Glutamine synthetase

Overview
NameGlutamine synthetase
Smed IDSMED30029103
Length (bp)1624
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glutamine synthetase (SMED30029103) t-SNE clustered cells

Violin plots show distribution of expression levels for Glutamine synthetase (SMED30029103) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glutamine synthetase (SMED30029103) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glutamine synthetase (SMED30029103) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029103

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30029103SMESG000017252.1 SMESG000017249.1 Contig3804GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30029103SMESG000000228.1 SMESG000000212.1 PL05011A1F07ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30029103SMESG000000227.1 SMESG000000212.1 SMESG000000228.1 Contig3804GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30029103SMESG000000228.1 SMESG000000227.1 SMESG000000225.1 SMESG000000212.1 dd_Smed_v4_896_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029103SMESG000000228.1 SMESG000000227.1 SMESG000000225.1 SMESG000000212.1 dd_Smed_v4_896_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30029103SMESG000000228.1 SMESG000000227.1 SMESG000000225.1 SMESG000000212.1 dd_Smed_v4_896_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30029103SMESG000000228.1 SMESG000000227.1 SMESG000000225.1 SMESG000000212.1 dd_Smed_v4_896_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029103SMESG000061124.1 SMESG000047334.1 SMESG000039493.1 SMESG000036749.1 SMESG000026738.1 SMESG000000228.1 SMESG000000212.1 Contig9438newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029103SMESG000061124.1 SMESG000047334.1 SMESG000039493.1 SMESG000036749.1 SMESG000026738.1 SMESG000000228.1 SMESG000000212.1 Contig9438uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 3 cellSMED30029103SMESG000000228.1 SMESG000000227.1 SMESG000000225.1 SMESG000000212.1 dd_Smed_v6_896_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029103SMESG000000228.1 SMESG000000227.1 SMESG000000225.1 SMESG000000212.1 dd_Smed_v4_896_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029103SMESG000000228.1 SMESG000000212.1 SMED_00099_V2_1rGPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30029103SMESG000000228.1 SMESG000000212.1 SMED_00099_V2_1rGPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30029103SMESG000000228.1 SMESG000000227.1 SMESG000000225.1 SMESG000000212.1 SMED_00099_V2_1rGPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30029103SMESG000000228.1 SMESG000000227.1 SMESG000000225.1 SMESG000000212.1 SMED_00099_V2_1rGPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glutamine synthetase vs. Ensembl Human
Match: GLUL (glutamate-ammonia ligase [Source:HGNC Symbol;Acc:HGNC:4341])

HSP 1 Score: 513.842 bits (1322), Expect = 1.636e-180
Identity = 233/361 (64.54%), Postives = 287/361 (79.50%), Query Frame = 2
Query:  371 NKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE*NEHDF 1453
            NK +   Y++LPQ E V Q MY+WIDGTGE LR KT+T+D  P    +LP WNFDGSST QSEGSNSD+Y+ P A+F DPFR+  NK+ LCE + Y++ P E+NLR++C  +M  V + HPWFG+EQEYT++  D +PF WP  GFPG QGPYYCG GA++ +GRDIVEAHYRAC+YAG+KIAGTNAEVMPAQWEFQ+GPCEGI +GD LW+AR+ILHRV EDFGV+ TFDPKPIPG+WNGAG HTN+ST  MR   G+ YIEEAIEK+SK+H  HI+AYDP  G DN RRLTG HETS+I+DFS+GVANR ASIRIPR V ++  GY EDRRPS+NCDP+SV + +++T +L+E  +  F
Sbjct:   10 NKGIKQVYMSLPQGEKV-QAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPF 369          
BLAST of Glutamine synthetase vs. Ensembl Human
Match: GLUL (glutamate-ammonia ligase [Source:HGNC Symbol;Acc:HGNC:4341])

HSP 1 Score: 513.842 bits (1322), Expect = 1.636e-180
Identity = 233/361 (64.54%), Postives = 287/361 (79.50%), Query Frame = 2
Query:  371 NKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE*NEHDF 1453
            NK +   Y++LPQ E V Q MY+WIDGTGE LR KT+T+D  P    +LP WNFDGSST QSEGSNSD+Y+ P A+F DPFR+  NK+ LCE + Y++ P E+NLR++C  +M  V + HPWFG+EQEYT++  D +PF WP  GFPG QGPYYCG GA++ +GRDIVEAHYRAC+YAG+KIAGTNAEVMPAQWEFQ+GPCEGI +GD LW+AR+ILHRV EDFGV+ TFDPKPIPG+WNGAG HTN+ST  MR   G+ YIEEAIEK+SK+H  HI+AYDP  G DN RRLTG HETS+I+DFS+GVANR ASIRIPR V ++  GY EDRRPS+NCDP+SV + +++T +L+E  +  F
Sbjct:   10 NKGIKQVYMSLPQGEKV-QAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPF 369          
BLAST of Glutamine synthetase vs. Ensembl Human
Match: GLUL (glutamate-ammonia ligase [Source:HGNC Symbol;Acc:HGNC:4341])

HSP 1 Score: 513.842 bits (1322), Expect = 1.636e-180
Identity = 233/361 (64.54%), Postives = 287/361 (79.50%), Query Frame = 2
Query:  371 NKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE*NEHDF 1453
            NK +   Y++LPQ E V Q MY+WIDGTGE LR KT+T+D  P    +LP WNFDGSST QSEGSNSD+Y+ P A+F DPFR+  NK+ LCE + Y++ P E+NLR++C  +M  V + HPWFG+EQEYT++  D +PF WP  GFPG QGPYYCG GA++ +GRDIVEAHYRAC+YAG+KIAGTNAEVMPAQWEFQ+GPCEGI +GD LW+AR+ILHRV EDFGV+ TFDPKPIPG+WNGAG HTN+ST  MR   G+ YIEEAIEK+SK+H  HI+AYDP  G DN RRLTG HETS+I+DFS+GVANR ASIRIPR V ++  GY EDRRPS+NCDP+SV + +++T +L+E  +  F
Sbjct:   10 NKGIKQVYMSLPQGEKV-QAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPF 369          
BLAST of Glutamine synthetase vs. Ensembl Human
Match: GLUL (glutamate-ammonia ligase [Source:HGNC Symbol;Acc:HGNC:4341])

HSP 1 Score: 513.842 bits (1322), Expect = 1.636e-180
Identity = 233/361 (64.54%), Postives = 287/361 (79.50%), Query Frame = 2
Query:  371 NKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE*NEHDF 1453
            NK +   Y++LPQ E V Q MY+WIDGTGE LR KT+T+D  P    +LP WNFDGSST QSEGSNSD+Y+ P A+F DPFR+  NK+ LCE + Y++ P E+NLR++C  +M  V + HPWFG+EQEYT++  D +PF WP  GFPG QGPYYCG GA++ +GRDIVEAHYRAC+YAG+KIAGTNAEVMPAQWEFQ+GPCEGI +GD LW+AR+ILHRV EDFGV+ TFDPKPIPG+WNGAG HTN+ST  MR   G+ YIEEAIEK+SK+H  HI+AYDP  G DN RRLTG HETS+I+DFS+GVANR ASIRIPR V ++  GY EDRRPS+NCDP+SV + +++T +L+E  +  F
Sbjct:   10 NKGIKQVYMSLPQGEKV-QAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPF 369          
BLAST of Glutamine synthetase vs. Ensembl Human
Match: GLUL (glutamate-ammonia ligase [Source:HGNC Symbol;Acc:HGNC:4341])

HSP 1 Score: 516.153 bits (1328), Expect = 1.935e-179
Identity = 233/361 (64.54%), Postives = 287/361 (79.50%), Query Frame = 2
Query:  371 NKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE*NEHDF 1453
            NK +   Y++LPQ E V Q MY+WIDGTGE LR KT+T+D  P    +LP WNFDGSST QSEGSNSD+Y+ P A+F DPFR+  NK+ LCE + Y++ P E+NLR++C  +M  V + HPWFG+EQEYT++  D +PF WP  GFPG QGPYYCG GA++ +GRDIVEAHYRAC+YAG+KIAGTNAEVMPAQWEFQ+GPCEGI +GD LW+AR+ILHRV EDFGV+ TFDPKPIPG+WNGAG HTN+ST  MR   G+ YIEEAIEK+SK+H  HI+AYDP  G DN RRLTG HETS+I+DFS+GVANR ASIRIPR V ++  GY EDRRPS+NCDP+SV + +++T +L+E  +  F
Sbjct:  144 NKGIKQVYMSLPQGEKV-QAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPF 503          
BLAST of Glutamine synthetase vs. Ensembl Celegans
Match: gln-3 (Glutamine synthetase [Source:UniProtKB/TrEMBL;Acc:H8ESF5])

HSP 1 Score: 510.76 bits (1314), Expect = 1.843e-179
Identity = 232/359 (64.62%), Postives = 284/359 (79.11%), Query Frame = 2
Query:  356 AKLRENKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILD 1432
            ++   +K +L K+L L Q + + Q +Y+WIDG+GEN+R KT+T DF P  P +LPIWNFDGSSTGQ+EG++SDVY+ P+A++ DPFR+G NK+ +CETY+  + P  +N R  C EVM+K  D HPWFG+EQEYT+LDID +PF WPK GFPG QGPYYCG GANKV+GRDIVEAHYRAC+YAGI+I+GTNAEVMP QWEFQVGPCEGI +GDQLW+ARY+L RVAE+FGV+ +FD KPI GDWNGAG HTN+ST +MR P GI  I  AI K+S  H +HI  YDPH G DN RRLTG HET+SID FS GVA+R +SIRIPR   +DG GY EDRRPSSNCDPY+V   +V+T  L+
Sbjct:   10 SQFATDKQVLQKFLNLDQ-KGMYQALYIWIDGSGENIRAKTRTFDFEPTDPEKLPIWNFDGSSTGQAEGADSDVYLKPVAIYPDPFRQGKNKLVMCETYDNKKKPTATNYRQRCKEVMEKAADQHPWFGMEQEYTLLDIDGHPFGWPKNGFPGPQGPYYCGVGANKVYGRDIVEAHYRACLYAGIQISGTNAEVMPGQWEFQVGPCEGIQMGDQLWVARYLLQRVAEEFGVIASFDCKPIKGDWNGAGCHTNFSTDKMRNPGGIDEIMSAINKLSLVHPQHIAYYDPHGGKDNERRLTGLHETASIDKFSYGVASRASSIRIPRSTDDDGYGYFEDRRPSSNCDPYTVTGALVRTVCLE 367          
BLAST of Glutamine synthetase vs. Ensembl Celegans
Match: gln-3 (Glutamine synthetase [Source:UniProtKB/TrEMBL;Acc:H8ESF5])

HSP 1 Score: 510.375 bits (1313), Expect = 1.888e-179
Identity = 232/359 (64.62%), Postives = 284/359 (79.11%), Query Frame = 2
Query:  356 AKLRENKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILD 1432
            ++   +K +L K+L L Q + + Q +Y+WIDG+GEN+R KT+T DF P  P +LPIWNFDGSSTGQ+EG++SDVY+ P+A++ DPFR+G NK+ +CETY+  + P  +N R  C EVM+K  D HPWFG+EQEYT+LDID +PF WPK GFPG QGPYYCG GANKV+GRDIVEAHYRAC+YAGI+I+GTNAEVMP QWEFQVGPCEGI +GDQLW+ARY+L RVAE+FGV+ +FD KPI GDWNGAG HTN+ST +MR P GI  I  AI K+S  H +HI  YDPH G DN RRLTG HET+SID FS GVA+R +SIRIPR   +DG GY EDRRPSSNCDPY+V   +V+T  L+
Sbjct:    7 SQFATDKQVLQKFLNLDQ-KGMYQALYIWIDGSGENIRAKTRTFDFEPTDPEKLPIWNFDGSSTGQAEGADSDVYLKPVAIYPDPFRQGKNKLVMCETYDNKKKPTATNYRQRCKEVMEKAADQHPWFGMEQEYTLLDIDGHPFGWPKNGFPGPQGPYYCGVGANKVYGRDIVEAHYRACLYAGIQISGTNAEVMPGQWEFQVGPCEGIQMGDQLWVARYLLQRVAEEFGVIASFDCKPIKGDWNGAGCHTNFSTDKMRNPGGIDEIMSAINKLSLVHPQHIAYYDPHGGKDNERRLTGLHETASIDKFSYGVASRASSIRIPRSTDDDGYGYFEDRRPSSNCDPYTVTGALVRTVCLE 364          
BLAST of Glutamine synthetase vs. Ensembl Celegans
Match: gln-1 (GLutamiNe synthetase (Glutamate-ammonia ligase) [Source:UniProtKB/TrEMBL;Acc:Q95YD1])

HSP 1 Score: 469.929 bits (1208), Expect = 1.892e-163
Identity = 221/364 (60.71%), Postives = 272/364 (74.73%), Query Frame = 2
Query:  359 KLRENKL--LLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGP----QGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILD 1432
            + R N +  L  KY+ L Q  N  QVMY+WID T EN+RGKTKT DF P  PS LPIWNFDG+STGQS G  SDVYI PIAL+ DPFR G NKIALCET  +D  PH +N R  C + M+K +D  PWFG+EQE+T+L  D +P++WP  GFP  QGPYYCG G+++VFGR I+EAHYRAC+YAGIKI+G+N E MP+Q+E+QVGPCEGI++GDQLW++RYILHR+ ED+GVV + DPKP+ G+W+GAG H N+ST  MR P     G   IEEA+ K+SK H  HI  YDPH G DN RRL G ++T ++D FSSGVA+R AS+RIPRQV  D CGY EDRRP+SNCDPY V   +V+T  L+
Sbjct:    9 RARTNNISELNAKYMALDQYNNY-QVMYIWIDATQENMRGKTKTFDFEPKTPSDLPIWNFDGTSTGQSLGEGSDVYIRPIALYRDPFRPGPNKIALCETLTHDNKPHPTNTRQQCVDNMEKAKDQEPWFGMEQEFTLLGADKHPYNWPVNGFPAPQGPYYCGVGSDRVFGRHILEAHYRACMYAGIKISGSNVESMPSQFEYQVGPCEGIEMGDQLWVSRYILHRICEDYGVVCSLDPKPVLGEWSGAGCHLNFSTNVMRTPCEDGTGWKAIEEAVVKLSKVHMHHIAYYDPHGGRDNERRLIGANQTETVDAFSSGVADREASVRIPRQVFADKCGYFEDRRPASNCDPYMVTSAMVKTCCLE 371          
BLAST of Glutamine synthetase vs. Ensembl Celegans
Match: gln-5 (GLutamiNe synthetase (Glutamate-ammonia ligase) [Source:UniProtKB/TrEMBL;Acc:Q9XVU2])

