHSNSKWSSALMFKEKPNNEWRACGDYRILNNITIPDKYPILIKNDVINSIYNPIFFSKVDL*KAYHQTPVREEDIKKTEIITPIGLFEYNRMPFALKNAAVTFQRFTDRILRN--NKNTIVYLNDILIASSSRPEHLQNIRDELETLNKHN*KINFKKCEFLKHEFKFLRHLLNENGTRPLENKFKAIKEFPXXXXXXXXXXFLGMINLYHKHIPKYSE 3528
            ++ +P+E  ++  ++  +    L   +   C  +  ++   +P   K+  L   +    ++  +D L  KI++ S+S   +   F +K +   R C DYR LN+IT+ + YP+ + +     +    FF+K+DL  AYH   +R  D  KT   TP G FEY  +PF L NA   FQ   + +LR+  ++   VYL+DILI S S  EH+Q++R  L+ L ++   +  +KC F     +FL H+++  G R    K +A+  +P   + + L+RFLG  N Y + I  +S+
Sbjct:  484 LSNVPREYHDLKRVFSKSRAASLPPHRPYDCAID--LLPGTSPPKGKLYSLSVPEREAMEKYISDSLAAKIIRPSSSPAGAGFFFVKKKDGSLRPCIDYRGLNSITVKNTYPLPLMSSAFERLQGANFFTKLDLRNAYHLVCIRPGDEWKTAFNTPRGHFEYCVLPFGLSNAPAVFQALVNDVLRDMIDQFIYVYLDDILIFSHSLQEHIQHVRRVLQRLLENGLYVKAEKCVFHAQSVQFLGHIVSVEGMRMDPEKIQAVVNWPTPDSRKALQRFLGFANFYRRFIHNFSQ 773          
BLAST of Pol polyprotein vs. Ensembl Zebrafish
Match: CR925755.2 (pep chromosome:GRCz11:17:42486740:42492668:-1 gene:ENSDARG00000116402.1 transcript:ENSDART00000183946.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR925755.2)

HSP 1 Score: 142.895 bits (359), Expect = 1.034e-33
Identity = 87/287 (30.31%), Postives = 147/287 (51.22%), Query Frame = 1
Query: 2662 INTIPKEIKEILEIYP-TVTNKLSVEKTIKCTTEHAIITNGNPFHAKVRQLDNSKLNITKQIFNDLLENKIMQHSNSKWSSALMFKEKPNNEWRACGDYRILNNITIPDKYPILIKNDVINSIYNPIFFSKVDL*KAYHQTPVREEDIKKTEIITPIGLFEYNRMPFALKNAAVTFQRFTDRILRN--NKNTIVYLNDILIASSSRPEHLQNIRDELETLNKHN*KINFKKCEFLKHEFKFLRHLLNENGTRPLENKFKAIKEFPXXXXXXXXXXFLGMINLYHKHI 3513
            ++ +P+E  ++  ++  +    L   +   C  +  ++   +P   K+  L   +    ++  +D L  KI++ S+S   +   F +K +   R C DYR LN+IT+ + YP+ + +     +    FF+K+DL  AYH   +R  D  KT   TP G FEY  +PF L NA   FQ   + +LR+  ++   VYL+DILI S S  EH+Q++R  L+ L ++   +  +KC F     +FL H ++  G R    K +A+  +P   + + L+RFLG  N Y + I
Sbjct:  457 LSNVPREYHDLKRVFSKSRAASLPPHRPYDCAID--LLPGTSPPKGKLYSLSVPEREAMEKYISDSLAAKIIRPSSSPAGAGFFFVKKKDGSLRPCIDYRGLNSITVKNTYPLPLMSSAFERLQGANFFTKLDLRNAYHLVRIRPGDEWKTAFNTPRGHFEYCVLPFGLSNAPAVFQALVNDVLRDMIDQFIYVYLDDILIFSHSLQEHVQHVRRVLQRLLENGLYVKAEKCVFHAQSVQFLGHTVSVEGMRMDPEKIQAVVNWPTPDSRKALQRFLGFANFYRRFI 741          
BLAST of Pol polyprotein vs. Ensembl Xenopus
Match: alkbh5 (alkB homolog 5, RNA demethylase [Source:Xenbase;Acc:XB-GENE-987580])

HSP 1 Score: 142.51 bits (358), Expect = 8.000e-35
Identity = 82/293 (27.99%), Postives = 154/293 (52.56%), Query Frame = 1
Query: 2659 LINTIPKEIKEILEIYPTVTNK--LSVEKTIKCTTEHAIITN-GNPFHAKVRQLDNSKLNITKQIFNDLLENKIMQHSNSKWSSALMFKEKPNNEWRACGDYRILNNITIPDKYPILIKNDVINSIYNPIFFSKVDL*KAYHQTPVREEDIKKTEIITPIGLFEYNRMPFALKNAAVTFQRFTDRILRNNKN-TIVYLNDILIASSSRPEHLQNIRDELETLNKHN*KINFKKCEFLKHEFKFLRHLLNENGTRPLENKFKAIKEFPXXXXXXXXXXFLGMINLYHKHIPKYS 3525
            L N+  +E++E L     + N+   S +  +    +H IIT  G   + +  ++  ++          +LE  +++ S+S+WSS ++   KP+   R C D+R LN ++  D YP+   +++I  +    + + +DL K Y Q P+ E   +KT   TP G ++Y R+PF L  A  TFQR  DRIL+ ++     YL+D++I S     HL  ++  L+++ K     N KKC     E ++L +++     +P  +K + I+++P   + +++R FLG++  Y + +P ++
Sbjct:  195 LTNSQKQEMREFL-----IRNRQIFSDQPGLTEMIKHDIITGPGVKVNVRPYRIPEARRQAVAGEIKRMLELDVIEESHSEWSSPIVLVPKPDGSIRFCNDFRKLNEVSKFDAYPMPRVDELIERLGQARYITTLDLTKGYWQVPLTEGAKEKTAFSTPEGQWQYKRLPFGLHGAPATFQRMMDRILKPHRGYASAYLDDVVIFSPDWESHLPRVQAVLDSIWKAGLTANPKKCAMGLEEARYLGYVIGRGVVKPQVSKIEGIQQWPRPNSKKQVRAFLGIVGYYRRFVPNFA 482          
BLAST of Pol polyprotein vs. Ensembl Xenopus
Match: ENSXETT00000006041.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:6:37317867:37322724:1 gene:ENSXETG00000003070.1 transcript:ENSXETT00000006041.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 145.591 bits (366), Expect = 1.993e-34
Identity = 81/262 (30.92%), Postives = 137/262 (52.29%), Query Frame = 1
Query: 2752 TTEHAI-ITNGNPFHAKVRQLDNSKLNITKQIFNDLLENKIMQHSNSKWSSALMFKEKPNNEWRACGDYRILNNITIPDKYPILIKNDVINSIYNPIFFSKVDL*KAYHQTPVREEDIKKTEIITPIGLFEYNRMPFALKNAAVTFQRFTDRILRNNK--NTIVYLNDILIASSSRPEHLQNIRDELETLNKHN*KINFKKCEFLKHEFKFLRHLLNENGTRPLENKFKAIKEFPXXXXXXXXXXFLGMINLYHKHIPKYSE 3528
            +T+H I +    PF  + R++    L   ++   +L    I++ S S ++S ++   K N   R C DYR LN  TIPD+Y      D +N +    +FS +DL   Y+Q P+  ED +KT  I P+G FE+NRMP  L  A  TFQR  +R + +      +VYL+D+++   +  EH Q +    + L K   K++ +KC+F +    ++ H+++  G     +K +A+  +P  +T  +LR FLG    Y + +  +S+
Sbjct:  314 STKHKIRLREDKPFRERSRRIAPGDLEDLRKHLEELKAAGIIKESRSPYASPIVVVRKKNGSIRMCVDYRTLNQRTIPDQYTTPRIEDALNCLVGSKWFSVLDLRSGYYQLPMHPEDKEKTAFICPLGFFEFNRMPQGLCGAPATFQRLMERTVGDMHLLEVLVYLDDLIVFGRTLEEHEQRLLKVFDRLEKEGLKLSPEKCQFCQPSVNYVGHVVSAEGIATDPSKIEAVSSWPKPRTITELRSFLGFCGYYRRFVKGFSK 575          
BLAST of Pol polyprotein vs. Ensembl Xenopus
Match: anxa6 (annexin A6 [Source:Xenbase;Acc:XB-GENE-989741])

HSP 1 Score: 138.658 bits (348), Expect = 9.452e-33
Identity = 75/259 (28.96%), Postives = 135/259 (52.12%), Query Frame = 1
Query: 2755 TEHAIITNGN-PFHAKVRQLDNSKLNITKQIFNDLLENKIMQHSNSKWSSALMFKEKPNNEWRACGDYRILNNITIPDKYPILIKNDVINSIYNPIFFSKVDL*KAYHQTPVREEDIKKTEIITPIGLFEYNRMPFALKNAAVTFQRFTDRILRNNKN-TIVYLNDILIASSSRPEHLQNIRDELETLNKHN*KINFKKCEFLKHEFKFLRHLLNENGTRPLENKFKAIKEFPXXXXXXXXXXFLGMINLYHKHIPKYS 3525
             EH + T    P  +   ++  +     K   +++L   ++  S+S W+S ++   K +   R C DYR LN++T  D YP+   +++++ + N  + + +DL + Y Q P+     +K+  +TP GL+++  MPF ++NA  TFQR  +R+L   ++    YL+DI + S +  EHLQ+++     +      +  +KC     E ++L H +     RP   K +AI ++P+ KT +++  FLG    Y K IP YS
Sbjct:  326 AEHKVDTGTQLPIRSPAYRVAEAVRPEMKSQIDEMLAFGVITPSHSPWASPVVLVPKKDGSTRFCVDYRRLNDVTTTDAYPMPRVDELLDRLGNAKYLTTLDLSRGYWQIPLAPSAQEKSAFLTPFGLYQFTVMPFGMRNAPATFQRLVNRLLEGMQDFAQAYLDDIAVFSQTWEEHLQHLQRVFAQIQDAGLTLKPEKCHLAMAEVQYLGHRVGGGQLRPDPAKVEAICQWPIPKTQKQVLAFLGTSGYYRKFIPNYS 584          
BLAST of Pol polyprotein vs. Ensembl Xenopus
Match: ENSXETT00000035398.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:9869556:9871940:-1 gene:ENSXETG00000011182.1 transcript:ENSXETT00000035398.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 123.635 bits (309), Expect = 4.223e-28
Identity = 78/249 (31.33%), Postives = 131/249 (52.61%), Query Frame = 1
Query: 2785 PFHAKVRQLDNSKLNITKQIFNDLLENKIMQHSNSKWSSALMFKEKPNNEWRACGDYRILNNITIPDKYPILIKNDVINSIYNPIFFSKVDL*KAYHQTPVREEDIKKTEIITPIGLFEYNRMPFALKNAAVTFQRFTDRILRN--NKNTIVYLNDILIASSSRPEHLQNIRDELETLNKHN*KINFKKCEFLKHEFKFLRHLLNENGTRPLENKFKAIKEFPXXXXXXXXXXFLGMINLYHKHIPKYS 3525
            P   +   L  ++    K+  ++ L+   ++ S S   +   F EK +   R C DYR LN IT+ ++YP+ + +++ + +     FSK+DL  AY+   +RE D  KT   T  G +EY  MPF L NA   FQ F + I R+   K+ +VYL+DILI S     H   +++ L  L +++     +KC F   +  FL ++++  G      K  AI+++PL ++T+ ++RF+G  N Y + I  +S
Sbjct:    2 PPRGRTYPLSPAETAAMKEYISENLQRGFIRPSTSPAGAGFFFVEKKDGGLRPCIDYRGLNKITVKNRYPLPLISELFDQLKGAKIFSKLDLRGAYNLIRIREGDEWKTAFNTRDGHYEYLVMPFGLCNAPAVFQEFVNDIFRDLLGKSVVVYLDDILIFSQDLETHRSQVKEALSRLRENSLFAKLEKCTFEVPKISFLGYIISSRGFEMDPAKVSAIQKWPLPQSTKAIQRFIGFANYYRQFIKGFS 250          
BLAST of Pol polyprotein vs. Ensembl Xenopus
Match: denr (density-regulated protein [Source:Xenbase;Acc:XB-GENE-1002798])