HSP 1 Score: 451.44 bits (1160), Expect = 1.867e-156
Identity = 208/362 (57.46%), Postives = 262/362 (72.38%), Query Frame = 2
Query:  356 AKLRENKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKP--IPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE 1435
             +L   +  ++ ++ LP   +  Q  YVWIDGTGE LR KT+T +  P   S+ PIWN+DGSSTGQ+EG NSD Y+ P+A+F DPF +G N + +CET +    P  +N R +C  +MKKV ++HPWFG+EQEY I+D D +P  WPK G+P  QG YYCG GA++ FGR++VE HYRAC++AGI I GTNAEV P QWEFQ+G CEGID+GDQLWMARYILHRVAE FGV V+ DPKP    GDWNGAG HTN+ST +MR P G+  I EA++ + + H E +  YDP+ G DN RRLTG HETS  D FS G+ANR  SIRIPRQV+++  GYLEDRRPSSNCDPY V   IV++ +L +
Sbjct:    8 TRLPLGQATIDHFMGLPAHPSKCQATYVWIDGTGEQLRAKTRTFNLKPQYLSEYPIWNYDGSSTGQAEGLNSDRYLRPVAVFPDPFLQGHNVLVMCETLDETMKPTATNHRQNCAAIMKKVAEHHPWFGMEQEYLIVDRDEHPLGWPKHGYPAPQGKYYCGVGADRAFGREVVETHYRACLHAGINIFGTNAEVTPGQWEFQIGTCEGIDMGDQLWMARYILHRVAEQFGVCVSLDPKPKVTMGDWNGAGCHTNFSTIEMRRPNGLNAIFEAMKGLERTHSEAMSVYDPNGGRDNLRRLTGRHETSQADKFSWGIANRACSIRIPRQVADETKGYLEDRRPSSNCDPYLVTAMIVKSCLLSD 369          
BLAST of Glutamine synthetase vs. Ensembl Celegans
Match: gln-2 (Probable glutamine synthetase [Source:UniProtKB/Swiss-Prot;Acc:P34497])

HSP 1 Score: 449.899 bits (1156), Expect = 6.157e-156
Identity = 207/353 (58.64%), Postives = 259/353 (73.37%), Query Frame = 2
Query:  380 LLNKYLTL-PQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKP--IPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTIL 1429
            +++++L L P P  + Q  YVWIDGTGENLR KT+T D +P +    PIWN+DGSSTGQ++G +SD Y+ P+A + DPF  G NK+ +C+T ++   P  ++ R +C E+M ++ D  PWFG+EQEY I+D D +P  WPK GFP  QG YYC  GA++ FGR++VE HYRAC++AG+ I GTNAEV P QWEFQ+G CEGID+GDQLWM+RYILHRVAE FGV V+ DPKP    GDWNGAG HTN+STA+MR P GI  IE A+  + + H E ++ YDPH G DN RRLTG HETSS D FS GVANRG SIRIPRQV+ +  GYLEDRRPSSNCDPY V   I Q+ + 
Sbjct:   16 VIDQFLGLRPHPTKI-QATYVWIDGTGENLRSKTRTFDKLPKRIEDYPIWNYDGSSTGQAKGRDSDRYLRPVAAYPDPFLGGGNKLVMCDTLDHQMQPTATSHRQACAEIMHEIRDTRPWFGMEQEYLIVDRDEHPLGWPKHGFPDPQGKYYCSVGADRAFGREVVETHYRACLHAGLNIFGTNAEVTPGQWEFQIGTCEGIDMGDQLWMSRYILHRVAEQFGVCVSLDPKPKVTMGDWNGAGCHTNFSTAEMRAPGGIAAIEAAMTGLKRTHLEAMKVYDPHGGEDNLRRLTGRHETSSADKFSWGVANRGCSIRIPRQVAAERKGYLEDRRPSSNCDPYQVTAMIAQSILF 367          
BLAST of Glutamine synthetase vs. Ensembl Fly
Match: Gs2 (gene:FBgn0001145 transcript:FBtr0073495)

HSP 1 Score: 528.48 bits (1360), Expect = 0.000e+0
Identity = 237/357 (66.39%), Postives = 289/357 (80.95%), Query Frame = 2
Query:  365 RENKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE 1435
            R NK +L++YL+LP  EN+ Q  YVWIDGTGE+LR K +T+DF+P  P +LP+WN+DGSS  Q+EGSNSD Y++P+A++ DPFRRG+N + +C+TY +D  P ++N R +C EV  K     PWFGIEQEYT LD D +P  WPK GFPG QGPYYCG GANKV+ RDIV+AHYRAC+YAGIK++GTNAEVMPAQWEFQVGPCEGI +GD LWMAR++LHR++E+FG+V T DPKP+PGDWNGAGAHTN ST  MR   GI  IE+A+ K+SK H  HI+AYDP QG DN RRLTG HETSSI+DFS+GVANRG SIRIPR V++DG GY EDRRPSSNCDPYSV++ I++T  LDE
Sbjct:   13 RINKTILDRYLSLPLQENIVQATYVWIDGTGEDLRCKDRTLDFIPQSPKELPVWNYDGSSCYQAEGSNSDTYLYPVAIYKDPFRRGNNILVMCDTYKFDGTPTDTNKRKTCLEVANKCAAEEPWFGIEQEYTFLDFDGHPLGWPKNGFPGPQGPYYCGVGANKVYARDIVDAHYRACLYAGIKVSGTNAEVMPAQWEFQVGPCEGISIGDDLWMARFLLHRISEEFGIVSTLDPKPMPGDWNGAGAHTNVSTKAMREDGGIRDIEKAVAKLSKCHERHIRAYDPKQGQDNARRLTGKHETSSINDFSAGVANRGCSIRIPRGVNDDGKGYFEDRRPSSNCDPYSVVEAILRTICLDE 369          
BLAST of Glutamine synthetase vs. Ensembl Fly
Match: Gs2 (gene:FBgn0001145 transcript:FBtr0343562)

HSP 1 Score: 528.48 bits (1360), Expect = 0.000e+0
Identity = 237/357 (66.39%), Postives = 289/357 (80.95%), Query Frame = 2
Query:  365 RENKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE 1435
            R NK +L++YL+LP  EN+ Q  YVWIDGTGE+LR K +T+DF+P  P +LP+WN+DGSS  Q+EGSNSD Y++P+A++ DPFRRG+N + +C+TY +D  P ++N R +C EV  K     PWFGIEQEYT LD D +P  WPK GFPG QGPYYCG GANKV+ RDIV+AHYRAC+YAGIK++GTNAEVMPAQWEFQVGPCEGI +GD LWMAR++LHR++E+FG+V T DPKP+PGDWNGAGAHTN ST  MR   GI  IE+A+ K+SK H  HI+AYDP QG DN RRLTG HETSSI+DFS+GVANRG SIRIPR V++DG GY EDRRPSSNCDPYSV++ I++T  LDE
Sbjct:   13 RINKTILDRYLSLPLQENIVQATYVWIDGTGEDLRCKDRTLDFIPQSPKELPVWNYDGSSCYQAEGSNSDTYLYPVAIYKDPFRRGNNILVMCDTYKFDGTPTDTNKRKTCLEVANKCAAEEPWFGIEQEYTFLDFDGHPLGWPKNGFPGPQGPYYCGVGANKVYARDIVDAHYRACLYAGIKVSGTNAEVMPAQWEFQVGPCEGISIGDDLWMARFLLHRISEEFGIVSTLDPKPMPGDWNGAGAHTNVSTKAMREDGGIRDIEKAVAKLSKCHERHIRAYDPKQGQDNARRLTGKHETSSINDFSAGVANRGCSIRIPRGVNDDGKGYFEDRRPSSNCDPYSVVEAILRTICLDE 369          
BLAST of Glutamine synthetase vs. Ensembl Fly
Match: Gs2 (gene:FBgn0001145 transcript:FBtr0343563)

HSP 1 Score: 528.48 bits (1360), Expect = 0.000e+0
Identity = 237/357 (66.39%), Postives = 289/357 (80.95%), Query Frame = 2
Query:  365 RENKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE 1435
            R NK +L++YL+LP  EN+ Q  YVWIDGTGE+LR K +T+DF+P  P +LP+WN+DGSS  Q+EGSNSD Y++P+A++ DPFRRG+N + +C+TY +D  P ++N R +C EV  K     PWFGIEQEYT LD D +P  WPK GFPG QGPYYCG GANKV+ RDIV+AHYRAC+YAGIK++GTNAEVMPAQWEFQVGPCEGI +GD LWMAR++LHR++E+FG+V T DPKP+PGDWNGAGAHTN ST  MR   GI  IE+A+ K+SK H  HI+AYDP QG DN RRLTG HETSSI+DFS+GVANRG SIRIPR V++DG GY EDRRPSSNCDPYSV++ I++T  LDE
Sbjct:   13 RINKTILDRYLSLPLQENIVQATYVWIDGTGEDLRCKDRTLDFIPQSPKELPVWNYDGSSCYQAEGSNSDTYLYPVAIYKDPFRRGNNILVMCDTYKFDGTPTDTNKRKTCLEVANKCAAEEPWFGIEQEYTFLDFDGHPLGWPKNGFPGPQGPYYCGVGANKVYARDIVDAHYRACLYAGIKVSGTNAEVMPAQWEFQVGPCEGISIGDDLWMARFLLHRISEEFGIVSTLDPKPMPGDWNGAGAHTNVSTKAMREDGGIRDIEKAVAKLSKCHERHIRAYDPKQGQDNARRLTGKHETSSINDFSAGVANRGCSIRIPRGVNDDGKGYFEDRRPSSNCDPYSVVEAILRTICLDE 369          
BLAST of Glutamine synthetase vs. Ensembl Fly
Match: Gs2 (gene:FBgn0001145 transcript:FBtr0343561)

HSP 1 Score: 528.094 bits (1359), Expect = 0.000e+0
Identity = 237/357 (66.39%), Postives = 289/357 (80.95%), Query Frame = 2
Query:  365 RENKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE 1435
            R NK +L++YL+LP  EN+ Q  YVWIDGTGE+LR K +T+DF+P  P +LP+WN+DGSS  Q+EGSNSD Y++P+A++ DPFRRG+N + +C+TY +D  P ++N R +C EV  K     PWFGIEQEYT LD D +P  WPK GFPG QGPYYCG GANKV+ RDIV+AHYRAC+YAGIK++GTNAEVMPAQWEFQVGPCEGI +GD LWMAR++LHR++E+FG+V T DPKP+PGDWNGAGAHTN ST  MR   GI  IE+A+ K+SK H  HI+AYDP QG DN RRLTG HETSSI+DFS+GVANRG SIRIPR V++DG GY EDRRPSSNCDPYSV++ I++T  LDE
Sbjct:   17 RINKTILDRYLSLPLQENIVQATYVWIDGTGEDLRCKDRTLDFIPQSPKELPVWNYDGSSCYQAEGSNSDTYLYPVAIYKDPFRRGNNILVMCDTYKFDGTPTDTNKRKTCLEVANKCAAEEPWFGIEQEYTFLDFDGHPLGWPKNGFPGPQGPYYCGVGANKVYARDIVDAHYRACLYAGIKVSGTNAEVMPAQWEFQVGPCEGISIGDDLWMARFLLHRISEEFGIVSTLDPKPMPGDWNGAGAHTNVSTKAMREDGGIRDIEKAVAKLSKCHERHIRAYDPKQGQDNARRLTGKHETSSINDFSAGVANRGCSIRIPRGVNDDGKGYFEDRRPSSNCDPYSVVEAILRTICLDE 373          
BLAST of Glutamine synthetase vs. Ensembl Fly
Match: Gs2 (gene:FBgn0001145 transcript:FBtr0073494)

HSP 1 Score: 528.094 bits (1359), Expect = 0.000e+0
Identity = 237/357 (66.39%), Postives = 289/357 (80.95%), Query Frame = 2
Query:  365 RENKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE 1435
            R NK +L++YL+LP  EN+ Q  YVWIDGTGE+LR K +T+DF+P  P +LP+WN+DGSS  Q+EGSNSD Y++P+A++ DPFRRG+N + +C+TY +D  P ++N R +C EV  K     PWFGIEQEYT LD D +P  WPK GFPG QGPYYCG GANKV+ RDIV+AHYRAC+YAGIK++GTNAEVMPAQWEFQVGPCEGI +GD LWMAR++LHR++E+FG+V T DPKP+PGDWNGAGAHTN ST  MR   GI  IE+A+ K+SK H  HI+AYDP QG DN RRLTG HETSSI+DFS+GVANRG SIRIPR V++DG GY EDRRPSSNCDPYSV++ I++T  LDE
Sbjct:   13 RINKTILDRYLSLPLQENIVQATYVWIDGTGEDLRCKDRTLDFIPQSPKELPVWNYDGSSCYQAEGSNSDTYLYPVAIYKDPFRRGNNILVMCDTYKFDGTPTDTNKRKTCLEVANKCAAEEPWFGIEQEYTFLDFDGHPLGWPKNGFPGPQGPYYCGVGANKVYARDIVDAHYRACLYAGIKVSGTNAEVMPAQWEFQVGPCEGISIGDDLWMARFLLHRISEEFGIVSTLDPKPMPGDWNGAGAHTNVSTKAMREDGGIRDIEKAVAKLSKCHERHIRAYDPKQGQDNARRLTGKHETSSINDFSAGVANRGCSIRIPRGVNDDGKGYFEDRRPSSNCDPYSVVEAILRTICLDE 369          
BLAST of Glutamine synthetase vs. Ensembl Zebrafish
Match: glulb (glutamate-ammonia ligase (glutamine synthase) b [Source:ZFIN;Acc:ZDB-GENE-030131-8417])