HSP 1 Score: 124.02 bits (310), Expect = 7.767e-28
Identity = 78/249 (31.33%), Postives = 130/249 (52.21%), Query Frame = 1
Query: 2785 PFHAKVRQLDNSKLNITKQIFNDLLENKIMQHSNSKWSSALMFKEKPNNEWRACGDYRILNNITIPDKYPILIKNDVINSIYNPIFFSKVDL*KAYHQTPVREEDIKKTEIITPIGLFEYNRMPFALKNAAVTFQRFTDRILRN--NKNTIVYLNDILIASSSRPEHLQNIRDELETLNKHN*KINFKKCEFLKHEFKFLRHLLNENGTRPLENKFKAIKEFPXXXXXXXXXXFLGMINLYHKHIPKYS 3525
            P   +   L  ++    K+  ++ L+   ++ S S   +   F EK +   R C DYR LN IT+ ++YP+ + +++ + +     FSK+DL  AY+   +RE D  KT   T  G +EY  MPF L NA   FQ F + I R+   K+ +VYL+DILI S     H   +++ L  L +++      KC F   +  FL ++++  G      K  AI+++PL ++T+ ++RF+G  N Y + I  +S
Sbjct:  520 PPRGRTYPLSPAETAAMKEYISENLQRGFIRPSTSPAGAGFFFVEKKDGGLRPCIDYRGLNKITVKNRYPLPLISELFDQLKGAKIFSKLDLRGAYNLIRIREGDEWKTAFNTRDGHYEYLVMPFGLCNAPAVFQEFVNDIFRDLLGKSVVVYLDDILIFSQDLETHRSQVKEALSRLRENSLFAKLDKCTFEVPKISFLGYIISSRGFEMDPAKVSAIQKWPLPQSTKAIQRFIGFANYYRQFIKGFS 768          
BLAST of Pol polyprotein vs. UniProt/SwissProt
Match: sp|P20825|POL2_DROME (Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 1.125e-39
Identity = 105/292 (35.96%), Postives = 168/292 (57.53%), Query Frame = 1
Query: 2680 EIKEILEIYPTVTNKLSVEKTIKCTTEHAI-ITNGNPFHAKVRQLDNS-KLNITKQIFNDLLENKIMQHSNSKWSS-ALMFKEKPN----NEWRACGDYRILNNITIPDKYPILIKNDVINSIYNPIFFSKVDL*KAYHQTPVREEDIKKTEIITPIGLFEYNRMPFALKNAAVTFQRFTDRILRN--NKNTIVYLNDILIASSSRPEHLQNIRDELETLNKHN*KINFKKCEFLKHEFKFLRHLLNENGTRPLENKFKAIKEFPXXXXXXXXXXFLGMINLYHKHIPKYSE 3528
            ++K +L  +  +  K   + T   T +H +  T+ +P ++K   L  + ++ +  Q+  ++L   +++ SNS ++S   +  +KP+    N++R   DYR LN ITIPD+YPI   ++++  +    +F+ +DL K +HQ  + EE I KT   T  G +EY RMPF L+NA  TFQR  + ILR   NK+ +VYL+DI+I S+S  EHL +I+     L   N K+   KCEFLK E  FL H++  +G +P   K KAI  +P+    +++R FLG+   Y K IP Y++
Sbjct:  170 KLKGLLNKFRNLEYKEGEKLTFTNTIKHVLNTTHNSPIYSKQYPLAQTHEIEVENQV-QEMLNQGLIRESNSPYNSPTWVVPKKPDASGANKYRVVIDYRKLNEITIPDRYPIPNMDEILGKLGKCQYFTTIDLAKGFHQIEMDEESISKTAFSTKSGHYEYLRMPFGLRNAPATFQRCMNNILRPLLNKHCLVYLDDIIIFSTSLTEHLNSIQLVFTKLADANLKLQLDKCEFLKKEANFLGHIVTPDGIKPNPIKVKAIVSYPIPTKDKEIRAFLGLTGYYRKFIPNYAD 460          
BLAST of Pol polyprotein vs. UniProt/SwissProt
Match: sp|P04323|POL3_DROME (Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 3.156e-39
Identity = 98/266 (36.84%), Postives = 153/266 (57.52%), Query Frame = 1
Query: 2755 TEHAIITNGN-PFHAKVRQLDNSKLNITKQIFNDLLENKIMQHSNSKWSSALMFKEKPNN-----EWRACGDYRILNNITIPDKYPILIKNDVINSIYNPIFFSKVDL*KAYHQTPVREEDIKKTEIITPIGLFEYNRMPFALKNAAVTFQRFTDRILRN--NKNTIVYLNDILIASSSRPEHLQNIRDELETLNKHN*KINFKKCEFLKHEFKFLRHLLNENGTRPLENKFKAIKEFPXXXXXXXXXXFLGMINLYHKHIPKYSE 3528
            T+H I T  N P ++K       +  +  QI  D+L   I++ SNS ++S +    K  +     ++R   DYR LN IT+ D++PI   ++++  +    +F+ +DL K +HQ  +  E + KT   T  G +EY RMPF LKNA  TFQR  + ILR   NK+ +VYL+DI++ S+S  EHLQ++    E L K N K+   KCEFLK E  FL H+L  +G +P   K +AI+++P+    ++++ FLG+   Y K IP +++
Sbjct:  197 TKHTINTKHNLPLYSKYSYPQAYEQEVESQI-QDMLNQGIIRTSNSPYNSPIWVVPKKQDASGKQKFRIVIDYRKLNEITVGDRHPIPNMDEILGKLGRCNYFTTIDLAKGFHQIEMDPESVSKTAFSTKHGHYEYLRMPFGLKNAPATFQRCMNDILRPLLNKHCLVYLDDIIVFSTSLDEHLQSLGLVFEKLAKANLKLQLDKCEFLKQETTFLGHVLTPDGIKPNPEKIEAIQKYPIPTKPKEIKAFLGLTGYYRKFIPNFAD 461          
BLAST of Pol polyprotein vs. UniProt/SwissProt
Match: sp|Q8I7P9|POL5_DROME (Retrovirus-related Pol polyprotein from transposon opus OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 2.726e-37
Identity = 104/306 (33.99%), Postives = 168/306 (54.90%), Query Frame = 1
Query: 2644 DNHTKLINTIPKEIKEILEIYPTVTNKLSVEKTIKC----TTEHAIITNGNPFHAKVRQLDNSKLNITKQIFNDLLENKIMQHSNSKWSSALMF---KEKPNNE--WRACGDYRILNNITIPDKYPILIKNDVINSIYNPIFFSKVDL*KAYHQTPVREEDIKKTEIITPIGLFEYNRMPFALKNAAVTFQRFTDRILRN--NKNTIVYLNDILIASSSRPEHLQNIRDELETLNKHN*KINFKKCEFLKHEFKFLRHLLNENGTRPLENKFKAIKEFPXXXXXXXXXXFLGMINLYHKHIPKYSE 3528
            D   +++N++  E   I E  P ++  +SVE  +K      T+  I     P+   +R        + +QI ++LL++ I++ SNS ++S +     K KPN E  +R   D++ LN +TIPD YPI   N  + S+ N  +F+ +DL   +HQ  ++E DI KT   T  G +E+ R+PF LKNA   FQR  D ILR    K   VY++DI++ S     H +N+R  L +L+K N ++N +K  FL  + +FL +++  +G +    K +AI E P   + ++L+RFLGM + Y K I  Y++
Sbjct:   82 DGTQEILNSLLGEFPRIFE--PPLSG-MSVETAVKAEIRTNTQDPIYAKSYPYPVNMRG------EVERQI-DELLQDGIIRPSNSPYNSPIWIVPKKPKPNGEKQYRMVVDFKRLNTVTIPDTYPIPDINATLASLGNAKYFTTLDLTSGFHQIHMKESDIPKTAFSTLNGKYEFLRLPFGLKNAPAIFQRMIDDILREHIGKVCYVYIDDIIVFSEDYDTHWKNLRLVLASLSKANLQVNLEKSHFLDTQVEFLGYIVTADGIKADPKKVRAISEMPPPTSVKELKRFLGMTSYYRKFIQDYAK 377          
BLAST of Pol polyprotein vs. UniProt/SwissProt
Match: sp|Q99315|YG31B_YEAST (Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY3B-G PE=1 SV=3)

HSP 1 Score: 154.836 bits (390), Expect = 1.939e-36
Identity = 94/249 (37.75%), Postives = 140/249 (56.22%), Query Frame = 1
Query: 2782 NPFHAKVRQLDNSKLNITKQIFNDLLENKIMQHSNSKWSSALMFKEKPNNEWRACGDYRILNNITIPDKYPILIKNDVINSIYNPIFFSKVDL*KAYHQTPVREEDIKKTEIITPIGLFEYNRMPFALKNAAVTFQRFTDRILRNNKNTIVYLNDILIASSSRPEHLQNIRDELETLNKHN*KINFKKCEFLKHEFKFLRHLLNENGTRPLENKFKAIKEFPXXXXXXXXXXFLGMINLYHKHIPKYSE 3528
             P+H  V + +  ++N   +I   LL+NK +  S S  SS ++   K +  +R C DYR LN  TI D +P+   +++++ I N   F+ +DL   YHQ P+  +D  KT  +TP G +EY  MPF L NA  TF R+     R+ +   VYL+DILI S S  EH +++   LE L   N  +  KKC+F   E +FL + +      PL++K  AI++FP  KT ++ +RFLGMIN Y + IP  S+
Sbjct:  600 QPYH--VTEKNEQEIN---KIVQKLLDNKFIVPSKSPCSSPVVLVPKKDGTFRLCVDYRTLNKATISDPFPLPRIDNLLSRIGNAQIFTTLDLHSGYHQIPMEPKDRYKTAFVTPSGKYEYTVMPFGLVNAPSTFARYMADTFRDLRFVNVYLDDILIFSESPEEHWKHLDTVLERLKNENLIVKKKKCKFASEETEFLGYSIGIQKIAPLQHKCAAIRDFPTPKTVKQAQRFLGMINYYRRFIPNCSK 843          
BLAST of Pol polyprotein vs. UniProt/SwissProt
Match: sp|Q7LHG5|YI31B_YEAST (Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY3B-I PE=1 SV=2)

HSP 1 Score: 154.451 bits (389), Expect = 2.091e-36
Identity = 94/249 (37.75%), Postives = 140/249 (56.22%), Query Frame = 1
Query: 2782 NPFHAKVRQLDNSKLNITKQIFNDLLENKIMQHSNSKWSSALMFKEKPNNEWRACGDYRILNNITIPDKYPILIKNDVINSIYNPIFFSKVDL*KAYHQTPVREEDIKKTEIITPIGLFEYNRMPFALKNAAVTFQRFTDRILRNNKNTIVYLNDILIASSSRPEHLQNIRDELETLNKHN*KINFKKCEFLKHEFKFLRHLLNENGTRPLENKFKAIKEFPXXXXXXXXXXFLGMINLYHKHIPKYSE 3528
             P+H  V + +  ++N   +I   LL+NK +  S S  SS ++   K +  +R C DYR LN  TI D +P+   +++++ I N   F+ +DL   YHQ P+  +D  KT  +TP G +EY  MPF L NA  TF R+     R+ +   VYL+DILI S S  EH +++   LE L   N  +  KKC+F   E +FL + +      PL++K  AI++FP  KT ++ +RFLGMIN Y + IP  S+
Sbjct:  626 QPYH--VTEKNEQEIN---KIVQKLLDNKFIVPSKSPCSSPVVLVPKKDGTFRLCVDYRTLNKATISDPFPLPRIDNLLSRIGNAQIFTTLDLHSGYHQIPMEPKDRYKTAFVTPSGKYEYTVMPFGLVNAPSTFARYMADTFRDLRFVNVYLDDILIFSESPEEHWKHLDTVLERLKNENLIVKKKKCKFASEETEFLGYSIGIQKIAPLQHKCAAIRDFPTPKTVKQAQRFLGMINYYRRFIPNCSK 869          
BLAST of Pol polyprotein vs. TrEMBL
Match: A0A2G8KPC5 (Gag-pol polyprotein OS=Stichopus japonicus OX=307972 GN=BSL78_13300 PE=4 SV=1)

HSP 1 Score: 285.419 bits (729), Expect = 8.599e-82
Identity = 156/424 (36.79%), Postives = 228/424 (53.77%), Query Frame = 1
Query: 2248 NTTYLVDTGSIVSLLPSYRFINLNEENFKLFTANCSSIKTYGKQPLIININNTN-YSWDFIIADIKQAILGSDFLSDYNFLVDCRNKRILQXXXXXXXXXXXXXXXXXSKHQRNCFIGVITVLNIHKQYKNTEDNHTKLINTIPKEIKEILEIYPTVTNKLSVEKTIKCTTEHAIITNGNPFHAKVRQLDNSKLNITKQIFNDLLENKIMQHSNSKWSSALMFKEKPNNEWRACGDYRILNNITIPDKYPILIKNDVINSIYNPIFFSKVDL*KAYHQTPVREEDIKKTEIITPIGLFEYNRMPFALKNAAVTFQRFTDRILRNNKNTIVYLNDILIASSSRPEHLQNIRDELETLNKHN*KINFKKCEFLKHEFKFLRHLLNENGTRPLENKFKAIKEFPXXXXXXXXXXFLGMINLYHKHIP 3516
             T +L+DTG+ VS++P+            L  AN ++I TYG+  L +NI     Y W F+ AD+   I+G+DFL  ++ LVD +++R+L                    H      G+ + +           N T  I+    + + +L  +P + N      T+K    H I+T G P  A+ R+L   +L + K  F  +LE  I++ S S WSS L    K + +WR CGDYR LN++TIPD+YPI   +D   +++  I FSK+DL +AYHQ PV   D+ KT I TP GLFE+ RMPF LKNAA TFQRF D +LR       YL+D+L+ASSS  EH Q++    + L+ +   IN  KCE      +FL H ++  G RPL  K +A+++FP  +   +LR FLG+ N Y + +P
Sbjct:    6 GTRFLIDTGAEVSVIPATSKEKTTPARSFLRAANLTNIGTYGESSLTLNIGLRRIYRWIFVKADVSTPIIGADFLEHFSLLVDIKHRRLLDL------------------HTSLSITGIRSTVE--------SSNLTFHIDDHDSQYRSLLRQFPHLVNPSRTAATVKHNITHHILTKGPPTFARPRRLAPDRLRLAKNEFEHMLELGIIRPSESSWSSPLHMVPKKSGDWRPCGDYRSLNSVTIPDRYPIPHIHDFTGTLHGKIIFSKIDLVRAYHQIPVEPADVPKTAITTPFGLFEFVRMPFGLKNAAQTFQRFIDEVLRGLPFVYAYLDDLLVASSSAEEHYQHLNQLFQRLDSYGININPSKCELGVSSLEFLGHHVDSQGIRPLPEKVQAVQDFPAPENLTQLRAFLGLANFYRRFVP 403          
BLAST of Pol polyprotein vs. TrEMBL
Match: A0A5S6QAW0 (Uncharacterized protein OS=Trichuris muris OX=70415 PE=4 SV=1)

HSP 1 Score: 291.197 bits (744), Expect = 2.791e-80
Identity = 154/418 (36.84%), Postives = 230/418 (55.02%), Query Frame = 1
Query: 2257 YLVDTGSIVSLLPSYRF-INLNEENFKLFTANCSSIKTYGKQPLIININNTNYSWDFIIADIKQAILGSDFLSDYNFLVDCRNKRILQXXXXXXXXXXXXXXXXXSKHQRNCFIGVITVLNIHKQYKNTEDNHTKLINTIPKEIKEILEIYPTVTNKLSVEKTIKCTTEHAIITNGNPFHAKVRQLDNSKLNITKQIFNDLLENKIMQHSNSKWSSALMFKEKPNNEWRACGDYRILNNITIPDKYPILIKNDVINSIYNPIFFSKVDL*KAYHQTPVREEDIKKTEIITPIGLFEYNRMPFALKNAAVTFQRFTDRILRNNKNTIVYLNDILIASSSRPEHLQNIRDELETLNKHN*KINFKKCEFLKHEFKFLRHLLNENGTRPLENKFKAIKEFPXXXXXXXXXXFLGMINLYHK 3507
            +L+DTG+ +S++P+    I  +     L  AN S+IKTYG + L +N  + +++W F +AD+ Q +LG+DF   ++ LVD + +R++ +   +                           +I  +       H   + +   E  +IL  +P +        + K   +H I+T+G P HA+ R+L   KL + K  F ++ E +I++ SNS W+S L    K +  WR CGDYR LN  T PD+YP+    D   +++    FSKVDL + YHQ PV  +DI+KT +ITP GLFE+ RMPF LKNAA  FQR  D + R    T VYL+DILIAS SR EHL ++R     L+ H+  IN  KC+F +    FL H ++++G  PL +K  AI+ FP   T + L+ FLGM+N YH+
Sbjct:   64 FLIDTGAEISVIPASAMEIRSHIPTACLVAANNSTIKTYGTRTLPLNFCSRHFTWTFTVADVAQPLLGADFFRAHSLLVDMKGRRLIDSKIFD---------------------------SISLRRTQATALHLGSVASHDSEYAKILNEFPDIKTPQFTANSPKHGVQHHIVTSGAPLHARTRRLPPDKLQLAKNEFRNMEELEIVRRSNSPWASPLHMVPKASGGWRPCGDYRRLNEATTPDRYPVPHIQDFSANLHGTKIFSKVDLIRGYHQIPVYPDDIQKTAVITPFGLFEFLRMPFGLKNAAQAFQRLMDTVCRGLDFTFVYLDDILIASRSRQEHLMHLRQLFHRLSAHSLVINLDKCQFGRTSIDFLGHHIDQHGATPLASKVDAIRNFPKPTTVKGLQEFLGMVNFYHR 454          
BLAST of Pol polyprotein vs. TrEMBL
Match: A0A147BLP1 (Putative pol polyprotein (Fragment) OS=Ixodes ricinus OX=34613 PE=4 SV=1)

HSP 1 Score: 296.59 bits (758), Expect = 6.869e-80
Identity = 171/440 (38.86%), Postives = 240/440 (54.55%), Query Frame = 1
Query: 2212 YGDSETFTVQSKNT--TYLVDTGSIVSLLPSYRFINLNE-ENFKLFTANCSSIKTYGKQPLIININ-NTNYSWDFIIADIKQAILGSDFLSDYNFLVDCRNKRILQXXXXXXXXXXXXXXXXXSKHQRNCFIGVITVLNIHKQYKNTED-NHTKLINTIPKEIKEILEIYPTVTNKLSVEKTIKCTTEHAIITNGNPFHAKVRQLDNSKLNITKQIFNDLLENKIMQHSNSKWSSALMFKEKPNNEWRACGDYRILNNITIPDKYPILIKNDVINSIYNPIFFSKVDL*KAYHQTPVREEDIKKTEIITPIGLFEYNRMPFALKNAAVTFQRFTDRILRNNKNTIVYLNDILIASSSRPEHLQNIRDELETLNKHN*KINFKKCEFLKHEFKFLRHLLNENGTRPLENKFKAIKEFPXXXXXXXXXXFLGMINLYHKHIP 3516
            +G S  F V  + T   YLVDTG+ VS++P  +    +  +   L  AN SSIKTYG++ L +++     Y W F +AD++Q ILG+DFL  +  +VD                             RN  +   T L +H     T+  N T          K +L+ +P +  + +  +T+K T  H I T G P  A+ R+L   +L I +Q F  ++E  I++ S+S WSSAL    K + +WR CGDYR LNN+T+PD+YPI    D  NS++    F+K+DL KAYHQ PV   D+ KT I+TP G++EY RMPF L+NAA TFQRF D++LR       YL+DIL+ S    EH  ++R     L+ +   IN  KCEF   E  FL H +N  G RPL  + +AI++FP   TT KLR FLG++N Y + IP
Sbjct:   16 HGTSRLFFVTERVTKLQYLVDTGAEVSVIPPTKEERRHPTDTPPLQAANGSSIKTYGQRSLTLDLGLRRTYRWIFYVADVQQPILGADFLRHFGLVVDL---------------------------SRNVLLDRGTHLYVHGILSKTKSLNLTISTQVSGAPWKSLLDEFPQLLRQSNPPQTVKHTITHHIETTGPPVFARPRRLAPDRLKIARQEFEHMIELGIVRPSSSAWSSALHMVPKKSGDWRPCGDYRALNNVTVPDRYPIPHLQDFGNSLHGSTIFTKIDLVKAYHQIPVEPCDVPKTAIVTPFGMYEYTRMPFGLRNAAQTFQRFMDQVLRGFPFCFAYLDDILVFSRDEKEHRDHLRQLFIRLSDYGILINAAKCEFGVSELSFLGHYVNHLGIRPLPQRIEAIEKFPQPLTTTKLREFLGLVNFYRRFIP 428          
BLAST of Pol polyprotein vs. TrEMBL
Match: A0A293MAR4 (Integrase core domain protein (Fragment) OS=Ornithodoros erraticus OX=265619 PE=4 SV=1)