HSP 1 Score: 512.301 bits (1318), Expect = 3.720e-180
Identity = 230/360 (63.89%), Postives = 289/360 (80.28%), Query Frame = 2
Query:  356 AKLRENKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE 1435
            A  + +K +  +Y+ LPQ E V QVMY+WIDGTGE LR KT+T+D  P    +LP WNFDGSST Q+EGSNSD+Y+ P A+F DPFR+  NK+ LC+   Y+  P E+NLR SC ++M  V++ HPWFG+EQEYT+L  D +PF WP  GFPG QGPYYCG GA+K +GRD+VEAHYRAC+YAG+KI GTNAEVMPAQWEFQVGPCEGI++GD LW+AR++LHRV EDFGVV +FDPKPIPG+WNGAG HTN+ST +MR   G+ +IEE+IEK+ K+H  HI+AYDP  G DN RRLTGHHETS+I++FS+GVANRGASIRIPR V ++  GY EDRRPS+NCDPY+V + +++T +L+E
Sbjct:    5 ASSKLSKAMKQQYMDLPQGEKV-QVMYIWIDGTGEGLRCKTRTLDSEPKSVEELPEWNFDGSSTYQAEGSNSDMYLFPQAMFRDPFRKDPNKLVLCDVLKYNHKPAETNLRQSCKKIMDMVQNQHPWFGMEQEYTLLGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDVVEAHYRACLYAGVKICGTNAEVMPAQWEFQVGPCEGIEMGDHLWVARFLLHRVCEDFGVVASFDPKPIPGNWNGAGCHTNFSTKEMREEGGLKHIEESIEKLGKRHQYHIRAYDPKGGLDNARRLTGHHETSNINEFSAGVANRGASIRIPRSVGQEKKGYFEDRRPSANCDPYAVTEALIRTCLLNE 363          
BLAST of Glutamine synthetase vs. Ensembl Zebrafish
Match: glulb (glutamate-ammonia ligase (glutamine synthase) b [Source:ZFIN;Acc:ZDB-GENE-030131-8417])

HSP 1 Score: 512.301 bits (1318), Expect = 3.720e-180
Identity = 230/360 (63.89%), Postives = 289/360 (80.28%), Query Frame = 2
Query:  356 AKLRENKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE 1435
            A  + +K +  +Y+ LPQ E V QVMY+WIDGTGE LR KT+T+D  P    +LP WNFDGSST Q+EGSNSD+Y+ P A+F DPFR+  NK+ LC+   Y+  P E+NLR SC ++M  V++ HPWFG+EQEYT+L  D +PF WP  GFPG QGPYYCG GA+K +GRD+VEAHYRAC+YAG+KI GTNAEVMPAQWEFQVGPCEGI++GD LW+AR++LHRV EDFGVV +FDPKPIPG+WNGAG HTN+ST +MR   G+ +IEE+IEK+ K+H  HI+AYDP  G DN RRLTGHHETS+I++FS+GVANRGASIRIPR V ++  GY EDRRPS+NCDPY+V + +++T +L+E
Sbjct:    5 ASSKLSKAMKQQYMDLPQGEKV-QVMYIWIDGTGEGLRCKTRTLDSEPKSVEELPEWNFDGSSTYQAEGSNSDMYLFPQAMFRDPFRKDPNKLVLCDVLKYNHKPAETNLRQSCKKIMDMVQNQHPWFGMEQEYTLLGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDVVEAHYRACLYAGVKICGTNAEVMPAQWEFQVGPCEGIEMGDHLWVARFLLHRVCEDFGVVASFDPKPIPGNWNGAGCHTNFSTKEMREEGGLKHIEESIEKLGKRHQYHIRAYDPKGGLDNARRLTGHHETSNINEFSAGVANRGASIRIPRSVGQEKKGYFEDRRPSANCDPYAVTEALIRTCLLNE 363          
BLAST of Glutamine synthetase vs. Ensembl Zebrafish
Match: glulb (glutamate-ammonia ligase (glutamine synthase) b [Source:ZFIN;Acc:ZDB-GENE-030131-8417])

HSP 1 Score: 512.301 bits (1318), Expect = 3.720e-180
Identity = 230/360 (63.89%), Postives = 289/360 (80.28%), Query Frame = 2
Query:  356 AKLRENKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE 1435
            A  + +K +  +Y+ LPQ E V QVMY+WIDGTGE LR KT+T+D  P    +LP WNFDGSST Q+EGSNSD+Y+ P A+F DPFR+  NK+ LC+   Y+  P E+NLR SC ++M  V++ HPWFG+EQEYT+L  D +PF WP  GFPG QGPYYCG GA+K +GRD+VEAHYRAC+YAG+KI GTNAEVMPAQWEFQVGPCEGI++GD LW+AR++LHRV EDFGVV +FDPKPIPG+WNGAG HTN+ST +MR   G+ +IEE+IEK+ K+H  HI+AYDP  G DN RRLTGHHETS+I++FS+GVANRGASIRIPR V ++  GY EDRRPS+NCDPY+V + +++T +L+E
Sbjct:    5 ASSKLSKAMKQQYMDLPQGEKV-QVMYIWIDGTGEGLRCKTRTLDSEPKSVEELPEWNFDGSSTYQAEGSNSDMYLFPQAMFRDPFRKDPNKLVLCDVLKYNHKPAETNLRQSCKKIMDMVQNQHPWFGMEQEYTLLGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDVVEAHYRACLYAGVKICGTNAEVMPAQWEFQVGPCEGIEMGDHLWVARFLLHRVCEDFGVVASFDPKPIPGNWNGAGCHTNFSTKEMREEGGLKHIEESIEKLGKRHQYHIRAYDPKGGLDNARRLTGHHETSNINEFSAGVANRGASIRIPRSVGQEKKGYFEDRRPSANCDPYAVTEALIRTCLLNE 363          
BLAST of Glutamine synthetase vs. Ensembl Zebrafish
Match: glulb (glutamate-ammonia ligase (glutamine synthase) b [Source:ZFIN;Acc:ZDB-GENE-030131-8417])

HSP 1 Score: 511.916 bits (1317), Expect = 5.553e-180
Identity = 231/364 (63.46%), Postives = 291/364 (79.95%), Query Frame = 2
Query:  356 AKLRENKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE*NEH 1447
            A  + +K +  +Y+ LPQ E V QVMY+WIDGTGE LR KT+T+D  P    +LP WNFDGSST Q+EGSNSD+Y+ P A+F DPFR+  NK+ LC+   Y+  P E+NLR SC ++M  V++ HPWFG+EQEYT+L  D +PF WP  GFPG QGPYYCG GA+K +GRD+VEAHYRAC+YAG+KI GTNAEVMPAQWEFQVGPCEGI++GD LW+AR++LHRV EDFGVV +FDPKPIPG+WNGAG HTN+ST +MR   G+ +IEE+IEK+ K+H  HI+AYDP  G DN RRLTGHHETS+I++FS+GVANRGASIRIPR V ++  GY EDRRPS+NCDPY+V + +++T +L+E  E+
Sbjct:    5 ASSKLSKAMKQQYMDLPQGEKV-QVMYIWIDGTGEGLRCKTRTLDSEPKSVEELPEWNFDGSSTYQAEGSNSDMYLFPQAMFRDPFRKDPNKLVLCDVLKYNHKPAETNLRQSCKKIMDMVQNQHPWFGMEQEYTLLGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDVVEAHYRACLYAGVKICGTNAEVMPAQWEFQVGPCEGIEMGDHLWVARFLLHRVCEDFGVVASFDPKPIPGNWNGAGCHTNFSTKEMREEGGLKHIEESIEKLGKRHQYHIRAYDPKGGLDNARRLTGHHETSNINEFSAGVANRGASIRIPRSVGQEKKGYFEDRRPSANCDPYAVTEALIRTCLLNEEGEN 367          
BLAST of Glutamine synthetase vs. Ensembl Zebrafish
Match: glula (glutamate-ammonia ligase (glutamine synthase) a [Source:ZFIN;Acc:ZDB-GENE-030131-688])

HSP 1 Score: 496.123 bits (1276), Expect = 8.205e-174
Identity = 228/360 (63.33%), Postives = 281/360 (78.06%), Query Frame = 2
Query:  356 AKLRENKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE 1435
            A  + +K++  +Y+ LPQ + V Q MY+WIDGTGE LR KT+T+D  P     LP WNFDGSST Q+EGSNSD+Y+ P A+F DPFR+  NK+ LCE   Y++   E+N R++C ++M+ V    PWFG+EQEYTIL  D +PF WP  GFPG QGPYYCG GA+K +GRDIVEAHYRAC+YAG+ I GTNAEVMPAQWEFQVGPCEGID+GD LW+AR+ILHRV EDFGVV +FDPKPIPG+WNGAG HTN+ST +MR   G+  IEE IEK+ K+H  HI+ YDP  G DN RRLTGHHETS+I +FS+GVANRGASIRIPR V ++  GY EDRRPS+NCDPY+V + +++T +LDE
Sbjct:    5 ASSQLSKVVKQQYMELPQGDQV-QAMYIWIDGTGEGLRCKTRTLDSEPKSIEDLPEWNFDGSSTYQAEGSNSDMYLIPAAMFRDPFRKDPNKLVLCEVVKYNRKTAETNHRHTCKKIMEMVGHQSPWFGMEQEYTILGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHYRACLYAGVMICGTNAEVMPAQWEFQVGPCEGIDMGDHLWVARFILHRVCEDFGVVASFDPKPIPGNWNGAGCHTNFSTKEMREDGGLKCIEECIEKLGKRHNYHIRTYDPKGGLDNARRLTGHHETSNIHEFSAGVANRGASIRIPRAVGQEKKGYFEDRRPSANCDPYAVTEALIRTCLLDE 363          
BLAST of Glutamine synthetase vs. Ensembl Xenopus
Match: c8a (complement component 8, alpha polypeptide [Source:Xenbase;Acc:XB-GENE-980231])

HSP 1 Score: 503.442 bits (1295), Expect = 1.905e-176
Identity = 227/360 (63.06%), Postives = 286/360 (79.44%), Query Frame = 2
Query:  356 AKLRENKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE 1435
            A  + +K +   YL LPQ + V Q MY+W+DGTGE LR KT+T+D  P     LP WNFDGSST QSEGSNSD+Y+ P+A+F DPFRR  NK+ LCE   Y++   E+NLR++CN++M  + + HPWFG+EQEYT+L +D +PF WP  GFPG QGPYYCG GA+K +GRDIVEAHYRAC+YAG+KIAGTNAEVMPAQWEFQ+GPCEGI++GD LW+AR+ILHR+ EDFG++V+FDPKPI G+WNGAG HTN+ST  MR   G+  IEE+IE++SK+H  HI+ YDP  G DN RRLTG HETSSI +FS+GVANRGASIRIPR V ++  GY EDRRPS+NCDPY+V + +++T +L+E
Sbjct:    5 ASAQLSKAIKQMYLELPQGDKV-QAMYIWVDGTGEGLRCKTRTLDSEPKTIEDLPEWNFDGSSTYQSEGSNSDMYLIPVAMFRDPFRRDPNKLVLCEVLKYNRKTAETNLRHTCNQIMDMMANEHPWFGMEQEYTLLGMDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGIEMGDHLWIARFILHRICEDFGIIVSFDPKPITGNWNGAGCHTNFSTKSMREEGGLKDIEESIERLSKRHDYHIRMYDPRGGKDNARRLTGFHETSSIHEFSAGVANRGASIRIPRSVGQEKKGYFEDRRPSANCDPYAVTEAMIRTCLLNE 363          
BLAST of Glutamine synthetase vs. Ensembl Xenopus
Match: glul (glutamate-ammonia ligase [Source:NCBI gene;Acc:394915])

HSP 1 Score: 498.049 bits (1281), Expect = 2.301e-174
Identity = 229/357 (64.15%), Postives = 284/357 (79.55%), Query Frame = 2
Query:  365 RENKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE 1435
            R NK +  +Y+ LPQ   V QV YVWIDGTGE +R KT+T+D  P    ++P WNFDGSST Q+EGSNSD+Y+ P+ +F DPF    NK+ +CE   Y++   E+NLR++C ++M+ V D+ PWFG+EQEYT+L I+ +P+ WP+ GFPG QGPYYCG GA+KV+GRDIVEAHY+AC+YAGIKI GTNAEVMP+QWEFQVGPCEGID+GD LWMAR+ILHRV EDFGVV T DPKP+ G+WNGAG HTNYST  MR   G+ +IE+AIEK+ K+H  HI  YDP  G DN RRLTG HETSSI +FS+GVANRGASIRIPRQV ++G GY EDRRP++NCDPY+V + +V+TTIL+E
Sbjct:    8 RLNKGVREQYMKLPQGGKV-QVTYVWIDGTGEGVRCKTRTLDQEPKTIDEIPEWNFDGSSTYQAEGSNSDMYLVPVQMFRDPFCLDPNKLVMCEVLKYNRKSAETNLRHTCKKIMEMVTDHRPWFGMEQEYTLLGINGHPYGWPENGFPGPQGPYYCGVGADKVYGRDIVEAHYKACLYAGIKICGTNAEVMPSQWEFQVGPCEGIDMGDHLWMARFILHRVCEDFGVVATLDPKPMTGNWNGAGCHTNYSTESMRVEGGLKHIEDAIEKLGKRHNYHICVYDPRGGKDNSRRLTGQHETSSIHEFSAGVANRGASIRIPRQVGQEGYGYFEDRRPAANCDPYAVTEALVRTTILNE 363          
BLAST of Glutamine synthetase vs. Ensembl Xenopus
Match: glul (glutamate-ammonia ligase [Source:NCBI gene;Acc:394915])