HSP 1 Score: 285.034 bits (728), Expect = 9.288e-80
Identity = 173/489 (35.38%), Postives = 248/489 (50.72%), Query Frame = 1
Query: 2125 ETTLSKATNLALTTKTINKRLKPPMTAPTYGDSETFTVQSKNTT---YLVDTGSIVSLLPSYRFINLNEENFKLFTANCSSIKTYGKQPLIININ-NTNYSWDFIIADIKQAILGSDFLSDYNFLVDCRNKRILQXXXXXXXXXXXXXXXXXSKHQRNCFIGVITVLNIHKQYKNTEDNHTKLINTIPKEIKEILEIYPTVTNKLSVEKTIKCTTEHAIITNGNPFHAKVRQLDNSKLNITKQIFNDLLENKIMQHSNSKWSSALMFKEKP-NNEWRACGDYRILNNITIPDKYPILIKNDVINSIYNPIFFSKVDL*KAYHQTPVREEDIKKTEIITPIGLFEYNRMPFALKNAAVTFQRFTDRILRNNKNTIVYLNDILIAS----------------SSRP-EHLQNIRDELETLNKHN*KINFKKCEFLKHEFKFLRHLLNENGTRPLENKFKAIKEFPXXXXXXXXXXFLGMINLYHKHIPKYS 3525
             T   K    ALT  +   RL          D +     ++ TT   +LVDTG+ +S+LP+      +     L   N ++I  YG + L +N+     + W F +AD+  AILG+DFLS +  LVD + KR+L +    T                 C +     LN+     +  D++  L          +L+ YPT+T  L+V+  +K +  H I T G P H + R+L   +L I K  F  +L+  I++ S+S WSSAL    KP   +WR CGDYR LN +T+PD+YPI    D   ++   + FSKVDL KAYHQ P+   DI KT I TP GLFEY RMPF L+NAA TFQRF D + R       Y++D+L+AS                S+ P EHL ++R   + L  +   +N +K EF      FL H ++  G RPL  K +AI++FP   T RKLR F+G++N Y + +P  +
Sbjct:    8 RTARGKCPASALTAASAEGRLD---------DRQRLLFVTERTTGRRFLVDTGADISVLPASPADKRHPATGCLQAVNNTAIPHYGTRSLTLNLGLRRAFRWVFTVADLSYAILGADFLSHFGILVDMKRKRLLDSMTQLTV---------------PCILSKQASLNLTLASTDAPDSNPYL---------ALLKDYPTITQPLAVDAPVKHSVTHHIKTTGPPVHVRPRRLPPERLRIAKNEFEHMLDLGIIRPSSSPWSSALHMVPKPIPGDWRPCGDYRALNQVTVPDRYPIPHIQDFTANLDGAVLFSKVDLIKAYHQIPMEAADIPKTAITTPFGLFEYLRMPFGLRNAAQTFQRFMDEVTRGLPFCYAYIDDLLVASTSPDEHRMHLRTLFLASTSPEEHLMHLRTLFQRLADYGIVVNPRKSEFGVPALTFLGHRIDSTGIRPLPEKVQAIRDFPQPTTKRKLREFVGLVNFYRRFLPSAA 463          
BLAST of Pol polyprotein vs. TrEMBL
Match: A0A2G8KJT6 (Uncharacterized protein (Fragment) OS=Stichopus japonicus OX=307972 GN=BSL78_14867 PE=4 SV=1)

HSP 1 Score: 287.73 bits (735), Expect = 9.918e-79
Identity = 161/443 (36.34%), Postives = 236/443 (53.27%), Query Frame = 1
Query: 2197 MTAPTYGDSETFTVQSK--NTTYLVDTGSIVSLLPSYRFINLNEENFKLFTANCSSIKTYGKQPLIININNTN-YSWDFIIADIKQAILGSDFLSDYNFLVDCRNKRILQXXXXXXXXXXXXXXXXXSKHQRNCFIGVITVLNIHKQYKNTEDNHTKLINTIPKEIKEILEIYPTVTNKLSVEKTIKCTTEHAIITNGNPFHAKVRQLDNSKLNITKQIFNDLLENKIMQHSNSKWSSALMFKEKPNNEWRACGDYRILNNITIPDKYPILIKNDVINSIYNPIFFSKVDL*KAYHQTPVREEDIKKTEIITPIGLFEYNRMPFALKNAAVTFQRFTDRILRNNKNTIVYLNDILIASSSRPEHLQNIRDELETLNKHN*KINFKKCEFLKHEFKFLRHLLNENGTRPLENKFKAIKEFPXXXXXXXXXXFLGMINLYHKHIP 3516
            ++ PT   S  F V  +   T +L+DTG+ VS++P+            L  AN ++I TYG+  L +NI     Y W F+ AD+   I+G+DFL  ++ LVD +++R+L                    H      G+ + +           N T  I+    + + +L  +P + N      T+K    H I+T G P  A+ R+L   +L + K  F  +LE  I++ S S WSS L    K + +WR CGDYR LN++TIPD+YPI   +D   +++  I FSK+DL +AYHQ PV   D+ KT I TP GLFE+ RMPF LKNAA TFQRF D +LR       YL+D+L+ASSS  EH Q++    + L+ +   IN  KCE      +FL H ++  G RPL  K +A+++FP  +   +LR FLG+ N Y + +P
Sbjct:   29 LSGPT-PKSRLFYVMDRETGTRFLIDTGAEVSVIPATSKEKTTPARSFLRAANLTNIGTYGESSLTLNIGLRRIYRWIFVKADVSTPIIGADFLEHFSLLVDIKHRRLLDL------------------HTSLSITGIRSTVE--------SSNLTFHIDDHDSQYRSLLRQFPHLVNPSRTAATVKHNITHHILTKGPPTFARPRRLAPDRLRLAKNEFEHMLELGIIRPSESSWSSPLHMVPKKSGDWRPCGDYRSLNSVTIPDRYPIPHIHDFTGTLHGKIIFSKIDLVRAYHQIPVEPADVPKTAITTPFGLFEFVRMPFGLKNAAQTFQRFIDEVLRGLPFVYAYLDDLLVASSSAEEHYQHLNQLFQRLDSYGININPSKCELGVSSLEFLGHHVDSQGIRPLPEKVQAVQDFPAPENLTQLRAFLGLANFYRRFVP 444          
BLAST of Pol polyprotein vs. Ensembl Cavefish
Match: ENSAMXT00000030217.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:12351169:12363564:1 gene:ENSAMXG00000035335.1 transcript:ENSAMXT00000030217.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 173.711 bits (439), Expect = 2.952e-43
Identity = 100/289 (34.60%), Postives = 166/289 (57.44%), Query Frame = 1
Query: 2677 KEIKEILEIYPTVTNKLSVEKTIKCTT--EHAI-ITNGNPFHAKVRQLDNSKLNITKQIFNDLLENKIMQHSNSKWSSALMFKEKPNNEWRACGDYRILNNITIPDKYPILIKNDVINSIYNPIFFSKVDL*KAYHQTPVREEDIKKTEIITPIGLFEYNRMPFALKNAAVTFQRFTDRILRNNK--NTIVYLNDILIASSSRPEHLQNIRDELETLNKHN*KINFKKCEFLKHEFKFLRHLLNENGTRPLENKFKAIKEFPXXXXXXXXXXFLGMINLYHKHIPKYSE 3528
            +E K +L  Y  V ++   E  I CTT  +H I +T+  P   + R+L  S+    K    DLL+ ++++ S S +SS ++  +K +   R C DYR LN  T  D YP+    + ++++     FS +DL   Y+Q P+ EED +KT   TP GLFE+NRMPF L NA  TFQR  +R+  + +  + ++YL+DI+I SS+   HL+ ++  L  L +HN K+  +KC F ++E ++L H+++ +G     +K  A+ E+    T ++LR FLG  + Y + + K+++
Sbjct:  296 QEGKALLRQYSEVFSQ--GEGDIGCTTLIQHEIPLTDDAPVRQRYRRLPPSQYEQVKAHIQDLLQREVVRVSCSPYSSPIVVVQKKDGTLRLCVDYRQLNAKTRKDAYPLPRIEESLDALAGAKLFSTLDLTSGYNQVPMAEEDKQKTAFCTPFGLFEFNRMPFGLCNAPSTFQRLMERVFGDERFQSLLLYLDDIVIFSSTFDSHLERLQMVLGRLQQHNLKLKLEKCNFFQNEVRYLGHVISASGVATDPDKITAVSEWKRPTTVKELRSFLGFASYYRRFVDKFAK 582          
BLAST of Pol polyprotein vs. Ensembl Cavefish
Match: ENSAMXT00000041682.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002320.1:24977:29035:1 gene:ENSAMXG00000038531.1 transcript:ENSAMXT00000041682.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 167.933 bits (424), Expect = 1.830e-41
Identity = 98/286 (34.27%), Postives = 163/286 (56.99%), Query Frame = 1
Query: 2686 KEILEIYPTVTNKLSVEKTIKCT--TEHAI-ITNGNPFHAKVRQLDNSKLNITKQIFNDLLENKIMQHSNSKWSSALMFKEKPNNEWRACGDYRILNNITIPDKYPILIKNDVINSIYNPIFFSKVDL*KAYHQTPVREEDIKKTEIITPIGLFEYNRMPFALKNAAVTFQRFTDRILRNNK--NTIVYLNDILIASSSRPEHLQNIRDELETLNKHN*KINFKKCEFLKHEFKFLRHLLNENGTRPLENKFKAIKEFPXXXXXXXXXXFLGMINLYHKHIPKYSE 3528
            K++L+ Y +V ++   E  + CT   EH I + +  P   + R+L  S+ ++ K    +LL+ K+++ S S +SS ++  +K +   R C DYR LN+ T  D YP+    + ++++    FFS +DL   Y+Q P+ E D  KT   TP GLFE+NRMPF L NA  TFQR  +RI  + +  + ++YL+DI+I SS+   HLQ +   L+ L ++N K+   KC F + + K+L H+++  G      K KA+ E+   +T  +LR FLG  + Y + +  +++
Sbjct:  290 KDLLQRYSSVFSQ--DEGELGCTHLIEHEIPLIDDTPVKQRYRRLPPSQYDLVKGHIQELLDRKVIRASCSPYSSPVVVVQKRDGTIRLCVDYRQLNSKTRKDAYPLPRIEESLDALGGARFFSTLDLASGYNQVPMAEHDKSKTAFCTPFGLFEFNRMPFGLCNAPSTFQRLMERIFGDERFQSLLLYLDDIVIFSSTFDLHLQRLEVVLKRLQQNNLKLKLSKCHFFQSQVKYLGHVISSAGVATDPEKIKAVSEWERPQTVTQLRSFLGFASYYRRFVEGFAK 573          
BLAST of Pol polyprotein vs. Ensembl Cavefish
Match: ENSAMXT00000041345.1 (pep primary_assembly:Astyanax_mexicanus-2.0:25:32334536:32339002:1 gene:ENSAMXG00000029230.1 transcript:ENSAMXT00000041345.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 165.622 bits (418), Expect = 9.525e-41
Identity = 123/452 (27.21%), Postives = 211/452 (46.68%), Query Frame = 1
Query: 2230 FTVQSKNTTYLVDTGSIVSLLPSYRFINL--------NEENFKLFTANCSSIKTYGKQPLIININNTNYSWDFIIADIK----QAILGSDFLSDYNFLVDC-RNKRILQXXXXXXXXXXXXXXXXXSKHQRNCFI--GVITVLNIHKQYKNTEDNHTKLINTIPKEIKEILEIYPTV-TNKLSVEKTIKCTTEHAIITNGN-PFHAKVRQLDNSKLNITKQIFNDLLENKIMQHSNSKWSSALMFKEKPNNEWRACGDYRILNNITIPDKYPILIKNDVINSIYNPIFFSKVDL*KAYHQTPVREEDIKKTEIITPIGLFEYNRMPFALKNAAVTFQRFTDRILRN--NKNTIVYLNDILIASSSRPEHLQNIRDELETLNKHN*KINFKKCEFLKHEFKFLRHLLNENGTRPLENKFKAIKEFPXXXXXXXXXXFLGMINLYHKHIPKYSE 3528
             +V+ +  T ++DTGS  SL+    +  +        +    K   AN  +    G   L   +        F + + K      +LG DFL D   ++D  ++  IL   +        ++   +    R C      + +    +Q  N       + +   +++ ++L  +P+V TN+L     +     H I TN N P   K  ++   K  + K+   D+    I++ S S W+S ++   K     R C DYR +N+ T  D YP+    +++ S++    FS +DL   Y Q  +  + I KT  IT  GL+E+  +PF +KNAA TFQR  D +L N   K+  VY+NDI++ SS+  +HL ++ +    L++    +N +KC  L+    FL H+++  G      K +AI+ FP  ++ ++L+RFLGM   YH+ I  +SE
Sbjct:  430 LSVRGQQVTAMIDTGSTFSLIQEGTWDRMKRTQEVWRSGRGQKFILANGQTQTAKGVVELDCELGKCQAKRPFYVMENKDHVFSLVLGLDFLHDTGLILDFQKDVYILPGGDTVPFGGEGESPPFSYADMRLCIAQEDYVPLDYEEEQEINKLVEGADITSQAKQDLHKLLSQWPSVCTNQLGRTMIVL----HHITTNDNLPIRQKPYKVSIEKQQLIKEAIEDMQRRGIVRPSTSPWASPVVLVPKKEGGVRFCVDYRRMNSKTHLDAYPMPQVQEILESLHGAAIFSTLDLKSGYWQVGLEPDSIPKTAFITCQGLYEFTVLPFGIKNAAATFQRLMDSVLVNLKGKSCFVYINDIVVYSSTIEQHLGHLEEVFRCLHQAGLTLNLRKCNLLQRSLIFLGHVISGEGICTEPGKVEAIQAFPEPRSIKELQRFLGMAGWYHRFITHFSE 877          
BLAST of Pol polyprotein vs. Ensembl Cavefish
Match: ENSAMXT00000045469.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000976.1:426503:430633:1 gene:ENSAMXG00000030479.1 transcript:ENSAMXT00000045469.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 163.31 bits (412), Expect = 4.292e-40
Identity = 88/266 (33.08%), Postives = 154/266 (57.89%), Query Frame = 1
Query: 2743 IKCTT--EHAI-ITNGNPFHAKVRQLDNSKLNITKQIFNDLLENKIMQHSNSKWSSALMFKEKPNNEWRACGDYRILNNITIPDKYPILIKNDVINSIYNPIFFSKVDL*KAYHQTPVREEDIKKTEIITPIGLFEYNRMPFALKNAAVTFQRFTDRILRNNK--NTIVYLNDILIASSSRPEHLQNIRDELETLNKHN*KINFKKCEFLKHEFKFLRHLLNENGTRPLENKFKAIKEFPXXXXXXXXXXFLGMINLYHKHIPKYS 3525
            + CTT  +H+I + +  P   + R+L  S+ ++ K    +L+E+++++ S+S ++S ++  +K +   R C DYR LN  T  D +P+    + ++++    +FS +DL   Y+Q PV E+D +KT   TP GLFE+NRMPF L NA  TFQR  +RI  +      ++YL+DI+I SS   +HLQ +   L  L +HN K+  +KC F +    +L H+++E+G      K +A+ ++    T +++R FLG  + Y + +  ++
Sbjct:  339 LGCTTLVQHSIPLLDSVPVRQRYRRLPPSQYDLVKAHIQELVEHQVVRPSSSPYASPIVVVQKKDGSIRLCVDYRQLNAKTRKDAFPLPRIEESLDALSGSKWFSTLDLASGYNQVPVLEKDKEKTAFCTPFGLFEFNRMPFGLCNAPSTFQRLMERIFGDQSFHTLLLYLDDIVIFSSDLQQHLQRLDMVLSRLQQHNLKLKLEKCHFFQTRVSYLGHVISESGVETDPEKIRAVVDWKRPTTVKEVRSFLGFASYYRRFVEGFA 604          
BLAST of Pol polyprotein vs. Ensembl Cavefish
Match: ENSAMXT00000041754.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001938.1:55959:59870:1 gene:ENSAMXG00000043385.1 transcript:ENSAMXT00000041754.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 161.384 bits (407), Expect = 1.450e-39
Identity = 87/270 (32.22%), Postives = 148/270 (54.81%), Query Frame = 1
Query: 2734 EKTIKCTT--EHAI-ITNGNPFHAKVRQLDNSKLNITKQIFNDLLENKIMQHSNSKWSSALMFKEKPNNEWRACGDYRILNNITIPDKYPILIKNDVINSIYNPIFFSKVDL*KAYHQTPVREEDIKKTEIITPIGLFEYNRMPFALKNAAVTFQRFTDRILRNNK--NTIVYLNDILIASSSRPEHLQNIRDELETLNKHN*KINFKKCEFLKHEFKFLRHLLNENGTRPLENKFKAIKEFPXXXXXXXXXXFLGMINLYHKHIPKYSE 3528
            E  + CT+   H I + +  P     R++  S+ +  K     LL++++++ S+S +SS ++   K +   R C DYR LN  T  D YP+    + ++++    +FS +DL   Y+Q PV E+D  KT   TP GLFE+NRMPF L NA  TFQR  +RI  + +  + ++YL+D+++ S +  EHL+ + +    L K N K+   KC+F +H+  +L H+++  G      K + +KE+       +LR FLG  + Y + +  +S+
Sbjct:  287 EGDLGCTSLISHEIPLLDEVPVRQPYRRIPPSQYSTVKAHIQQLLDSRVIRESSSPFSSPIVLVTKKDGSLRLCVDYRQLNAKTRRDSYPLPRIEESLDALCGAKWFSTLDLASGYNQVPVEEKDKSKTAFCTPFGLFEFNRMPFGLCNAPGTFQRLMERIFGDCRYQSVLLYLDDVIVFSQTVEEHLERLEEVFSRLQKQNLKVKLSKCQFFQHQVSYLGHVVSAEGVTTDPAKIEVVKEWKSPSHLAELRSFLGFASYYRRFVEGFSK 556          
BLAST of Pol polyprotein vs. Ensembl Medaka
Match: ENSORLT00000040051.1 (pep primary_assembly:ASM223467v1:1:37354481:37359289:-1 gene:ENSORLG00000026212.1 transcript:ENSORLT00000040051.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 192.971 bits (489), Expect = 3.566e-49
Identity = 137/464 (29.53%), Postives = 229/464 (49.35%), Query Frame = 1
Query: 2236 VQSKNTTYLVDTGSIVSLLPSYRFINLNEENFKLFTANCSSI-----KTYG---KQPLIININNTNYSWD-FIIADIKQA---ILGSDFLSDYNFLVDCRNKRILQXXXXXXXXXXXXXXXXXSKHQRNCFIGVITVLNIHKQYKNTEDNH--TKLINTI---------------PKEIKEILEIYPTV-TNKLSVEKTIKCTTEHAIITNGN-PFHAKVRQLDNSKLNITKQIFNDLLENKIMQHSNSKWSSALMFKEKPNNEWRACGDYRILNNITIPDKYPILIKNDVINSIYNPIFFSKVDL*KAYHQTPVREEDIKKTEIITPIGLFEYNRMPFALKNAAVTFQRFTDRILRNNKNTI--VYLNDILIASSSRPEHLQNIRDELETLNKHN*KINFKKCEFLKHEFKFLRHLLNENGTRPLENKFKAIKEFPXXXXXXXXXXFLGMINLYHKHIPKYSE 3528
            V+ K    + DTG   SL+   ++  +  E  +L T +  +      KT+G   K  L+ N +   +S D +I+AD   A   ILG DFL   + +++  N+              T    N S +  + FI      N H Q +++   H    L  T+               P E++E+L  +P V + KL     I    EH I T    P   K  ++   K  I  +  + +L++ I++ S S W + ++   KP+   R C DYR LN  T  D YP+ + +D++ S++   FFS +DL   Y Q  + E+   KT +ITP+GL+++  MPF LKNA  TFQR  +++L   +  +  VY++D++I S S  +HL++++     L+  N  +N KKC F + + +FL H+++  G +   +K +A+  +P       L+RFLG++  YHK IP++S+
Sbjct:  541 VRGKICHAVFDTGCTYSLMRQSQWSEIAHEGEQLKTCDSQTFALADGKTHGALGKVQLLYNWHGMLWSLDTYIMADAHLAFPIILGLDFLRKTSTILNLGNQ--------------TYGVKNLSGYAFHHFID-----NHHGQGESSSSVHLYMALPPTVTNPGWQVAPPAFMDQPVEVRELLRAWPKVCSGKLG----ITSAEEHHIFTTDEVPVRCKAYRVSPFKRKIITEHIDQMLKDGIIEPSQSAWGAPVVLVPKPDGSMRFCVDYRRLNAKTTADAYPMPLIHDLLESMHGAEFFSTLDLKSGYWQVAMAEDSKAKTAVITPVGLYQFKSMPFGLKNAGATFQRLMEKVLGELRGRLCCVYIDDVIIFSPSAEQHLKDLQAVFGKLHSANLVLNLKKCTFFQRQLRFLGHIVSGAGVQVDPDKSRAVMTYPEPTNVPSLQRFLGLVGWYHKFIPQFSD 981          
BLAST of Pol polyprotein vs. Ensembl Medaka
Match: ENSORLT00000032171.1 (pep primary_assembly:ASM223467v1:18:2114932:2117958:1 gene:ENSORLG00000025397.1 transcript:ENSORLT00000032171.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 157.918 bits (398), Expect = 1.141e-38
Identity = 92/297 (30.98%), Postives = 159/297 (53.54%), Query Frame = 1
Query: 2662 INTIPKE----IKEILEIYPTVTNKLSVEKTIKCTT--EHAI-ITNGNPFHAKVRQLDNSKLNITKQIFNDLLENKIMQHSNSKWSSALMFKEKPNNEWRACGDYRILNNITIPDKYPILIKNDVINSIYNPIFFSKVDL*KAYHQTPVREEDIKKTEIITPIGLFEYNRMPFALKNAAVTFQRFTDRILRNN--KNTIVYLNDILIASSSRPEHLQNIRDELETLNKHN*KINFKKCEFLKHEFKFLRHLLNENGTRPLENKFKAIKEFPXXXXXXXXXXFLGMINLYHKHIPKYS 3525
            + T+P E     + +L+ Y  V    + E  + CTT   H I + +  P   + R++  S+    K   N LL + +++ SNS ++S ++   K +   R C DYR LN+ T  D +P+   ++ ++++    +F+ +DL   Y+Q PV E D  KT   TP GLFE+NRMPF L NA  TFQR   RI  +   ++ ++YL+DI++ SS+  EHL+ +   L  L +   ++   KC F + E ++L H++++ G     +K +A+  +    T  +LR FLG  + Y + +  ++
Sbjct:  175 LETLPAEDRGKAQALLQKYANVFA--AHEGDLGCTTLMTHEIPLLDDAPVRQRHRRIPPSEYEAVKDHINQLLASGVIRESNSPYASPIVLARKKDGSLRMCVDYRQLNSKTRRDAFPLPRIDESLDALSGARWFTTLDLASGYNQVPVTEGDRAKTAFCTPFGLFEWNRMPFGLCNAPGTFQRLMQRIFGDQQCQSVLLYLDDIVVFSSTIDEHLERLELVLGRLQQEKLRVKLPKCAFFQQEVRYLGHVISDQGVSTDPHKIEAVAGWQPPSTVSELRTFLGFASYYRRFVEGFA 469          
BLAST of Pol polyprotein vs. Ensembl Medaka
Match: ENSORLT00000041674.1 (pep primary_assembly:ASM223467v1:5:30088905:30092924:1 gene:ENSORLG00000022054.1 transcript:ENSORLT00000041674.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 155.992 bits (393), Expect = 8.216e-38
Identity = 91/297 (30.64%), Postives = 158/297 (53.20%), Query Frame = 1
Query: 2662 INTIPKE----IKEILEIYPTVTNKLSVEKTIKCTT--EHAI-ITNGNPFHAKVRQLDNSKLNITKQIFNDLLENKIMQHSNSKWSSALMFKEKPNNEWRACGDYRILNNITIPDKYPILIKNDVINSIYNPIFFSKVDL*KAYHQTPVREEDIKKTEIITPIGLFEYNRMPFALKNAAVTFQRFTDRILRNN--KNTIVYLNDILIASSSRPEHLQNIRDELETLNKHN*KINFKKCEFLKHEFKFLRHLLNENGTRPLENKFKAIKEFPXXXXXXXXXXFLGMINLYHKHIPKYS 3525
            + T+P E     + +L+ Y  V    + E  + CTT   H I + +  P   + R++  S+    K   N LL + +++ SNS ++S ++   K +   R C DYR LN+ T  D +P+   ++ ++++    +F+ +DL   Y+Q PV E D  KT    P GLFE+NRMPF L NA  TFQR   RI  +   ++ ++YL+DI++ SS+  EHL+ +   L  L +   ++   KC F + E ++L H++++ G     +K +A+  +    T  +LR FLG  + Y + +  ++
Sbjct:  267 LETLPAEDRGKAQALLQKYANVFA--AHEGDLGCTTLMTHEIPLLDDAPVRQRHRRIPPSEYEAVKDHINQLLASGVIRESNSPYASPIVLARKKDGSLRMCVDYRQLNSKTRRDAFPLPRIDESLDALSGARWFTTLDLASGYNQVPVTEGDRAKTAFCIPFGLFEWNRMPFGLCNAPGTFQRLMQRIFGDQQCQSVLLYLDDIVVFSSTIDEHLERLELVLGRLQQEKLRVKLPKCAFFQQEVRYLGHVISDQGVSTDPHKIEAVAGWQPPSTVSELRTFLGFASYYRRFVEGFA 561          
BLAST of Pol polyprotein vs. Ensembl Medaka
Match: ENSORLT00000039099.1 (pep primary_assembly:ASM223467v1:16:31928608:31932747:-1 gene:ENSORLG00000023909.1 transcript:ENSORLT00000039099.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 155.606 bits (392), Expect = 9.709e-38
Identity = 84/270 (31.11%), Postives = 148/270 (54.81%), Query Frame = 1
Query: 2734 EKTIKCTT--EHAI-ITNGNPFHAKVRQLDNSKLNITKQIFNDLLENKIMQHSNSKWSSALMFKEKPNNEWRACGDYRILNNITIPDKYPILIKNDVINSIYNPIFFSKVDL*KAYHQTPVREEDIKKTEIITPIGLFEYNRMPFALKNAAVTFQRFTDRIL--RNNKNTIVYLNDILIASSSRPEHLQNIRDELETLNKHN*KINFKKCEFLKHEFKFLRHLLNENGTRPLENKFKAIKEFPXXXXXXXXXXFLGMINLYHKHIPKYSE 3528
            E  + CT+   H I + +  P   + R++  S     K+  N+LL++++++ S+S ++S ++   K +   R C DYR LN+ T  D +P+    + ++++    +FS +DL   YHQ  V E D  KT   TP GLFE+NRMPF L NA  TFQR   R+   +  ++ ++YL+DI++ SS+  +HL+ +   LE L     K+   KC F +H+  +L H++++ G      K +A+  +    T  +LR F+G  + Y + +  +++
Sbjct:  327 EGDLGCTSLITHEIPLVDDAPVRQRYRRIPPSDYVAAKEHINNLLQSQVIRESSSPFASPIVLIRKKDGGLRLCVDYRQLNSRTRKDAFPLPRIEESLDALSGARWFSTLDLASGYHQVAVAEADRPKTAFCTPFGLFEWNRMPFGLCNAPSTFQRLMQRMFGEQQGQSLLLYLDDIIVFSSTIEQHLERLELVLERLQLEGLKVKLAKCAFFQHQVHYLGHVISDQGVSTDPGKVEAVANWEPPTTVFQLRSFIGFASYYRRFVEGFAK 596          
BLAST of Pol polyprotein vs. Ensembl Medaka
Match: ENSORLT00000029819.1 (pep primary_assembly:ASM223467v1:24:6358775:6362914:-1 gene:ENSORLG00000022361.1 transcript:ENSORLT00000029819.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 155.606 bits (392), Expect = 9.875e-38
Identity = 84/270 (31.11%), Postives = 148/270 (54.81%), Query Frame = 1
Query: 2734 EKTIKCTT--EHAI-ITNGNPFHAKVRQLDNSKLNITKQIFNDLLENKIMQHSNSKWSSALMFKEKPNNEWRACGDYRILNNITIPDKYPILIKNDVINSIYNPIFFSKVDL*KAYHQTPVREEDIKKTEIITPIGLFEYNRMPFALKNAAVTFQRFTDRIL--RNNKNTIVYLNDILIASSSRPEHLQNIRDELETLNKHN*KINFKKCEFLKHEFKFLRHLLNENGTRPLENKFKAIKEFPXXXXXXXXXXFLGMINLYHKHIPKYSE 3528
            E  + CT+   H I + +  P   + R++  S     K+  N+LL++++++ S+S ++S ++   K +   R C DYR LN+ T  D +P+    + ++++    +FS +DL   YHQ  V E D  KT   TP GLFE+NRMPF L NA  TFQR   R+   +  ++ ++YL+DI++ SS+  +HL+ +   LE L     K+   KC F +H+  +L H++++ G      K +A+  +    T  +LR F+G  + Y + +  +++
Sbjct:  327 EGDLGCTSLITHEIPLVDDAPVRQRYRRIPPSDYVAAKEHINNLLQSQVIRESSSPFASPIVLIRKKDGGLRLCVDYRQLNSRTRKDAFPLPRIEESLDALSGARWFSTLDLASGYHQVAVAEADRPKTAFCTPFGLFEWNRMPFGLCNAPSTFQRLMQRMFGEQQGQSLLLYLDDIIVFSSTIEQHLERLELVLERLQLEGLKVKLAKCAFFQHQVHYLGHVISDQGVSTDPGKVEAVANWEPPTTVFQLRSFIGFASYYRRFVEGFAK 596          
BLAST of Pol polyprotein vs. Planmine SMEST
Match: SMESG000074961.1 (SMESG000074961.1)