HSP 1 Score: 497.664 bits (1280), Expect = 3.639e-174
Identity = 229/357 (64.15%), Postives = 284/357 (79.55%), Query Frame = 2
Query:  365 RENKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE 1435
            R NK +  +Y+ LPQ   V QV YVWIDGTGE +R KT+T+D  P    ++P WNFDGSST Q+EGSNSD+Y+ P+ +F DPF    NK+ +CE   Y++   E+NLR++C ++M+ V D+ PWFG+EQEYT+L I+ +P+ WP+ GFPG QGPYYCG GA+KV+GRDIVEAHY+AC+YAGIKI GTNAEVMP+QWEFQVGPCEGID+GD LWMAR+ILHRV EDFGVV T DPKP+ G+WNGAG HTNYST  MR   G+ +IE+AIEK+ K+H  HI  YDP  G DN RRLTG HETSSI +FS+GVANRGASIRIPRQV ++G GY EDRRP++NCDPY+V + +V+TTIL+E
Sbjct:    8 RLNKGVREQYMKLPQGGKV-QVTYVWIDGTGEGVRCKTRTLDQEPKTIDEIPEWNFDGSSTYQAEGSNSDMYLVPVQMFRDPFCLDPNKLVMCEVLKYNRKSAETNLRHTCKKIMEMVTDHRPWFGMEQEYTLLGINGHPYGWPENGFPGPQGPYYCGVGADKVYGRDIVEAHYKACLYAGIKICGTNAEVMPSQWEFQVGPCEGIDMGDHLWMARFILHRVCEDFGVVATLDPKPMTGNWNGAGCHTNYSTESMRVEGGLKHIEDAIEKLGKRHNYHICVYDPRGGKDNSRRLTGQHETSSIHEFSAGVANRGASIRIPRQVGQEGYGYFEDRRPAANCDPYAVTEALVRTTILNE 363          
BLAST of Glutamine synthetase vs. Ensembl Xenopus
Match: stard15 (StAR-related lipid transfer (START) domain containing 15 [Source:Xenbase;Acc:XB-GENE-942501])

HSP 1 Score: 383.259 bits (983), Expect = 6.193e-129
Identity = 187/363 (51.52%), Postives = 249/363 (68.60%), Query Frame = 2
Query:  347 MPLAKLRENKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE 1435
            M  +  R N+ + ++Y+ LPQ E    V YVW +   ENL+ KT+T+D+ P    ++P W    +   Q E    D+Y+ P+ +F DPF    NK+ LCE    +  P ++NLR SC +VM+   DYHPWFG+EQEY ++  +  P+ W +   P  QG ++CG GA+KV GR+I+EAHY+AC+YAGIKI GTNAE++ +QWEFQVGPCEG D GD L MAR+ILHRV EDFGVV + DPKP+PG W  +G H N+ST  MR   G+ +IE+AIEK++K+H  HI  YDP  G  N +RL G   TS+I+ FSSGV +R ASIRIP QV + G GYLEDRRPS++CDPY+VI+ +V+TTIL E
Sbjct:   32 MSFSSSRLNRRVKDQYMKLPQ-EGKVMVTYVWKNVPHENLQCKTRTLDYEPKSIEEIPKWGL--AFHLQHEDPLRDMYLIPVKMFKDPFFWDPNKLVLCEAMKSNGQPADNNLRQSCKKVMEMARDYHPWFGMEQEYFLIGANGLPYGWQEDRCP-IQGIHHCGVGADKVHGREIMEAHYKACLYAGIKIWGTNAEIISSQWEFQVGPCEGTDAGDHLVMARFILHRVCEDFGVVASLDPKPVPGFWADSGCHVNFSTEDMRKEGGLKHIEDAIEKLAKRHDHHISKYDPTGGEGNAQRLIGVLVTSNINKFSSGVDDRTASIRIPIQVWQQGYGYLEDRRPSADCDPYAVIEAVVRTTILKE 390          
BLAST of Glutamine synthetase vs. Ensembl Xenopus
Match: stard15 (StAR-related lipid transfer (START) domain containing 15 [Source:Xenbase;Acc:XB-GENE-942501])

HSP 1 Score: 382.104 bits (980), Expect = 6.454e-129
Identity = 187/363 (51.52%), Postives = 249/363 (68.60%), Query Frame = 2
Query:  347 MPLAKLRENKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE 1435
            M  +  R N+ + ++Y+ LPQ E    V YVW +   ENL+ KT+T+D+ P    ++P W    +   Q E    D+Y+ P+ +F DPF    NK+ LCE    +  P ++NLR SC +VM+   DYHPWFG+EQEY ++  +  P+ W +   P  QG ++CG GA+KV GR+I+EAHY+AC+YAGIKI GTNAE++ +QWEFQVGPCEG D GD L MAR+ILHRV EDFGVV + DPKP+PG W  +G H N+ST  MR   G+ +IE+AIEK++K+H  HI  YDP  G  N +RL G   TS+I+ FSSGV +R ASIRIP QV + G GYLEDRRPS++CDPY+VI+ +V+TTIL E
Sbjct:    1 MSFSSSRLNRRVKDQYMKLPQ-EGKVMVTYVWKNVPHENLQCKTRTLDYEPKSIEEIPKWGL--AFHLQHEDPLRDMYLIPVKMFKDPFFWDPNKLVLCEAMKSNGQPADNNLRQSCKKVMEMARDYHPWFGMEQEYFLIGANGLPYGWQEDRCP-IQGIHHCGVGADKVHGREIMEAHYKACLYAGIKIWGTNAEIISSQWEFQVGPCEGTDAGDHLVMARFILHRVCEDFGVVASLDPKPVPGFWADSGCHVNFSTEDMRKEGGLKHIEDAIEKLAKRHDHHISKYDPTGGEGNAQRLIGVLVTSNINKFSSGVDDRTASIRIPIQVWQQGYGYLEDRRPSADCDPYAVIEAVVRTTILKE 359          
BLAST of Glutamine synthetase vs. Ensembl Mouse
Match: Glul (glutamate-ammonia ligase (glutamine synthetase) [Source:MGI Symbol;Acc:MGI:95739])

HSP 1 Score: 514.998 bits (1325), Expect = 0.000e+0
Identity = 234/361 (64.82%), Postives = 287/361 (79.50%), Query Frame = 2
Query:  371 NKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE*NEHDF 1453
            NK +   Y++LPQ E V Q MY+W+DGTGE LR KT+T+D  P    +LP WNFDGSST QSEGSNSD+Y+HP+A+F DPFR+  NK+ LCE + Y++ P E+NLR+ C  +M  V + HPWFG+EQEYT++  D +PF WP  GFPG QGPYYCG GA+K +GRDIVEAHYRAC+YAG+KI GTNAEVMPAQWEFQ+GPCEGI +GD LW+AR+ILHRV EDFGV+ TFDPKPIPG+WNGAG HTN+ST  MR   G+  IEEAI+K+SK+H  HI+AYDP  G DN RRLTG HETS+I+DFS+GVANRGASIRIPR V ++  GY EDRRPS+NCDPY+V + IV+T +L+E  +  F
Sbjct:   10 NKGIKQMYMSLPQGEKV-QAMYIWVDGTGEGLRCKTRTLDCEPKCVEELPEWNFDGSSTFQSEGSNSDMYLHPVAMFRDPFRKDPNKLVLCEVFKYNRKPAETNLRHICKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHYRACLYAGVKITGTNAEVMPAQWEFQIGPCEGIRMGDHLWIARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKCIEEAIDKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRGASIRIPRTVGQEKKGYFEDRRPSANCDPYAVTEAIVRTCLLNETGDEPF 369          
BLAST of Glutamine synthetase vs. Ensembl Mouse
Match: Glul (glutamate-ammonia ligase (glutamine synthetase) [Source:MGI Symbol;Acc:MGI:95739])

HSP 1 Score: 514.998 bits (1325), Expect = 0.000e+0
Identity = 234/361 (64.82%), Postives = 287/361 (79.50%), Query Frame = 2
Query:  371 NKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE*NEHDF 1453
            NK +   Y++LPQ E V Q MY+W+DGTGE LR KT+T+D  P    +LP WNFDGSST QSEGSNSD+Y+HP+A+F DPFR+  NK+ LCE + Y++ P E+NLR+ C  +M  V + HPWFG+EQEYT++  D +PF WP  GFPG QGPYYCG GA+K +GRDIVEAHYRAC+YAG+KI GTNAEVMPAQWEFQ+GPCEGI +GD LW+AR+ILHRV EDFGV+ TFDPKPIPG+WNGAG HTN+ST  MR   G+  IEEAI+K+SK+H  HI+AYDP  G DN RRLTG HETS+I+DFS+GVANRGASIRIPR V ++  GY EDRRPS+NCDPY+V + IV+T +L+E  +  F
Sbjct:   10 NKGIKQMYMSLPQGEKV-QAMYIWVDGTGEGLRCKTRTLDCEPKCVEELPEWNFDGSSTFQSEGSNSDMYLHPVAMFRDPFRKDPNKLVLCEVFKYNRKPAETNLRHICKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHYRACLYAGVKITGTNAEVMPAQWEFQIGPCEGIRMGDHLWIARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKCIEEAIDKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRGASIRIPRTVGQEKKGYFEDRRPSANCDPYAVTEAIVRTCLLNETGDEPF 369          
BLAST of Glutamine synthetase vs. Ensembl Mouse
Match: Glul (glutamate-ammonia ligase (glutamine synthetase) [Source:MGI Symbol;Acc:MGI:95739])

HSP 1 Score: 264.618 bits (675), Expect = 1.206e-85
Identity = 118/190 (62.11%), Postives = 147/190 (77.37%), Query Frame = 2
Query:  371 NKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVM 940
            NK +   Y++LPQ E V Q MY+W+DGTGE LR KT+T+D  P    +LP WNFDGSST QSEGSNSD+Y+HP+A+F DPFR+  NK+ LCE + Y++ P E+NLR+ C  +M  V + HPWFG+EQEYT++  D +PF WP  GFPG QGPYYCG GA+K +GRDIVEAHYRAC+YAG+KI GTNAEVM
Sbjct:   10 NKGIKQMYMSLPQGEKV-QAMYIWVDGTGEGLRCKTRTLDCEPKCVEELPEWNFDGSSTFQSEGSNSDMYLHPVAMFRDPFRKDPNKLVLCEVFKYNRKPAETNLRHICKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHYRACLYAGVKITGTNAEVM 198          
BLAST of Glutamine synthetase vs. UniProt/SwissProt
Match: sp|Q04831|GLNA_PANAR (Glutamine synthetase OS=Panulirus argus OX=6737 PE=2 SV=1)

HSP 1 Score: 545.043 bits (1403), Expect = 0.000e+0
Identity = 246/355 (69.30%), Postives = 295/355 (83.10%), Query Frame = 2
Query:  371 NKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE 1435
            NK +L++YL L  P+   Q MY+W+DGTGENLR KT+T++F P  PS+LPIWNFDGSSTGQ+E SNSDVY++P+A++ DPFR G+NK+ LCETY Y++ P ++N R+ C EVM +  D HPWFG+EQEYT+LDID +P  WPK G+PG QGPYYCG GAN+V+GRD+VEAHYRAC+ AGI I+G NA+VMPAQWEFQVGPCEGI +GD LWMARY+LHRVAEDF VVVT DPKPIPGDWNGAG HTN+ST  MRGP GI  IE AI+K+SK H +HI+AYDPH G DN RRLTGH+ETSSI DFS+GVANRGASIRIPR V+E+  GYLEDRRPSSN DPY V +R+V+T  L+E
Sbjct:    6 NKTVLDRYLRLDIPDQKCQAMYIWVDGTGENLRSKTRTLNFTPKSPSELPIWNFDGSSTGQAERSNSDVYLYPVAVYRDPFRLGNNKLVLCETYKYNKKPADTNQRWKCMEVMTRAADQHPWFGMEQEYTLLDIDKHPLGWPKNGYPGPQGPYYCGVGANRVYGRDVVEAHYRACLCAGINISGENAKVMPAQWEFQVGPCEGITMGDDLWMARYLLHRVAEDFDVVVTLDPKPIPGDWNGAGMHTNFSTEAMRGPNGILEIESAIDKLSKVHEKHIKAYDPHAGKDNERRLTGHYETSSIHDFSAGVANRGASIRIPRGVAEEKTGYLEDRRPSSNADPYVVSERLVRTICLNE 360          
BLAST of Glutamine synthetase vs. UniProt/SwissProt
Match: sp|P20478|GLNA2_DROME (Glutamine synthetase 2 cytoplasmic OS=Drosophila melanogaster OX=7227 GN=Gs2 PE=2 SV=3)

HSP 1 Score: 528.48 bits (1360), Expect = 0.000e+0
Identity = 237/357 (66.39%), Postives = 289/357 (80.95%), Query Frame = 2
Query:  365 RENKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE 1435
            R NK +L++YL+LP  EN+ Q  YVWIDGTGE+LR K +T+DF+P  P +LP+WN+DGSS  Q+EGSNSD Y++P+A++ DPFRRG+N + +C+TY +D  P ++N R +C EV  K     PWFGIEQEYT LD D +P  WPK GFPG QGPYYCG GANKV+ RDIV+AHYRAC+YAGIK++GTNAEVMPAQWEFQVGPCEGI +GD LWMAR++LHR++E+FG+V T DPKP+PGDWNGAGAHTN ST  MR   GI  IE+A+ K+SK H  HI+AYDP QG DN RRLTG HETSSI+DFS+GVANRG SIRIPR V++DG GY EDRRPSSNCDPYSV++ I++T  LDE
Sbjct:   13 RINKTILDRYLSLPLQENIVQATYVWIDGTGEDLRCKDRTLDFIPQSPKELPVWNYDGSSCYQAEGSNSDTYLYPVAIYKDPFRRGNNILVMCDTYKFDGTPTDTNKRKTCLEVANKCAAEEPWFGIEQEYTFLDFDGHPLGWPKNGFPGPQGPYYCGVGANKVYARDIVDAHYRACLYAGIKVSGTNAEVMPAQWEFQVGPCEGISIGDDLWMARFLLHRISEEFGIVSTLDPKPMPGDWNGAGAHTNVSTKAMREDGGIRDIEKAVAKLSKCHERHIRAYDPKQGQDNARRLTGKHETSSINDFSAGVANRGCSIRIPRGVNDDGKGYFEDRRPSSNCDPYSVVEAILRTICLDE 369          
BLAST of Glutamine synthetase vs. UniProt/SwissProt
Match: sp|Q8HZM5|GLNA_CANLF (Glutamine synthetase OS=Canis lupus familiaris OX=9615 GN=GLUL PE=1 SV=3)