HSP 1 Score: 536.184 bits (1380), Expect = 0.000e+0
Identity = 281/288 (97.57%), Postives = 285/288 (98.96%), Query Frame = 1
Query: 2197 MTAPTYGDSETFTVQSKNTTYLVDTGSIVSLLPSYRFINLNEENFKLFTANCSSIKTYGKQPLIININNTNYSWDFIIADIKQAILGSDFLSDYNFLVDCRNKRILQXXXXXXXXXXXXXXXXXSKHQRNCFIGVITVLNIHKQYKNTEDNHTKLINTIPKEIKEILEIYPTVTNKLSVEKTIKCTTEHAIITNGNPFHAKVRQLDNSKLNITKQIFNDLLENKIMQHSNSKWSSALMFKEKPNNEWRACGDYRILNNITIPDKYPILIKNDVINSIYNPIFFSKVDL 3060
            MTAPTYGDSETFTVQSKNTTYLVDTGSIVSLLPSYRFINLNEENFKLFTANCSSIKTYGKQPLIININNTNYSWDFIIAD+KQAILG+DFLSDYNFLVDCRNKRILQTNN+NTTNENTKANYNNSKHQR C IGVITVLNIHKQYKNTEDN+TKLINTIPKEIKEILEIYPTVTNKLSVEKTIKCTTEHAIITNGNPFHAKVRQLDNSKLNITKQIFNDLLENKIMQHSNSKWSSALMFKEKPNNEWRACGDYRILNNITIPDKYPILIKNDVIN IYNPIFFSKVDL
Sbjct:    1 MTAPTYGDSETFTVQSKNTTYLVDTGSIVSLLPSYRFINLNEENFKLFTANCSSIKTYGKQPLIININNTNYSWDFIIADVKQAILGADFLSDYNFLVDCRNKRILQTNNDNTTNENTKANYNNSKHQRTCDIGVITVLNIHKQYKNTEDNNTKLINTIPKEIKEILEIYPTVTNKLSVEKTIKCTTEHAIITNGNPFHAKVRQLDNSKLNITKQIFNDLLENKIMQHSNSKWSSALMFKEKPNNEWRACGDYRILNNITIPDKYPILIKNDVINKIYNPIFFSKVDL 288          
BLAST of Pol polyprotein vs. Planmine SMEST
Match: SMESG000037879.1 (SMESG000037879.1)