HSP 1 Score: 516.538 bits (1329), Expect = 0.000e+0
Identity = 235/361 (65.10%), Postives = 288/361 (79.78%), Query Frame = 2
Query:  371 NKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE*NEHDF 1453
            NK +   Y++LPQ E V Q MY+WIDGTGE LR KT+T+D  P    +LP WNFDGSST QSEGSNSD+Y+ P A+F DPFR+  NK+  CE + Y++ P E+NLR++C  +M  V + HPWFG+EQEYT++  D +PF WP  GFPG QGPYYCG GA+K +GRDIVEAHYRAC+YAGIKIAGTNAEVMPAQWEFQ+GPCEGID+GD LW+AR+ILHRV EDFGV+ TFDPKPIPG+WNGAG HTN+ST  MR   G+ YIEE+IEK+SK+H  HI+AYDP  G DN RRLTG HETS+I+DFS+GVANRGASIRIPR V ++  GY EDRRPS+NCDP+SV + +++T +L+E  +  F
Sbjct:   10 NKGIKQVYMSLPQGEKV-QAMYIWIDGTGEGLRCKTRTLDSEPKGVEELPEWNFDGSSTFQSEGSNSDMYLVPAAMFRDPFRKDPNKLVFCEVFKYNRKPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHYRACLYAGIKIAGTNAEVMPAQWEFQIGPCEGIDMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEESIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRGASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPF 369          
BLAST of Glutamine synthetase vs. UniProt/SwissProt
Match: sp|Q9QY94|GLNA_ACOCA (Glutamine synthetase OS=Acomys cahirinus OX=10068 GN=GLUL PE=2 SV=3)

HSP 1 Score: 515.768 bits (1327), Expect = 1.341e-180
Identity = 233/355 (65.63%), Postives = 285/355 (80.28%), Query Frame = 2
Query:  371 NKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE 1435
            NK +   Y++LPQ E V Q MY+W+DGTGE LR KT+T+D  P    +LP WNFDGSST QSEGSNSD+Y+ P+A+F DPFR+  NK+  CE + Y++ P E+NLR+SC  +M  V + HPWFG+EQEYT++  D +PF WP  GFPG QGPYYCG GA+K +GRDIVEAHYRAC+YAG+KI GTNAEVMPAQWEFQ+GPCEGI +GD LW+AR+ILHRV EDFGV+ TFDPKPIPG+WNGAG HTN+ST  MR   G+ YIEEAI+K+SK+H  HI+AYDP  G DN RRLTG HETS+I+DFS+GVANRGASIRIPR V ++  GY EDRRPS+NCDPY+V + IV+T +L+E
Sbjct:   10 NKGIKQMYMSLPQGEKV-QAMYIWVDGTGEGLRCKTRTLDCEPKCVEELPEWNFDGSSTFQSEGSNSDMYLSPVAMFRDPFRKEPNKLVFCEVFKYNRKPAETNLRHSCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHYRACLYAGVKITGTNAEVMPAQWEFQIGPCEGIRMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIDKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRGASIRIPRTVGQEKRGYFEDRRPSANCDPYAVTEAIVRTCLLNE 363          
BLAST of Glutamine synthetase vs. UniProt/SwissProt
Match: sp|P15105|GLNA_MOUSE (Glutamine synthetase OS=Mus musculus OX=10090 GN=Glul PE=1 SV=6)

HSP 1 Score: 514.998 bits (1325), Expect = 2.975e-180
Identity = 234/361 (64.82%), Postives = 287/361 (79.50%), Query Frame = 2
Query:  371 NKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE*NEHDF 1453
            NK +   Y++LPQ E V Q MY+W+DGTGE LR KT+T+D  P    +LP WNFDGSST QSEGSNSD+Y+HP+A+F DPFR+  NK+ LCE + Y++ P E+NLR+ C  +M  V + HPWFG+EQEYT++  D +PF WP  GFPG QGPYYCG GA+K +GRDIVEAHYRAC+YAG+KI GTNAEVMPAQWEFQ+GPCEGI +GD LW+AR+ILHRV EDFGV+ TFDPKPIPG+WNGAG HTN+ST  MR   G+  IEEAI+K+SK+H  HI+AYDP  G DN RRLTG HETS+I+DFS+GVANRGASIRIPR V ++  GY EDRRPS+NCDPY+V + IV+T +L+E  +  F
Sbjct:   10 NKGIKQMYMSLPQGEKV-QAMYIWVDGTGEGLRCKTRTLDCEPKCVEELPEWNFDGSSTFQSEGSNSDMYLHPVAMFRDPFRKDPNKLVLCEVFKYNRKPAETNLRHICKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHYRACLYAGVKITGTNAEVMPAQWEFQIGPCEGIRMGDHLWIARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKCIEEAIDKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRGASIRIPRTVGQEKKGYFEDRRPSANCDPYAVTEAIVRTCLLNETGDEPF 369          
BLAST of Glutamine synthetase vs. TrEMBL
Match: A0A1I8IP23 (Glutamine synthetase OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 562.377 bits (1448), Expect = 0.000e+0
Identity = 251/351 (71.51%), Postives = 296/351 (84.33%), Query Frame = 2
Query:  371 NKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTT 1423
            NK  L +YL LPQPE+  Q MY+WIDGTGENLR KT+TVDFVP + ++LPIWNFDGSSTGQ+EG NSDV IHP+ALF DPFR  +NK+ LCETY +D   H SN R SCN+VM+K + + PWFGIEQEYT+LD D++PF WPK GFPG QGPYY G GAN V GRDIVE+HYRAC+Y+ IKI+G NAEVMPAQWEFQVGPCEGI +GD LW+AR++LHRVAEDFGVVV+FDPKP+PGDWNGAGAH NYST +MR P G+  + EAIE++ K+H  HI+AYDP+ G DNRRRLTG HETSSID+FS GVA+RG+SIRIPRQ S+DGCGY+EDRRPSSNCDPYSV + +V+TT
Sbjct:    9 NKTTLLRYLALPQPEDKVQCMYIWIDGTGENLRAKTRTVDFVPKQATELPIWNFDGSSTGQAEGHNSDVMIHPVALFKDPFRGNNNKLVLCETYRHDGAVHPSNKRNSCNQVMQKAKGFEPWFGIEQEYTLLDTDLHPFGWPKNGFPGPQGPYYTGVGANNVHGRDIVESHYRACLYSEIKISGENAEVMPAQWEFQVGPCEGISMGDHLWVARFLLHRVAEDFGVVVSFDPKPMPGDWNGAGAHANYSTKEMRAPGGMKAMVEAIERLGKRHAAHIRAYDPNGGNDNRRRLTGRHETSSIDNFSYGVAHRGSSIRIPRQCSDDGCGYIEDRRPSSNCDPYSVTEMLVRTT 359          
BLAST of Glutamine synthetase vs. TrEMBL
Match: A0A087UK01 (Glutamine synthetase (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_11234 PE=3 SV=1)

HSP 1 Score: 561.222 bits (1445), Expect = 0.000e+0
Identity = 259/355 (72.96%), Postives = 296/355 (83.38%), Query Frame = 2
Query:  371 NKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE 1435
            NK    KYL+LPQPEN  Q MYVWIDGTGE LR KT+T+DFVP     LPIWNFDGSST Q+EGSNSD+Y+HP+AL+ DPFR G+N++ LCETY Y+  P ESN R SC EVM+K ++  PWFGIEQEYT+LD D +PF WPK GFPG QGPYYCG GA+KV+GRD+VEAHYRAC+YAGI I GTNAEVMPAQWEFQVGP EG+ +GD LWMAR+IL RVAEDFGVVVTFDPKPIPGDWNGAGAHTN+ST +MR   G+  IE+AIE++SK H  HIQAYDP QG DN RRLTG HETSSI DFS+GVANRGASIRIPRQV+E+G GYLEDRRPSSNCDPYSV + +V+T  L+E
Sbjct:   14 NKQTTLKYLSLPQPENKVQCMYVWIDGTGEQLRAKTRTIDFVPKAAEDLPIWNFDGSSTYQAEGSNSDIYLHPVALYKDPFRGGNNRLVLCETYKYNHKPTESNKRRSCMEVMEKAKEEKPWFGIEQEYTLLDCDKHPFGWPKNGFPGPQGPYYCGVGADKVYGRDVVEAHYRACLYAGIPICGTNAEVMPAQWEFQVGPSEGVAIGDDLWMARFILQRVAEDFGVVVTFDPKPIPGDWNGAGAHTNFSTKRMREDNGLKEIEKAIERLSKHHERHIQAYDPKQGKDNERRLTGFHETSSIHDFSAGVANRGASIRIPRQVAEEGKGYLEDRRPSSNCDPYSVAEVLVRTVCLEE 368          
BLAST of Glutamine synthetase vs. TrEMBL
Match: A0A423TMW1 (Glutamine synthetase OS=Penaeus vannamei OX=6689 GN=C7M84_003499 PE=3 SV=1)

HSP 1 Score: 560.836 bits (1444), Expect = 0.000e+0
Identity = 252/355 (70.99%), Postives = 297/355 (83.66%), Query Frame = 2
Query:  371 NKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE 1435
            NK +L++YL L  P+   QVMYVW+DG+GENLR KT+T++F+P  P +LPIWNFDGSST Q+EGSNSDVY+HP+AL+ DPFR G+NK+ LCETY Y++ P ++N RY C EVM +    HPWFG+EQEYT+LD+D +P  WPK G+PG QGPYYCG GA+KV+GRD+VEAHYRAC+Y GI I+GTNAEVMPAQWEFQVGPCEGI++GD LWMARY+LHRVAEDFG+VVT DPKPIPGDWNGAG HTN+STA MR P GIT IE AIEK+ K H EHI+AYDPH G DN RRLTG HETSSI DFS+GVANRGASIRIPR V+E+  GYLEDRRPSSN DPY V +R+V+T  LDE
Sbjct:    6 NKTVLDRYLRLEIPDQKCQVMYVWVDGSGENLRSKTRTLNFIPKAPEELPIWNFDGSSTAQAEGSNSDVYLHPVALYRDPFRLGNNKLVLCETYKYNKKPTDTNHRYRCTEVMTRAASQHPWFGMEQEYTLLDVDKHPLGWPKNGYPGPQGPYYCGVGASKVYGRDVVEAHYRACLYTGINISGTNAEVMPAQWEFQVGPCEGINMGDDLWMARYLLHRVAEDFGIVVTLDPKPIPGDWNGAGMHTNFSTAAMRAPNGITAIETAIEKLGKVHAEHIRAYDPHGGKDNERRLTGLHETSSIHDFSAGVANRGASIRIPRGVAEEKTGYLEDRRPSSNADPYVVSERLVRTICLDE 360          
BLAST of Glutamine synthetase vs. TrEMBL
Match: A0A4Y2BM83 (Glutamine synthetase OS=Araneus ventricosus OX=182803 GN=Gs2_2 PE=3 SV=1)

HSP 1 Score: 560.836 bits (1444), Expect = 0.000e+0
Identity = 258/355 (72.68%), Postives = 297/355 (83.66%), Query Frame = 2
Query:  371 NKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE 1435
            NK    KYL+LPQPE+  Q +YVWIDGTGE LR KT+T+DFVP  P  LPIWNFDGSST Q+E SNSD Y++P+AL+ DPFR GDNK+ LC+TY Y++ P ESN R++C EVM KV+D  PWFGIEQEYT+LD D +PF WPK GFPG QGPYYCG G++KV+GRDIVEAHYRAC+YAGI I+GTNAEVMPAQWEFQVGP EG+ +GD LWMAR+IL RVAEDFGVVVTFDPKPIPGDWNGAGAHTN+ST  MR   GI  IE+AI+++SK+H  HIQAYDP QG DN RRLTG+HETSSI DFS+GVANRGASIRIPRQV+E+G GYLEDRRPSSNCDPY V + IV+T  L E
Sbjct:   49 NKQTTMKYLSLPQPEDKVQCLYVWIDGTGEQLRAKTRTLDFVPKAPEDLPIWNFDGSSTYQAEDSNSDTYLYPVALYKDPFRGGDNKLVLCDTYKYNKKPTESNKRHTCVEVMNKVKDQKPWFGIEQEYTLLDCDKHPFGWPKSGFPGPQGPYYCGVGSDKVYGRDIVEAHYRACLYAGIPISGTNAEVMPAQWEFQVGPSEGVRIGDDLWMARFILQRVAEDFGVVVTFDPKPIPGDWNGAGAHTNFSTKAMREENGIKEIEKAIDRLSKQHLRHIQAYDPKQGKDNERRLTGNHETSSIHDFSAGVANRGASIRIPRQVAEEGKGYLEDRRPSSNCDPYCVAEVIVRTACLGE 403          
BLAST of Glutamine synthetase vs. TrEMBL
Match: L0GC80 (Glutamine synthetase OS=Penaeus monodon OX=6687 PE=2 SV=1)

HSP 1 Score: 560.836 bits (1444), Expect = 0.000e+0
Identity = 252/355 (70.99%), Postives = 296/355 (83.38%), Query Frame = 2
Query:  371 NKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE 1435
            NK +L++YL L  P+   Q MYVW+DG+GENLR KT+T+ F+P  P +LPIWNFDGSSTGQ+EGSNSDVY+HP+AL+ DPFR G+NK+ LCETY Y++ P ++N RY C EVM +    HPWFG+EQEYT+LD+D +P  WPK G+PG QGPYYCG GA+KV+GRD+VEAHYRAC+Y GI I+GTNAEVMPAQWEFQVGPCEGI++GD LWMARY+LHRVAEDFG+VVT DPKPIPGDWNGAG HTN+STA MR P GIT IE AIEK+ K H EHI+AYDPH G DN RRLTG HETSSI DFS+GVANRGASIRIPR V+E+  GYLEDRRPSSN DPY V +R+V+T  LDE
Sbjct:    6 NKTVLDRYLRLEIPDQKCQAMYVWVDGSGENLRSKTRTLSFIPKAPEELPIWNFDGSSTGQAEGSNSDVYLHPVALYRDPFRLGNNKLVLCETYKYNKKPTDTNHRYRCTEVMTRAASQHPWFGMEQEYTLLDVDKHPLGWPKNGYPGPQGPYYCGVGASKVYGRDVVEAHYRACLYTGINISGTNAEVMPAQWEFQVGPCEGINMGDDLWMARYLLHRVAEDFGIVVTLDPKPIPGDWNGAGMHTNFSTAAMRAPNGITAIETAIEKLGKVHSEHIRAYDPHGGKDNERRLTGLHETSSIHDFSAGVANRGASIRIPRGVAEEKTGYLEDRRPSSNADPYVVSERLVRTICLDE 360          
BLAST of Glutamine synthetase vs. Ensembl Cavefish
Match: glula (glutamine synthetase [Source:NCBI gene;Acc:103046209])