HSP 1 Score: 167.933 bits (424), Expect = 2.200e-45
Identity = 95/248 (38.31%), Postives = 143/248 (57.66%), Query Frame = 1
Query: 2785 PFHAKVRQLDNSKLNITKQIFNDLLENKIMQHSNSKWSSALMFKEKPNNEWRACGDYRILNNITIPDKYPILIKNDVINSIYNPIFFSKVDL*KAYHQTPVREEDIKKTEIITPIGLFEYNRMPFALKNAAVTFQRFTDRILRNNKNTIVYLNDILIASSSRPEHLQNIRDELETLNKHN*KINFKKCEFLKHEFKFLRHLLNENGTRPLENKFKAIKEFPXXXXXXXXXXFLGMINLYHKHIPKYSE 3528
            P  +K+R L N KL+  +  F++LL N   + S S  SS L    K +  +R C D R LN IT+ D Y + + +++++ +     F  +DL KAYHQ PVRE DI+KT ++TPIG+FEY  MPF L+N+  TF+R+  ++L +    + Y++DILI S     H  ++ + L  L ++  KIN     F K E +F  HL++  GTRP  ++   I  FPL KT  + R FLG +N  ++ IP  S+
Sbjct:   85 PVRSKLRPLSNEKLDFVQSEFSNLLNNDTTRRSKSPLSSPLNLFTKKDGTFRPCADCRNLNAITVHDSYSMPLVSNILHRLSKAKTFLTIDLVKAYHQIPVRESDIEKTAVLTPIGMFEYVFMPFGLRNSVQTFKRYIHQVLMDLPFAVPYMDDILIRSPEMDTHKIHLTETLNELQQNCLKINVNNWIFFKQEVRFHGHLISRKGTRP-PDRLDTISNFPLSKTVSQQRSFLGTLNYCYRFIPGVSD 331          
BLAST of Pol polyprotein vs. Planmine SMEST
Match: SMESG000060384.1 (SMESG000060384.1)

HSP 1 Score: 114.775 bits (286), Expect = 1.411e-38
Identity = 60/76 (78.95%), Postives = 67/76 (88.16%), Query Frame = 3
Query: 1839 ENKGENGHELENPNIETNKLLSTLIKKFDEVLK*NKNLRNDIQTLQMKETMRSQYTQDNSNRFTRQRSNYRS*YKP 2066
            ENKG+N HELE+ NIETNKLL+TLIKKFDE L  NKNLRNDIQTLQMKET+R+QYTQDN NR+TRQRSN  + YKP
Sbjct:   49 ENKGDNSHELESSNIETNKLLNTLIKKFDEALIENKNLRNDIQTLQMKETIRNQYTQDNRNRYTRQRSNSGNRYKP 124          

HSP 2 Score: 66.6254 bits (161), Expect = 1.411e-38
Identity = 32/43 (74.42%), Postives = 36/43 (83.72%), Query Frame = 2
Query: 1715 RPVPPEIRRILAANNSKDLYSIADIANRINDEIFPTICKTYGK 1843
            R +PPEIRRILAANN  DL +IADI ++IN EIFPTICKTY K
Sbjct:    2 RAMPPEIRRILAANNCTDLDTIADIGDKINYEIFPTICKTYKK 44          
BLAST of Pol polyprotein vs. Planmine SMEST
Match: SMESG000080881.1 (SMESG000080881.1)

HSP 1 Score: 144.05 bits (362), Expect = 4.541e-34
Identity = 98/302 (32.45%), Postives = 163/302 (53.97%), Query Frame = 1
Query: 2623 KQYKNTEDNHTKLINTIPKEIKEILEIYPTVTNKLSVEKTIKCTTEHAI-ITNGNPFHAKVRQLDNSKLNITKQIFNDLLENKIMQHSNSKWSSALMFKEKPNNEWRACGDYRILNNITIPDKYPILIKNDVINSIYNPIFFSKVDL*KAYHQTPVREEDIKKTEIITPIGLFEYNRMPFALKNAAVTFQRFTDRILRNNKNTIVYLNDILIASSSRPEHLQNIRDELETLNKHN*KINFKKCEFLKHEFKFLRHLLNENGTRPLENKFKAIKEFPXXXXXXXXXXFLGMINLYHKHIPKYS 3525
            K YK  +     L  +   E  E+L+ Y  V  K   +  +    EH I + +  P   K  ++       + +    + E KI++ S+S +SS++   +K + + R C DYR LN +T  D YPI +  ++ + +    FF+ +DL K Y+Q  V+EED +KT      GL+E+N +PF L  A  TFQR  + +LR+  + +VY++DI+I S++  EHL+++      L K N KI   KCE+ K E  ++ H+++ NG +P     K IKE+P+ +   ++R+FLG+ + Y K I  +S
Sbjct: 3328 KIYKQPQVISNDLTESQKWEFTELLKKYKMVFAKHEYDLGLTQVIEHEIPLLDETPIKLKPYRIPYIHQEESDRQIKAMKEFKIIRDSSSPFSSSIAVVKKKDGDLRFCVDYRKLNQVTRKDTYPIPVPQEMFDQMGEVQFFTVIDLNKGYNQFKVKEEDRRKTAFSDGKGLYEFNVLPFGLTGAPATFQRGMNFVLRDIPHALVYIDDIIIFSNTFKEHLKDVETVFRRLLKANLKIKPSKCEWGKSEVVYVGHIISRNGLQPNPENVKKIKEYPIPENVDQVRQFLGLASYYRKFIKSFS 3629          
BLAST of Pol polyprotein vs. Planmine SMEST
Match: SMESG000011773.1 (SMESG000011773.1)