HSP 1 Score: 511.531 bits (1316), Expect = 7.282e-180
Identity = 234/355 (65.92%), Postives = 286/355 (80.56%), Query Frame = 2
Query:  371 NKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE 1435
            +KL+ ++Y+ LPQ E V Q MY+WIDGTGE LR KT+T+D  P     LP WNFDGSST QSEGSNSD+Y+ P A+F DPFR+  NK+ LCE   Y++ P E+N R +C ++M+ VED  PWFG+EQEYTIL  D +PF WP  GFPG QGPYYCG GA+K +GRDIVEAHYRAC+YAG++I GTNAEVMPAQWEFQVGPCEGI++GD LW+AR+ILHRV EDFGVVV+FDPKPIPG+WNGAG HTN+ST  MR   G+ YIEE+IE++ K+H  HI+AYDP  G DN RRLTGHHETS+I +FS+GVANRGASIRIPR V ++  GY EDRRPS+NCDPY+V Q +++T +L+E
Sbjct:   10 SKLVKSQYMELPQGEKV-QAMYIWIDGTGEGLRCKTRTLDSEPKSIEDLPEWNFDGSSTYQSEGSNSDMYLIPSAMFRDPFRKDPNKLVLCEVLKYNRKPAETNHRVTCQKIMQMVEDQSPWFGMEQEYTILGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHYRACLYAGVQICGTNAEVMPAQWEFQVGPCEGIEMGDHLWVARFILHRVCEDFGVVVSFDPKPIPGNWNGAGCHTNFSTKAMREDGGLKYIEESIERLGKRHSYHIRAYDPKGGLDNARRLTGHHETSNIHEFSAGVANRGASIRIPRAVGQEKKGYFEDRRPSANCDPYAVTQALIRTCLLNE 363          
BLAST of Glutamine synthetase vs. Ensembl Cavefish
Match: glulb (glutamine synthetase [Source:NCBI gene;Acc:103044444])

HSP 1 Score: 506.523 bits (1303), Expect = 5.955e-178
Identity = 235/355 (66.20%), Postives = 282/355 (79.44%), Query Frame = 2
Query:  371 NKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE 1435
            +K +  +Y+ LPQ   V Q MY+WIDGTGE LR KT+T+D  P     LP WNFDGSST QSEGSNSD+Y+ P A+F DPFR+  NK+ LCE   Y++ P E+NLR  C ++M KVE+ HPWFG+EQEYTIL ID +PF WP  GFPG QGPYYCG GA+K +GRDIVEAHYRAC+YAG+ I GTNAEVMPAQWEFQVGPCEGI +GD LWMAR+ILHRV EDFGVVV+FDPKPI G+WNGAG HTN+ST +MR   G+  IEEAIEK+SK+H  HI+AYDP  G DN RRLTG HETS+I++FS+GVANRGASIRIPR V ++  GY EDRRPS+NCDPY+V + +++T +L E
Sbjct:   10 SKAVKQQYMELPQGGTV-QAMYIWIDGTGEGLRCKTRTLDAEPKTIEDLPEWNFDGSSTYQSEGSNSDMYLIPKAIFRDPFRKDPNKLILCEVLKYNRKPAETNLRQMCAKIMDKVENQHPWFGMEQEYTILGIDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHYRACLYAGVDICGTNAEVMPAQWEFQVGPCEGIRMGDHLWMARFILHRVCEDFGVVVSFDPKPISGNWNGAGCHTNFSTKEMREEGGLKQIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGRHETSNINEFSAGVANRGASIRIPRSVGQEKRGYFEDRRPSANCDPYAVTEALIRTCLLGE 363          
BLAST of Glutamine synthetase vs. Ensembl Cavefish
Match: glulb (glutamine synthetase [Source:NCBI gene;Acc:103044444])

HSP 1 Score: 506.523 bits (1303), Expect = 1.189e-177
Identity = 235/355 (66.20%), Postives = 282/355 (79.44%), Query Frame = 2
Query:  371 NKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE 1435
            +K +  +Y+ LPQ   V Q MY+WIDGTGE LR KT+T+D  P     LP WNFDGSST QSEGSNSD+Y+ P A+F DPFR+  NK+ LCE   Y++ P E+NLR  C ++M KVE+ HPWFG+EQEYTIL ID +PF WP  GFPG QGPYYCG GA+K +GRDIVEAHYRAC+YAG+ I GTNAEVMPAQWEFQVGPCEGI +GD LWMAR+ILHRV EDFGVVV+FDPKPI G+WNGAG HTN+ST +MR   G+  IEEAIEK+SK+H  HI+AYDP  G DN RRLTG HETS+I++FS+GVANRGASIRIPR V ++  GY EDRRPS+NCDPY+V + +++T +L E
Sbjct:   26 SKAVKQQYMELPQGGTV-QAMYIWIDGTGEGLRCKTRTLDAEPKTIEDLPEWNFDGSSTYQSEGSNSDMYLIPKAIFRDPFRKDPNKLILCEVLKYNRKPAETNLRQMCAKIMDKVENQHPWFGMEQEYTILGIDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHYRACLYAGVDICGTNAEVMPAQWEFQVGPCEGIRMGDHLWMARFILHRVCEDFGVVVSFDPKPISGNWNGAGCHTNFSTKEMREEGGLKQIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGRHETSNINEFSAGVANRGASIRIPRSVGQEKRGYFEDRRPSANCDPYAVTEALIRTCLLGE 379          
BLAST of Glutamine synthetase vs. Ensembl Cavefish
Match: glulc (glutamine synthetase-like [Source:NCBI gene;Acc:103025378])

HSP 1 Score: 471.855 bits (1213), Expect = 4.383e-164
Identity = 210/360 (58.33%), Postives = 273/360 (75.83%), Query Frame = 2
Query:  374 KLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE*NEHDF 1453
            K L + Y +LPQ     QV Y+WIDG+GE +R KT+T+D  P     +P W FDGSSTGQ+ G N D+++ P+ +F DPF    NK+ LCE   YD+ P E+N R+ C ++M+KV++Y+PWFG+EQEYT+L  D YP++WP  GFP  QGPYYC  GA++ FGRDIVE HY+AC+YAG+KI+G+NAEVMP+QWEFQVGPCEG ++GDQLWMAR++LHRV EDFGV+ T DPKP+ G+WNGAG HTN+ST   R   G+ +IE+AI+K+  +H EHI+ YDPH G DN+RRLTG HETS I +FS+ VANRG SIRIPR V++D  GYLEDRRP++NCDPY+V   I++T +L+   E D 
Sbjct:   13 KTLRSHYFSLPQGGQC-QVTYIWIDGSGEGMRSKTRTLDCEPSGIEDIPEWIFDGSSTGQATGENCDMFLIPVKMFRDPFILDPNKLVLCEVLKYDRQPTETNHRHHCKKIMEKVKEYNPWFGMEQEYTLLGADEYPYAWPSKGFPKPQGPYYCSVGADRAFGRDIVECHYKACMYAGVKISGSNAEVMPSQWEFQVGPCEGTEIGDQLWMARFLLHRVCEDFGVIATLDPKPMSGNWNGAGCHTNFSTNATRAEGGLEHIEKAIDKLRPQHAEHIRVYDPHGGEDNKRRLTGLHETSPIHEFSAAVANRGVSIRIPRHVAQDKRGYLEDRRPAANCDPYAVTAAIIRTCLLEGEEEGDI 371          
BLAST of Glutamine synthetase vs. Ensembl Cavefish
Match: ENSAMXT00000034935.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002169.1:24429:28842:-1 gene:ENSAMXG00000030071.1 transcript:ENSAMXT00000034935.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 347.821 bits (891), Expect = 6.133e-116
Identity = 166/284 (58.45%), Postives = 203/284 (71.48%), Query Frame = 2
Query:  599 FNDPFRRGDNKIALCE-----TYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE 1435
            F DPFR+  NK+ LCE     T     L  E+N R +C ++M+ VED  PWFG+EQEYTIL  D +PF WP  GFPG QGPYYCG GA+K +GRDIVEAHYRAC+YAG++I GTNAEVMPAQWEFQVGPCEGI++GD LW+AR+ILHRV EDFGVVV+FDPKPIPG+WNGAG HTN+ST  MR   G+ YIEE+IE++ K+H  HI+AYDP  G DN R               +    R +S    R+  E   GY EDRRPS+NCDPY+V Q +++T +L+E
Sbjct:   77 FRDPFRKRPNKLVLCESEDVLTCYLVSLVAETNHRVTCQKIMQMVEDQSPWFGMEQEYTILGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHYRACLYAGVQICGTNAEVMPAQWEFQVGPCEGIEMGDHLWVARFILHRVCEDFGVVVSFDPKPIPGNWNGAGCHTNFSTKAMREDGGLKYIEESIERLGKRHSYHIRAYDPKGGLDNARSP------------PAWPTARASSPHPSRRRPEKKKGYFEDRRPSANCDPYAVTQALIRTCLLNE 348          
BLAST of Glutamine synthetase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008530.1 (pep scaffold:Pmarinus_7.0:GL476642:753214:761317:-1 gene:ENSPMAG00000007702.1 transcript:ENSPMAT00000008530.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 516.538 bits (1329), Expect = 0.000e+0
Identity = 235/357 (65.83%), Postives = 289/357 (80.95%), Query Frame = 2
Query:  365 RENKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE 1435
            R NK++ +KY+ LPQ + V Q MY+W+DGTGE LR KT+T+D  P   + LP WNFDGSST Q+EGSNSD+Y+ P+A+F DPFR   NK+ LCE   Y++ P E+NLR +C  VM+++    PWFG+EQEYTIL +D +PF WP  GFPG QGPYYCG G++K +GRDIVEAHYRAC+YAG+KI GTNAEVMP+QWEFQVGPCEGID+GD LW+AR+ILHRV EDFGVV TFDPKPIPG+WNGAG HTN+ST  MR   G+ +IEEAIEK+ K+H  HI+AYDP  G DN RRLTG HETSSI +FS+GVANRGASIRIPRQV +DGCGY+EDRRPS+NC+PY+V + +++T +L E
Sbjct:    8 RLNKMVKSKYMELPQGDAV-QAMYIWLDGTGEGLRCKTRTLDAEPKTVADLPEWNFDGSSTYQAEGSNSDMYLIPVAMFRDPFRNDPNKLVLCEVLKYNRQPAETNLRGTCKMVMERIRAQVPWFGMEQEYTILGVDGHPFGWPSNGFPGPQGPYYCGVGSDKAYGRDIVEAHYRACLYAGVKICGTNAEVMPSQWEFQVGPCEGIDMGDHLWVARFILHRVCEDFGVVATFDPKPIPGNWNGAGCHTNFSTLPMREDGGLQHIEEAIEKLGKRHSYHIRAYDPRGGLDNARRLTGSHETSSIHEFSAGVANRGASIRIPRQVGQDGCGYMEDRRPSANCNPYAVTEALIRTCLLHE 363          
BLAST of Glutamine synthetase vs. Ensembl Yeast
Match: GLN1 (Glutamine synthetase (GS); synthesizes glutamine from glutamate and ammonia; with Glt1p, forms the secondary pathway for glutamate biosynthesis from ammonia; expression regulated by nitrogen source and by amino acid limitation; forms filaments of back-to-back stacks of cylindrical homo-decamers at low pH, leading to enzymatic inactivation and storage during states of advanced cellular starvation; relocalizes from nucleus to cytoplasmic foci upon DNA replication stress [Source:SGD;Acc:S000006239])

HSP 1 Score: 431.024 bits (1107), Expect = 3.575e-149
Identity = 208/366 (56.83%), Postives = 263/366 (71.86%), Query Frame = 2
Query:  368 ENKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE*NEHDFTKGF 1465
            E   +L KYL L Q   +    YVWIDGTG NLR K +T+        QLP WNFDGSST Q+ G +SD+Y+ P+A + DPFRRGDN + L   YN D  P++ N R+   ++    +D   WFG+EQEYT+ D+    + WPK G+P  QGPYYCG GA KV+ RD++EAHYRAC+YAG++I+G NAEVMP+QWEFQVGPC GID+GDQLWMARY LHRVAE+FG+ ++F PKP+ GDWNGAG HTN ST +MR P G+ YIE+AIEK+SK+H EHI+ Y    G+DN  RLTG HET+S+  FSSGVANRG+SIRIPR V+++G GY EDRRP+SN DPY ++  I+  T+    +  D TK F
Sbjct:    7 EKTQILQKYLELDQRGRII-AEYVWIDGTG-NLRSKGRTLKKRITSIDQLPEWNFDGSSTNQAPGHDSDIYLKPVAYYPDPFRRGDNIVVLAACYNNDGTPNKFNHRHEAAKLFAAHKDEEIWFGLEQEYTLFDMYDDVYGWPKGGYPAPQGPYYCGVGAGKVYARDMIEAHYRACLYAGLEISGINAEVMPSQWEFQVGPCTGIDMGDQLWMARYFLHRVAEEFGIKISFHPKPLKGDWNGAGCHTNVSTKEMRQPGGMKYIEQAIEKLSKRHAEHIKLY----GSDNDMRLTGRHETASMTAFSSGVANRGSSIRIPRSVAKEGYGYFEDRRPASNIDPY-LVTGIMCETVCGAIDNADMTKEF 365          
BLAST of Glutamine synthetase vs. Ensembl Nematostella
Match: EDO40606 (Glutamine synthetase [Source:UniProtKB/TrEMBL;Acc:A7S6S5])