HSP 1 Score: 135.576 bits (340), Expect = 1.590e-33
Identity = 73/204 (35.78%), Postives = 114/204 (55.88%), Query Frame = 1
Query: 2704 YPTVTNKLSVEKTIKCTTEHAIITN-GNPFHAKVRQLDNSKLNITKQIFNDLLENKIMQHSNSKWSSALMFKEKPNNEWRACGDYRILNNITIPDKYPILIKNDVINSIYNPIFFSKVDL*KAYHQTPVREEDIKKTEIITPIGLFEYNRMPFALKNAAVTFQRFTDRILRNNKNTIVYLNDILIASSSRPEHLQNIRDELETL 3312
            +P+   K    + I+  T+H I T    P     R+L   +    ++ F  L +  I++ S+S W++ +    K +   R CGDYR +N ITIPD YP+ + +D++        FS +DL KAYHQ  +  E I KT +ITP  LFEY  MP  L+NA+ TFQR  D +L+  ++T+ Y++DI++AS    EH +++ +   TL
Sbjct:  194 FPSTIFKNLTPQNIQNETKHVIATTPCAPIRHHQRELAQDRSIAAEKEFLQLEKQDIIRRSSSPWAAPIQIITKKDGSLRICGDYRSVNKITIPDSYPMPLISDILQRFSGCSIFSSLDLAKAYHQIQIEPESIPKTAVITPFCLFEYTFMPLGLRNASQTFQRHIDTVLQGLQHTVAYVDDIIVASPYIEEHKKDLCETYLTL 397          
The following BLAST results are available for this feature:
BLAST of Pol polyprotein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pol polyprotein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pol polyprotein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pol polyprotein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BX511082.12.122e-3631.44pep chromosome:GRCz11:9:14291932:14297132:1 gene:E... [more]
CR855320.18.958e-3631.16pep chromosome:GRCz11:1:7956030:7961696:1 gene:ENS... [more]
BX546500.16.882e-3530.14pep chromosome:GRCz11:23:12926092:12931693:-1 gene... [more]
BX511224.11.074e-3430.14pep chromosome:GRCz11:2:18017000:18022765:1 gene:E... [more]
CR925755.21.034e-3330.31pep chromosome:GRCz11:17:42486740:42492668:-1 gene... [more]
back to top
BLAST of Pol polyprotein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
alkbh58.000e-3527.99alkB homolog 5, RNA demethylase [Source:Xenbase;Ac... [more]
ENSXETT00000006041.11.993e-3430.92pep primary_assembly:Xenopus_tropicalis_v9.1:6:373... [more]
anxa69.452e-3328.96annexin A6 [Source:Xenbase;Acc:XB-GENE-989741][more]
ENSXETT00000035398.14.223e-2831.33pep primary_assembly:Xenopus_tropicalis_v9.1:3:986... [more]
denr7.767e-2831.33density-regulated protein [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Pol polyprotein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pol polyprotein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P20825|POL2_DROME1.125e-3935.96Retrovirus-related Pol polyprotein from transposon... [more]
sp|P04323|POL3_DROME3.156e-3936.84Retrovirus-related Pol polyprotein from transposon... [more]
sp|Q8I7P9|POL5_DROME2.726e-3733.99Retrovirus-related Pol polyprotein from transposon... [more]
sp|Q99315|YG31B_YEAST1.939e-3637.75Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomy... [more]
sp|Q7LHG5|YI31B_YEAST2.091e-3637.75Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomy... [more]
back to top
BLAST of Pol polyprotein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2G8KPC58.599e-8236.79Gag-pol polyprotein OS=Stichopus japonicus OX=3079... [more]
A0A5S6QAW02.791e-8036.84Uncharacterized protein OS=Trichuris muris OX=7041... [more]
A0A147BLP16.869e-8038.86Putative pol polyprotein (Fragment) OS=Ixodes rici... [more]
A0A293MAR49.288e-8035.38Integrase core domain protein (Fragment) OS=Ornith... [more]
A0A2G8KJT69.918e-7936.34Uncharacterized protein (Fragment) OS=Stichopus ja... [more]
back to top
BLAST of Pol polyprotein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000030217.12.952e-4334.60pep primary_assembly:Astyanax_mexicanus-2.0:16:123... [more]
ENSAMXT00000041682.11.830e-4134.27pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000041345.19.525e-4127.21pep primary_assembly:Astyanax_mexicanus-2.0:25:323... [more]
ENSAMXT00000045469.14.292e-4033.08pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000041754.11.450e-3932.22pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Pol polyprotein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pol polyprotein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pol polyprotein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pol polyprotein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000040051.13.566e-4929.53pep primary_assembly:ASM223467v1:1:37354481:373592... [more]
ENSORLT00000032171.11.141e-3830.98pep primary_assembly:ASM223467v1:18:2114932:211795... [more]
ENSORLT00000041674.18.216e-3830.64pep primary_assembly:ASM223467v1:5:30088905:300929... [more]
ENSORLT00000039099.19.709e-3831.11pep primary_assembly:ASM223467v1:16:31928608:31932... [more]
ENSORLT00000029819.19.875e-3831.11pep primary_assembly:ASM223467v1:24:6358775:636291... [more]
back to top
BLAST of Pol polyprotein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074961.10.000e+097.57SMESG000074961.1[more]
SMESG000037879.12.200e-4538.31SMESG000037879.1[more]
SMESG000060384.11.411e-3878.95SMESG000060384.1[more]
SMESG000080881.14.541e-3432.45SMESG000080881.1[more]
SMESG000011773.11.590e-3335.78SMESG000011773.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029112 ID=SMED30029112|Name=Pol polyprotein|organism=Schmidtea mediterranea sexual|type=transcript|length=3885bp
TTAATATTACGTGTGAATAACGCAACGCTCAAATAAAAATGTAATATTTG
GTCATAAAAAGAATTCCAATTATTAAGTACGAAATGAAAATAAATTTTCT
AACTTAATATTGCAAATACAGCTTTAAGAACCGATTTTCAGCTTAATAAA
GCGAACCTACCAAATTGGCTGATTTGTTCTGCTGTACTTAGGTGTTGTTT
TTCACTAATTCAGTTTTAATAAAAAAAATAACAATCGTTACTCAAGCTTC
ATAGTAAGCTTCACAGGGTCAATAAATCAACATGACAGATTTAGCAAATA
AATAAGAGAATTGCTAGTATAATAGAGTGCATATTTGGAACTGATATCAG
TTTGTCTTTAATGAGTGATACCACCCTTTTGGATGATAGGTAAAATGTTG
TTTGAAATAGACTCCAAATAGTATAACCAACAAAATTAAGGATTACCCAT
GTATTGATTAATAATCAGGTTTTTCATGTTTTATAAATTTATTATTTATG
GTCTGAATATAAAAATAATTTTTCAATAATATTATTCTATGGTAAATATA
TTTAAGATGAACAGTTTAACACGTTAACTGACACGAAACGTAAACTTCTT
GTAATATGTGAGTTATATTTACCTCGCGTTATAGTCAACGTGTTAAGGAT
AATTGCAGTAGCTCAGTTATATTGTATTTGATTCATGTATTTGATTCAGC
TGATAAATAATATTTTTCGTTACATGCATTTGAAATATAAGTTATAATTT
AAGCATATTTATAAAAATATATTTTATCAAAATTAGCTTATTATTTCTGG
TATACAAATAGACTTTATCACAAGTGATCTAATAATTATTGATTTCAAAT
TTCCTCCAAGCCTCACTGGTTTGGTATCCACCATTATTCTAAAATTATTG
TATTTTAATTTTGTGTAATATTTGTAAATAATTTTTAAATTAATAATTAT
ATTTTAAGCATTTATATCATCATTTTTTACATAATACTAGATATCACATT
GGTCTAAAATATCCATCCACCCCAGCTGTCCTGATACAGGTTTTTGACAG
GTGACGCTGCTGGACACTGACTTTTCCTCCACACACATATTCAGTTATCT
TCATTAATATAAGTTCCTAAATTAACAATAACAACTGGTATCAGAAGTCA
AAAACAACAAATATTCGCGAAAACATTTTTTTTCAATCTCTACGCCTTTC
AGAATATCTATTATAGAGGTATTGAGGATCGAAACACTTTTGACCGAACA
CAGTAGGTCCTTTGACACAAACTCGATTTTTTATCTACAGAAAAAAAACA
AATAAAACCAAATGGCGTCAAACAATAGCAAAAAAATGTAAACAACATCA
ACTCTATCATCAACCCAAAGATAAATATCCAAAATTTTTTTACTGATGAA
AATGGCACACCGCAAAAATGGTTGGAGTTTACGAAACTCACTATGACACT
ATCAGGCATAAAGTCGTCAAAACCAATATCCTCTTTATTCAGCTGACAGA
ATAGACGAAATATCAAAAGTCGATTTCCTTTTTGAAATGTTATATACAAC
TTAATAAATATAAATAAGGTAAACAGAAGAGAAATACTCGAATTCTGCTT
AAAAGACATACAACTATGTAATGATAAACCAAGCGAATTTCTATGGAATT
TGAATATTTAAAACCCAAAATAACAAGCAAGGGTTCAAAGGAATTCGTAA
AAGATCTATTCTGAAGGCCAGTGCCACCAGAAATAAGACGCATTTTAGCT
GCAAACAACTCAAAAGACCTATACTCGATAGCGGATATCGCCAACAGAAT
AAACGATGAAATATTTCCAACAATCTGTAAGACTTACGGAAAATAAAGGT
GAAAATGGCCATGAATTGGAAAACCCCAACATCGAAACCAACAAACTATT
AAGTACATTAATAAAGAAATTTGACGAAGTCCTAAAATAGAACAAGAATC
TCAGAAATGACATACAGACCTTACAAATGAAGGAAACAATGAGAAGTCAA
TATACTCAAGACAATTCGAACCGATTTACTAGACAAAGATCAAATTATAG
AAGTTGATACAAACCACAAAACAGAAATTACAATAACAAAAACCAAAGCT
GGTGTTGCTTCCATAATAGATTGGGAGACAACGCTTTCAAAGGCAACGAA
CCTTGCTCTTACAACAAAAACAATAAACAAACGATTAAAGCCGCCAATGA
CAGCGCCAACTTATGGCGACAGTGAAACCTTTACGGTGCAAAGCAAAAAC
ACAACATATCTCGTAGATACTGGTTCTATAGTCAGTTTATTACCAAGTTA
TCGGTTCATAAACCTAAACGAAGAGAATTTCAAACTTTTCACAGCAAATT
GTAGCAGCATCAAAACATATGGCAAACAGCCCCTCATAATTAACATTAAC
AACACTAATTACAGTTGGGATTTCATAATCGCCGACATAAAACAAGCGAT
TCTAGGCTCAGATTTCCTGTCAGACTATAACTTCTTGGTCGACTGTAGAA
ACAAAAGAATACTGCAAACTAACAACAACAATACTACAAATGAAAATACA
AAAGCAAATTACAACAATTCAAAACATCAAAGAAACTGTTTCATCGGAGT
AATAACCGTTCTCAACATCCATAAACAATATAAAAATACAGAAGACAATC
ACACAAAACTGATAAACACAATACCCAAGGAAATTAAAGAAATACTAGAA
ATTTACCCAACAGTTACAAACAAACTCTCTGTGGAAAAGACAATTAAATG
CACAACTGAACATGCAATCATAACAAATGGAAATCCATTTCACGCAAAGG
TCAGACAACTGGACAACAGTAAACTAAACATAACAAAACAAATATTCAAC
GACCTTCTAGAAAACAAAATAATGCAACACTCCAACTCAAAATGGTCATC
CGCACTGATGTTTAAAGAAAAACCGAATAACGAATGGAGAGCATGCGGAG
ATTACAGAATACTCAACAACATTACAATACCCGACAAATACCCTATACTA
ATAAAAAACGACGTCATCAACAGCATTTATAACCCAATATTCTTCAGCAA
AGTCGACCTATAAAAAGCATACCATCAAACCCCAGTACGAGAAGAAGATA
TCAAAAAGACAGAAATAATAACACCAATCGGGTTATTCGAATACAACAGA
ATGCCGTTTGCACTGAAAAACGCAGCGGTTACATTTCAAAGGTTTACGGA
CCGAATATTACGAAACAACAAAAACACTATAGTTTATTTGAACGACATCT
TAATCGCGTCATCAAGCAGACCTGAACATTTACAAAACATTAGAGACGAA
CTAGAAACTCTCAATAAACACAACTGAAAAATAAACTTTAAAAAATGCGA
ATTTTTAAAACACGAATTCAAGTTTCTTAGACATCTCCTAAACGAAAATG
GAACAAGACCTTTAGAAAACAAATTTAAAGCAATCAAAGAATTCCCTTTA
CTGAAAACAACAAGGAAACTAAGACGTTTCCTAGGGATGATAAACCTCTA
CCACAAACACATCCCAAAATACAGTGAAAGCTAGCGACATTAAATAAACT
GAACAAAATCAAACGAAACGTGAAAATAAATTGGAACAAAAACTTAGAAA
TAGCTTTCGAGGAAGCTAAAACAAAAGCCACTTCGCACTCATGCATACAA
AAGTGTCATGGCCAAACATGAGAAAAGACGTCCAAAATTTTGTCAACTTA
TGTGTAAACTGCCAGAAAAATAAAATCACAAAAAAATTCAAAATCACAAA
AGTAAAATTCCCCTTAACTGAACCTTTCGAAACAATCCACATCAATATAG
TGGGTCCGCTACCTCCCTACAACAAAAACAAATACTTGCTCACAATTATA
TACCGCAACACAACTATTTGACTTTTGTATTCTGG
back to top

protein sequence of SMED30029112-orf-1

>SMED30029112-orf-1 ID=SMED30029112-orf-1|Name=SMED30029112-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=289bp
MTAPTYGDSETFTVQSKNTTYLVDTGSIVSLLPSYRFINLNEENFKLFTA
NCSSIKTYGKQPLIININNTNYSWDFIIADIKQAILGSDFLSDYNFLVDC
RNKRILQTNNNNTTNENTKANYNNSKHQRNCFIGVITVLNIHKQYKNTED
NHTKLINTIPKEIKEILEIYPTVTNKLSVEKTIKCTTEHAIITNGNPFHA
KVRQLDNSKLNITKQIFNDLLENKIMQHSNSKWSSALMFKEKPNNEWRAC
GDYRILNNITIPDKYPILIKNDVINSIYNPIFFSKVDL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000477RT_dom
IPR021109Peptidase_aspartic_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0004190aspartic-type endopeptidase activity
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
GO:0015074DNA integration