HSP 1 Score: 517.694 bits (1332), Expect = 0.000e+0
Identity = 241/359 (67.13%), Postives = 290/359 (80.78%), Query Frame = 2
Query:  362 LRENKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMK--KVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILD 1432
            + +  ++L KY  L Q + V Q +Y+W+DG+GE +R K++T+D  P     LPIWNFDGSST Q+EG NSDVY+HPI +F DPFR G+N + LCETY +D  P  +N R +C +VM+  KV+ + PWFGIEQEYT+LDID +P  WPK GFPG QGPYYCG G NKVFGR+IVEAHYRAC+YAG+KIAGTNAEVMPAQWEFQVGPCEGI++GD LW+ARY+LHRVAEDFGV+VTFDPKP+PGDWNGAGAH NYST +MR   G+ +I  AIEK+ K H  HI++YDP++G DN RRLTG HETS ID FS GVANRGAS+RIPRQ +EDG GYLEDRRPSSNCDPYSV + IV+TT+LD
Sbjct:    8 VSDRHVVLEKYQRLDQGDRV-QALYIWVDGSGEGIRCKSRTLDKPPKSHEDLPIWNFDGSSTAQAEGCNSDVYLHPINIFKDPFRGGNNILVLCETYQFDHKPTRTNKRKTCFDVMESEKVKPHRPWFGIEQEYTLLDIDGHPLGWPKGGFPGPQGPYYCGVGTNKVFGREIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQVGPCEGIEMGDHLWVARYLLHRVAEDFGVIVTFDPKPMPGDWNGAGAHCNYSTEEMREEGGMVHIYTAIEKLEKNHDYHIRSYDPNEGRDNARRLTGAHETSRIDQFSHGVANRGASVRIPRQCAEDGKGYLEDRRPSSNCDPYSVTEAIVRTTVLD 365          
BLAST of Glutamine synthetase vs. Ensembl Nematostella
Match: EDO27362 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9G3])

HSP 1 Score: 145.206 bits (365), Expect = 6.850e-42
Identity = 70/102 (68.63%), Postives = 82/102 (80.39%), Query Frame = 2
Query: 1127 MRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILD 1432
            MR   G+ +I  AIEK+ K H  HI++YDP++G DN RRLTG HETS ID FS GVANRGAS+RIPRQ +EDG GYLEDRRPSSNCDPYSV + IV+TT+LD
Sbjct:    1 MREEGGMVHIYTAIEKLEKNHDYHIRSYDPNEGRDNARRLTGAHETSRIDQFSHGVANRGASVRIPRQCAEDGKGYLEDRRPSSNCDPYSVTEAIVRTTVLD 102          
BLAST of Glutamine synthetase vs. Ensembl Nematostella
Match: EDO25869 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TDH3])

HSP 1 Score: 47.7506 bits (112), Expect = 5.668e-6
Identity = 56/247 (22.67%), Postives = 98/247 (39.68%), Query Frame = 2
Query:  713 KVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPG----AQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQV-GPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRG--------PQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIV 1414
            K + YHP   +E E+ +LD +      P+          Q P   G    +   +  ++  Y AC   G+ +    +E  P Q E  +    + +   D+    + ++  VA   G+   F  KP  GD  G+G H + S A   G        P G   ++ AI  M     + +  + P+  A++ RR   +        +  GV NR  S R+P   ++    ++E R   ++ +PY     I+
Sbjct:   58 KADGYHPVMAVELEFYLLDKNRDANGRPQPALQANGVRPQAPQVYGVYELEQL-QPFLDDLYSACEVQGLPVRTAISEYAPGQVELTLEHRFDALQAVDEGVRYKRLVKGVANKHGMQACFMAKPF-GDQAGSGMHMHVSLADEHGNNLMASEDPHGTPLLKHAIGGMMATLNDALAIFCPN--ANSYRRFQANSYAPLAKSW--GVNNRTVSFRVPGGPAKS--RHVEHRICGADANPYLAAAAIL 296          
BLAST of Glutamine synthetase vs. Ensembl Medaka
Match: glula (glutamate-ammonia ligase [Source:NCBI gene;Acc:101159856])

HSP 1 Score: 505.368 bits (1300), Expect = 1.770e-177
Identity = 233/355 (65.63%), Postives = 278/355 (78.31%), Query Frame = 2
Query:  371 NKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE 1435
            +K +  +Y+ LPQ   V Q MY+WIDGTGE LR KT+T+D  P     LP WNFDGSST Q+EGSNSD+Y+ P A+F DPFR+  NK+ LCE   Y++ P ESNLR +C +VM  V D HPWFG+EQEYTIL  D +PF WP  GFPG QGPYYCG GA+K +GRDIVEAHYRAC+YAG+ I GTNAEVMPAQWEFQVGPCEGID+GD LW+AR+ILHRV EDFGVV +FDPKPIPG+WNGAG HTN ST +MR   G+  IE+AIEK+ K+H  HI+AYDP  G DN RRLTGHHETS+I +FS+GVANRGASIRIPR V ++  GY EDRRPS+NCDPY V + +++T +L E
Sbjct:   10 SKAVKQQYMELPQGGKV-QAMYIWIDGTGEGLRCKTRTLDSEPKSIEDLPEWNFDGSSTYQAEGSNSDMYLLPAAMFRDPFRKDPNKLVLCEVLKYNRKPAESNLRITCKKVMDMVTDQHPWFGMEQEYTILGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHYRACLYAGVNICGTNAEVMPAQWEFQVGPCEGIDMGDHLWVARFILHRVCEDFGVVASFDPKPIPGNWNGAGCHTNVSTKEMREEGGLKAIEDAIEKLGKRHRYHIRAYDPKGGLDNARRLTGHHETSNIHEFSAGVANRGASIRIPRSVGQEKKGYFEDRRPSANCDPYGVTEALIRTCLLSE 363          
BLAST of Glutamine synthetase vs. Ensembl Medaka
Match: glula (glutamate-ammonia ligase [Source:NCBI gene;Acc:101159856])

HSP 1 Score: 505.368 bits (1300), Expect = 1.770e-177
Identity = 233/355 (65.63%), Postives = 278/355 (78.31%), Query Frame = 2
Query:  371 NKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE 1435
            +K +  +Y+ LPQ   V Q MY+WIDGTGE LR KT+T+D  P     LP WNFDGSST Q+EGSNSD+Y+ P A+F DPFR+  NK+ LCE   Y++ P ESNLR +C +VM  V D HPWFG+EQEYTIL  D +PF WP  GFPG QGPYYCG GA+K +GRDIVEAHYRAC+YAG+ I GTNAEVMPAQWEFQVGPCEGID+GD LW+AR+ILHRV EDFGVV +FDPKPIPG+WNGAG HTN ST +MR   G+  IE+AIEK+ K+H  HI+AYDP  G DN RRLTGHHETS+I +FS+GVANRGASIRIPR V ++  GY EDRRPS+NCDPY V + +++T +L E
Sbjct:   10 SKAVKQQYMELPQGGKV-QAMYIWIDGTGEGLRCKTRTLDSEPKSIEDLPEWNFDGSSTYQAEGSNSDMYLLPAAMFRDPFRKDPNKLVLCEVLKYNRKPAESNLRITCKKVMDMVTDQHPWFGMEQEYTILGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHYRACLYAGVNICGTNAEVMPAQWEFQVGPCEGIDMGDHLWVARFILHRVCEDFGVVASFDPKPIPGNWNGAGCHTNVSTKEMREEGGLKAIEDAIEKLGKRHRYHIRAYDPKGGLDNARRLTGHHETSNIHEFSAGVANRGASIRIPRSVGQEKKGYFEDRRPSANCDPYGVTEALIRTCLLSE 363          
BLAST of Glutamine synthetase vs. Ensembl Medaka
Match: ENSORLT00000017600.2 (glutamine synthetase [Source:NCBI gene;Acc:101163918])

HSP 1 Score: 494.582 bits (1272), Expect = 2.797e-173
Identity = 224/356 (62.92%), Postives = 277/356 (77.81%), Query Frame = 2
Query:  365 RENKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILD 1432
            R NK++  +Y++LPQ +   QV Y+W+DGTGE LR KT+T+D  P     +P WNFDGSST QSEGSNSD+Y+ P+++F DPF    NK+ LCE   Y++LP E+N R+ CNEVMK + +Y  WFG+EQEYT+L +D +PFSWP  GFP  QGPYYCG GAN  +GRDIVE HY+AC+YAG+KI+GTNAEVMP+QWE+QVGPCEGI +GD LW++R++LHRV EDFGV+ T DPKP+ G+WNGAG HTN ST QMR   G+ +IE AIEK+ K H +HI  YDPH G DN RRLTG HETSSI DFS+GVANRGASIRIPRQV +DG GY EDRRP++NCDPY V   I +T +L+
Sbjct:    9 RLNKVVRQQYMSLPQGQKC-QVTYIWVDGTGEGLRNKTRTLDAEPAGIEDIPEWNFDGSSTYQSEGSNSDMYLVPVSMFRDPFTLDPNKLVLCEVLKYNRLPAETNHRHRCNEVMKTLAEYSLWFGMEQEYTLLGLDGHPFSWPTNGFPAPQGPYYCGVGANCAYGRDIVECHYKACLYAGVKISGTNAEVMPSQWEYQVGPCEGIHMGDHLWVSRFLLHRVCEDFGVLATLDPKPVKGNWNGAGCHTNVSTRQMREEGGLQHIEAAIEKLGKNHKKHISTYDPHNGQDNMRRLTGLHETSSIHDFSAGVANRGASIRIPRQVGKDGKGYFEDRRPAANCDPYLVTGIIAETCLLE 363          
BLAST of Glutamine synthetase vs. Planmine SMEST
Match: SMESG000000212.1 (SMESG000000212.1)

HSP 1 Score: 763.451 bits (1970), Expect = 0.000e+0
Identity = 363/363 (100.00%), Postives = 363/363 (100.00%), Query Frame = 2
Query:  347 MPLAKLRENKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE 1435
            MPLAKLRENKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE
Sbjct:    1 MPLAKLRENKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE 363          
BLAST of Glutamine synthetase vs. Planmine SMEST
Match: SMESG000000211.1 (SMESG000000211.1)

HSP 1 Score: 614.379 bits (1583), Expect = 0.000e+0
Identity = 276/335 (82.39%), Postives = 312/335 (93.13%), Query Frame = 2
Query:  431 MYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE 1435
            MY+WIDG+GENLR KT+T+DFVPVKP  +PIWNFDGSSTGQ+EGSNSD+Y+HP+ALFNDPFR  +N++ LCET+ YDQ PH+SNLR+SCNEVMK  EDYHPWFGIEQEYT+LDID+YPFSWPKLGFPGAQGPYYCG G+NKVFGRDI+E+HY+AC+YAG+KIAGTNAEVMPAQWEFQ+GPCEGI+V D LWMARY+LHRVAEDFGVVV+FDPKPI GDWNGAGAHTNYST QMRGP GI YIE+AIEKMSKKH  HI+AYDP +G DNRRRLTG HETS+IDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSV +RI++TTIL++
Sbjct:    1 MYIWIDGSGENLRSKTRTLDFVPVKPKDVPIWNFDGSSTGQAEGSNSDIYLHPVALFNDPFRGKNNRMVLCETFTYDQTPHDSNLRHSCNEVMKAAEDYHPWFGIEQEYTLLDIDLYPFSWPKLGFPGAQGPYYCGVGSNKVFGRDIIESHYKACLYAGVKIAGTNAEVMPAQWEFQIGPCEGINVSDHLWMARYLLHRVAEDFGVVVSFDPKPIAGDWNGAGAHTNYSTIQMRGPGGIKYIEDAIEKMSKKHDLHIEAYDPKKGEDNRRRLTGRHETSTIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVTERIIRTTILED 335          
BLAST of Glutamine synthetase vs. Planmine SMEST
Match: SMESG000000229.1 (SMESG000000229.1)

HSP 1 Score: 540.421 bits (1391), Expect = 0.000e+0
Identity = 257/363 (70.80%), Postives = 292/363 (80.44%), Query Frame = 2
Query:  347 MPLAKLRENKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE 1435
            M  +KLRENKLLL +YL L  P +  QVMY+WIDG+GENLR KT+T+DFVPVKP  +PIWNFDGSSTGQ+EGSNSD+Y+HP+ALFNDPFR  +N++ LCET+ YDQ PH+SNLR+SCNEVMK  EDYHPWFGIEQEYT+LDID+YPFSWPKLGFPGAQG YYCG G+NKVFGRDI+EAHY+AC+YAG+KIAGTNAEVMPAQWEFQ+GPCEGI+               +EDFGVVV+FDPKPI  DWNGAGAHTNYST QMR             KM  K  E           DNRRRLTG HETS+IDDFSSGVANRGASIRIP QVSED CGYLEDRRPSSNCDPYSV +RI++TTIL++
Sbjct:    1 MAYSKLRENKLLLTRYLNLDTPPDQVQVMYIWIDGSGENLRSKTRTLDFVPVKPKDVPIWNFDGSSTGQAEGSNSDIYLHPVALFNDPFRGKNNRMVLCETFTYDQTPHDSNLRHSCNEVMKAAEDYHPWFGIEQEYTLLDIDLYPFSWPKLGFPGAQGLYYCGVGSNKVFGRDIIEAHYKACLYAGVKIAGTNAEVMPAQWEFQIGPCEGIN--------------GSEDFGVVVSFDPKPIAEDWNGAGAHTNYSTIQMRDTL----------KMQLKRCE-----------DNRRRLTGRHETSTIDDFSSGVANRGASIRIPHQVSEDDCGYLEDRRPSSNCDPYSVTERIIRTTILED 328          
BLAST of Glutamine synthetase vs. Planmine SMEST
Match: SMESG000000229.1 (SMESG000000229.1)

HSP 1 Score: 508.064 bits (1307), Expect = 7.621e-180
Identity = 241/335 (71.94%), Postives = 273/335 (81.49%), Query Frame = 2
Query:  431 MYVWIDGTGENLRGKTKTVDFVPVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCETYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWPKLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE 1435
            MY+WIDG+GENLR KT+T+DFVPVKP  +PIWNFDGSSTGQ+EGSNSD+Y+HP+ALFNDPFR  +N++ LCET+ YDQ PH+SNLR+SCNEVMK  EDYHPWFGIEQEYT+LDID+YPFSWPKLGFPGAQG YYCG G+NKVFGRDI+EAHY+AC+YAG+KIAGTNAEVMPAQWEFQ+GPCEGI+               +EDFGVVV+FDPKPI  DWNGAGAHTNYST QMR             KM  K  E           DNRRRLTG HETS+IDDFSSGVANRGASIRIP QVSED CGYLEDRRPSSNCDPYSV +RI++TTIL++
Sbjct:    1 MYIWIDGSGENLRSKTRTLDFVPVKPKDVPIWNFDGSSTGQAEGSNSDIYLHPVALFNDPFRGKNNRMVLCETFTYDQTPHDSNLRHSCNEVMKAAEDYHPWFGIEQEYTLLDIDLYPFSWPKLGFPGAQGLYYCGVGSNKVFGRDIIEAHYKACLYAGVKIAGTNAEVMPAQWEFQIGPCEGIN--------------GSEDFGVVVSFDPKPIAEDWNGAGAHTNYSTIQMRDTL----------KMQLKRCE-----------DNRRRLTGRHETSTIDDFSSGVANRGASIRIPHQVSEDDCGYLEDRRPSSNCDPYSVTERIIRTTILED 300          
BLAST of Glutamine synthetase vs. Planmine SMEST
Match: SMESG000000228.1 (SMESG000000228.1)

HSP 1 Score: 422.935 bits (1086), Expect = 1.386e-143
Identity = 197/200 (98.50%), Postives = 198/200 (99.00%), Query Frame = 2
Query:  836 GAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGAGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE 1435
            GAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILH+VAEDFGVVV FDPKPIPGDWNG GAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE
Sbjct:  281 GAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPAQWEFQVGPCEGIDVGDQLWMARYILHKVAEDFGVVVIFDPKPIPGDWNGEGAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRLTGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYSVIQRIVQTTILDE 480          
The following BLAST results are available for this feature:
BLAST of Glutamine synthetase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GLUL1.636e-18064.54glutamate-ammonia ligase [Source:HGNC Symbol;Acc:H... [more]
GLUL1.636e-18064.54glutamate-ammonia ligase [Source:HGNC Symbol;Acc:H... [more]
GLUL1.636e-18064.54glutamate-ammonia ligase [Source:HGNC Symbol;Acc:H... [more]
GLUL1.636e-18064.54glutamate-ammonia ligase [Source:HGNC Symbol;Acc:H... [more]
GLUL1.935e-17964.54glutamate-ammonia ligase [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Glutamine synthetase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gln-31.843e-17964.62Glutamine synthetase [Source:UniProtKB/TrEMBL;Acc... [more]
gln-31.888e-17964.62Glutamine synthetase [Source:UniProtKB/TrEMBL;Acc... [more]
gln-11.892e-16360.71GLutamiNe synthetase (Glutamate-ammonia ligase) [... [more]
gln-51.867e-15657.46GLutamiNe synthetase (Glutamate-ammonia ligase) [... [more]
gln-26.157e-15658.64Probable glutamine synthetase [Source:UniProtKB/S... [more]
back to top
BLAST of Glutamine synthetase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gs20.000e+066.39gene:FBgn0001145 transcript:FBtr0073495[more]
Gs20.000e+066.39gene:FBgn0001145 transcript:FBtr0343562[more]
Gs20.000e+066.39gene:FBgn0001145 transcript:FBtr0343563[more]
Gs20.000e+066.39gene:FBgn0001145 transcript:FBtr0343561[more]
Gs20.000e+066.39gene:FBgn0001145 transcript:FBtr0073494[more]
back to top
BLAST of Glutamine synthetase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glulb3.720e-18063.89glutamate-ammonia ligase (glutamine synthase) b [S... [more]
glulb3.720e-18063.89glutamate-ammonia ligase (glutamine synthase) b [S... [more]
glulb3.720e-18063.89glutamate-ammonia ligase (glutamine synthase) b [S... [more]
glulb5.553e-18063.46glutamate-ammonia ligase (glutamine synthase) b [S... [more]
glula8.205e-17463.33glutamate-ammonia ligase (glutamine synthase) a [S... [more]
back to top
BLAST of Glutamine synthetase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
c8a1.905e-17663.06complement component 8, alpha polypeptide [Source:... [more]
glul2.301e-17464.15glutamate-ammonia ligase [Source:NCBI gene;Acc:394... [more]
glul3.639e-17464.15glutamate-ammonia ligase [Source:NCBI gene;Acc:394... [more]
stard156.193e-12951.52StAR-related lipid transfer (START) domain contain... [more]
stard156.454e-12951.52StAR-related lipid transfer (START) domain contain... [more]
back to top
BLAST of Glutamine synthetase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Glul0.000e+064.82glutamate-ammonia ligase (glutamine synthetase) [S... [more]
Glul0.000e+064.82glutamate-ammonia ligase (glutamine synthetase) [S... [more]
Glul1.206e-8562.11glutamate-ammonia ligase (glutamine synthetase) [S... [more]
back to top
BLAST of Glutamine synthetase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q04831|GLNA_PANAR0.000e+069.30Glutamine synthetase OS=Panulirus argus OX=6737 PE... [more]
sp|P20478|GLNA2_DROME0.000e+066.39Glutamine synthetase 2 cytoplasmic OS=Drosophila m... [more]
sp|Q8HZM5|GLNA_CANLF0.000e+065.10Glutamine synthetase OS=Canis lupus familiaris OX=... [more]
sp|Q9QY94|GLNA_ACOCA1.341e-18065.63Glutamine synthetase OS=Acomys cahirinus OX=10068 ... [more]
sp|P15105|GLNA_MOUSE2.975e-18064.82Glutamine synthetase OS=Mus musculus OX=10090 GN=G... [more]
back to top
BLAST of Glutamine synthetase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8IP230.000e+071.51Glutamine synthetase OS=Macrostomum lignano OX=282... [more]
A0A087UK010.000e+072.96Glutamine synthetase (Fragment) OS=Stegodyphus mim... [more]
A0A423TMW10.000e+070.99Glutamine synthetase OS=Penaeus vannamei OX=6689 G... [more]
A0A4Y2BM830.000e+072.68Glutamine synthetase OS=Araneus ventricosus OX=182... [more]
L0GC800.000e+070.99Glutamine synthetase OS=Penaeus monodon OX=6687 PE... [more]
back to top
BLAST of Glutamine synthetase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glula7.282e-18065.92glutamine synthetase [Source:NCBI gene;Acc:1030462... [more]
glulb5.955e-17866.20glutamine synthetase [Source:NCBI gene;Acc:1030444... [more]
glulb1.189e-17766.20glutamine synthetase [Source:NCBI gene;Acc:1030444... [more]
glulc4.383e-16458.33glutamine synthetase-like [Source:NCBI gene;Acc:10... [more]
ENSAMXT00000034935.16.133e-11658.45pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Glutamine synthetase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000008530.10.000e+065.83pep scaffold:Pmarinus_7.0:GL476642:753214:761317:-... [more]
back to top
BLAST of Glutamine synthetase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
GLN13.575e-14956.83Glutamine synthetase (GS); synthesizes glutamine f... [more]
back to top
BLAST of Glutamine synthetase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO406060.000e+067.13Glutamine synthetase [Source:UniProtKB/TrEMBL;Acc... [more]
EDO273626.850e-4268.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO258695.668e-622.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glutamine synthetase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
glula1.770e-17765.63glutamate-ammonia ligase [Source:NCBI gene;Acc:101... [more]
glula1.770e-17765.63glutamate-ammonia ligase [Source:NCBI gene;Acc:101... [more]
ENSORLT00000017600.22.797e-17362.92glutamine synthetase [Source:NCBI gene;Acc:1011639... [more]
back to top
BLAST of Glutamine synthetase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000000212.10.000e+0100.00SMESG000000212.1[more]
SMESG000000211.10.000e+082.39SMESG000000211.1[more]
SMESG000000229.10.000e+070.80SMESG000000229.1[more]
SMESG000000229.17.621e-18071.94SMESG000000229.1[more]
SMESG000000228.11.386e-14398.50SMESG000000228.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029103 ID=SMED30029103|Name=Glutamine synthetase|organism=Schmidtea mediterranea sexual|type=transcript|length=1624bp
GGTCTTTGCAACTCAATATTGTTTAATAATCGACCAATAAGGAACCCTTA
ATAAACCTTAATTGATCTGTTCTTATTCTTCTCAATATTCATGTTAAAGT
TGTTCAAATCACCCAAGTAAAAAATGCTTTCAGTAAATGCATAATCTGAT
TGATAAATGATATGCCGATATTCCTGAATCAGATTGTAACATATAAAACT
GAGTGTTGATTCTATCGAATGCATGCTGAATAATAAATGTGCTGACCAAT
AGCCAATAGAGTGCCGTTGTGAGTCCGCTGTGTGCAATTGTGCTCGATTT
TGTATAAATTATGTAATCGTTTCACTAAGATTAAAATTTACAAATCATGC
CATTGGCAAAGTTAAGAGAAAACAAATTGTTGTTAAATAAGTATTTGACA
CTGCCACAGCCGGAAAATGTGACCCAAGTTATGTATGTCTGGATCGACGG
AACCGGAGAAAATCTAAGGGGCAAAACAAAAACCGTCGATTTCGTTCCTG
TTAAGCCATCGCAACTGCCGATTTGGAATTTTGACGGAAGCAGTACAGGT
CAGTCAGAAGGGAGCAATTCTGATGTATATATTCATCCGATTGCTCTATT
CAATGATCCTTTTCGCAGAGGAGATAATAAAATTGCTTTGTGCGAAACGT
ATAACTATGATCAACTTCCTCATGAAAGCAATTTGAGATATAGTTGTAAC
GAAGTAATGAAGAAAGTAGAAGATTATCATCCCTGGTTTGGAATCGAGCA
GGAATATACGATTCTCGACATCGACATGTATCCGTTCTCGTGGCCTAAAC
TTGGTTTCCCTGGTGCTCAAGGACCATATTATTGTGGAGCAGGAGCAAAT
AAAGTTTTTGGGAGAGACATTGTAGAAGCTCATTACAGAGCTTGTATTTA
TGCTGGGATCAAGATTGCTGGAACAAACGCTGAAGTTATGCCCGCTCAGT
GGGAATTTCAAGTAGGTCCATGCGAAGGAATCGATGTCGGTGATCAGTTG
TGGATGGCAAGGTATATCCTACATAGAGTGGCTGAAGATTTTGGAGTAGT
AGTTACCTTTGATCCAAAACCAATTCCGGGTGACTGGAATGGTGCAGGAG
CTCATACAAATTATTCAACGGCTCAGATGAGAGGTCCACAAGGAATAACA
TATATCGAAGAAGCAATAGAAAAAATGTCTAAGAAACACTTTGAACATAT
ACAAGCATACGATCCTCATCAAGGTGCCGATAACAGACGTCGATTAACTG
GTCATCATGAAACAAGTTCAATTGATGACTTTTCATCGGGTGTTGCTAAT
CGCGGTGCATCAATTCGAATTCCCCGCCAAGTGTCCGAAGACGGATGTGG
CTACTTGGAAGATCGAAGGCCATCTTCGAATTGTGATCCCTACTCTGTCA
TACAAAGAATTGTTCAAACCACAATTCTAGATGAATAGAATGAACATGAC
TTTACCAAAGGATTTTGAATGTATTCGTGTTTTATTCGTGTTGATTTTTC
CTTTTTTTTAAATTAAAACTAAAAATCCAAATTTAATCAATTAAAAACAT
TTTAAAAATGAAAATAAATATTTGTTATGTAATTTTACCGACAAAATGAT
TATAAAAGCAAATTAAGAATGAAG
back to top

protein sequence of SMED30029103-orf-1

>SMED30029103-orf-1 ID=SMED30029103-orf-1|Name=SMED30029103-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=364bp
MPLAKLRENKLLLNKYLTLPQPENVTQVMYVWIDGTGENLRGKTKTVDFV
PVKPSQLPIWNFDGSSTGQSEGSNSDVYIHPIALFNDPFRRGDNKIALCE
TYNYDQLPHESNLRYSCNEVMKKVEDYHPWFGIEQEYTILDIDMYPFSWP
KLGFPGAQGPYYCGAGANKVFGRDIVEAHYRACIYAGIKIAGTNAEVMPA
QWEFQVGPCEGIDVGDQLWMARYILHRVAEDFGVVVTFDPKPIPGDWNGA
GAHTNYSTAQMRGPQGITYIEEAIEKMSKKHFEHIQAYDPHQGADNRRRL
TGHHETSSIDDFSSGVANRGASIRIPRQVSEDGCGYLEDRRPSSNCDPYS
VIQRIVQTTILDE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005783endoplasmic reticulum
GO:0005829cytosol
GO:0043231intracellular membrane-bounded organelle
GO:0005737cytoplasm
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0004356glutamate-ammonia ligase activity
GO:0003824catalytic activity
GO:0000166nucleotide binding
GO:0005524ATP binding
GO:0016874ligase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000070intestinal phagocyte
PLANA:0000429neoblast
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036651Gln_synt_N
IPR008146Gln_synth_cat_dom
IPR014746Gln_synth/guanido_kin_cat_dom
IPR008147Gln_synt_b-grasp
IPR027303Gln_synth_gly_rich_site
IPR027302Gln_synth_N_conserv_site
Vocabulary: biological process
TermDefinition
GO:0006807nitrogen compound metabolic process
GO:0006542glutamine biosynthetic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008146Glutamine synthetase, catalytic domainSMARTSM01230Gln_synt_C_2coord: 110..359
e-value: 1.4E-63
score: 227.2
IPR008146Glutamine synthetase, catalytic domainPFAMPF00120Gln-synt_Ccoord: 123..351
e-value: 2.7E-17
score: 62.8
IPR008147Glutamine synthetase, beta-Grasp domainPFAMPF03951Gln-synt_Ncoord: 24..103
e-value: 5.2E-10
score: 38.9
NoneNo IPR availableGENE3DG3DSA:3.30.590.40coord: 111..363
e-value: 1.3E-125
score: 419.9
NoneNo IPR availablePANTHERPTHR20852GLUTAMINE SYNTHETASEcoord: 8..363
NoneNo IPR availablePANTHERPTHR20852:SF43GLUTAMINE SYNTHETASEcoord: 8..363
IPR036651Glutamine synthetase, N-terminal domain superfamilyGENE3DG3DSA:3.10.20.70coord: 3..110
e-value: 6.6E-43
score: 147.0
IPR036651Glutamine synthetase, N-terminal domain superfamilySUPERFAMILYSSF54368Glutamine synthetase, N-terminal domaincoord: 14..109
IPR027302Glutamine synthetase, N-terminal conserved sitePROSITEPS00180GLNA_1coord: 62..79
IPR014746Glutamine synthetase/guanido kinase, catalytic domainSUPERFAMILYSSF55931Glutamine synthetase/guanido kinasecoord: 111..361