ras-related protein Rab-32

Overview
Nameras-related protein Rab-32
Smed IDSMED30029100
Length (bp)1025
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ras-related protein Rab-32 (SMED30029100) t-SNE clustered cells

Violin plots show distribution of expression levels for ras-related protein Rab-32 (SMED30029100) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ras-related protein Rab-32 (SMED30029100) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ras-related protein Rab-32 (SMED30029100) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029100

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30029100SMESG000060721.1 dd_Smed_v4_6128_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30029100SMESG000060721.1 dd_Smed_v4_6128_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ras-related protein Rab-32 vs. Ensembl Human
Match: RAB32 (RAB32, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9772])

HSP 1 Score: 228.409 bits (581), Expect = 1.363e-73
Identity = 116/205 (56.59%), Postives = 148/205 (72.20%), Query Frame = 2
Query:   95 YLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKASQEGEPKEGKINTINVTNKANQQTENSKTNCC 709
            +LFKVLV+GE   GKTSIIKRYVH  FS HYR TIGVDFALKVLN +   +V++QLWDIAGQERFGNMTR YYKEA GAF+V+D++R ST EA +KWK+DLDSKV LPNG+ IP++LL NK D  +    +  + +DQF KEH F+G   TSAK+NI IEE+   LVE ++   Q    +E  ++ I + ++   + EN K+ CC
Sbjct:   24 HLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQNKDSSQS-PSQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILVNHQSFPNEENDVDKIKL-DQETLRAEN-KSQCC 225          
BLAST of ras-related protein Rab-32 vs. Ensembl Human
Match: RAB38 (RAB38, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9776])

HSP 1 Score: 207.608 bits (527), Expect = 1.434e-65
Identity = 101/171 (59.06%), Postives = 128/171 (74.85%), Query Frame = 2
Query:   95 YLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMM 607
            +L+K+LV+G+   GKTSIIKRYVH  FS HYR TIGVDFALKVL+ + + +V++QLWDIAGQERFGNMTR YY+EA GAFIV+DVTR +T EA  KWK DLDSK++LPNG  +  +LL NK D  +   + +   +DQF KEH F G   TSAKENI I+E+   LV+ ++
Sbjct:    8 HLYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKVLHWDPETVVRLQLWDIAGQERFGNMTRVYYREAMGAFIVFDVTRPATFEAVAKWKNDLDSKLSLPNGKPVSVVLLANKCDQGKDVLMNNGLKMDQFCKEHGFVGWFETSAKENINIDEASRCLVKHIL 178          
BLAST of ras-related protein Rab-32 vs. Ensembl Human
Match: RAB29 (RAB29, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9789])

HSP 1 Score: 195.667 bits (496), Expect = 5.027e-61
Identity = 98/213 (46.01%), Postives = 141/213 (66.20%), Query Frame = 2
Query:   80 MADNNYLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKASQEGEPKEGKINTINVTNKA---NQQTENSKTNCC 709
            M   ++LFKVLVVG+   GKTS+++RY    FS HY++T+GVDFALKVL   D +IV++QLWDIAGQERF +MTR YY++AS   I++DVT  +T   + +WK DLDSK+TLPNG  +P +LL NK  C  +      + +D+F KE+ F+G + TS KEN  I E++  L+E MM+ S E        + ++++ +    N QT++S  +CC
Sbjct:    1 MGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDYEIVRLQLWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPNGEPVPCLLLANK--CDLSPWAVSRDQIDRFSKENGFTGWTETSVKENKNINEAMRVLIEKMMRNSTE--------DIMSLSTQGDYINLQTKSSSWSCC 203          
BLAST of ras-related protein Rab-32 vs. Ensembl Human
Match: RAB29 (RAB29, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9789])

HSP 1 Score: 195.667 bits (496), Expect = 5.027e-61
Identity = 98/213 (46.01%), Postives = 141/213 (66.20%), Query Frame = 2
Query:   80 MADNNYLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKASQEGEPKEGKINTINVTNKA---NQQTENSKTNCC 709
            M   ++LFKVLVVG+   GKTS+++RY    FS HY++T+GVDFALKVL   D +IV++QLWDIAGQERF +MTR YY++AS   I++DVT  +T   + +WK DLDSK+TLPNG  +P +LL NK  C  +      + +D+F KE+ F+G + TS KEN  I E++  L+E MM+ S E        + ++++ +    N QT++S  +CC
Sbjct:    1 MGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDYEIVRLQLWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPNGEPVPCLLLANK--CDLSPWAVSRDQIDRFSKENGFTGWTETSVKENKNINEAMRVLIEKMMRNSTE--------DIMSLSTQGDYINLQTKSSSWSCC 203          
BLAST of ras-related protein Rab-32 vs. Ensembl Human
Match: RAB29 (RAB29, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9789])

HSP 1 Score: 195.667 bits (496), Expect = 5.027e-61
Identity = 98/213 (46.01%), Postives = 141/213 (66.20%), Query Frame = 2
Query:   80 MADNNYLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKASQEGEPKEGKINTINVTNKA---NQQTENSKTNCC 709
            M   ++LFKVLVVG+   GKTS+++RY    FS HY++T+GVDFALKVL   D +IV++QLWDIAGQERF +MTR YY++AS   I++DVT  +T   + +WK DLDSK+TLPNG  +P +LL NK  C  +      + +D+F KE+ F+G + TS KEN  I E++  L+E MM+ S E        + ++++ +    N QT++S  +CC
Sbjct:    1 MGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDYEIVRLQLWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPNGEPVPCLLLANK--CDLSPWAVSRDQIDRFSKENGFTGWTETSVKENKNINEAMRVLIEKMMRNSTE--------DIMSLSTQGDYINLQTKSSSWSCC 203          
BLAST of ras-related protein Rab-32 vs. Ensembl Celegans
Match: glo-1 (Gut granule LOss; Rab GTPase GLO-1 [Source:UniProtKB/TrEMBL;Acc:G5EBF0])

HSP 1 Score: 181.415 bits (459), Expect = 8.154e-56
Identity = 94/206 (45.63%), Postives = 135/206 (65.53%), Query Frame = 2
Query:  101 FKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKASQEGE---PKEGKINTINVTNKANQQTENSKTNCC 709
            +KVLV+G+   GKTSII+R+VH  FS +Y+TTIGVDFALK+L ++++ +V +Q+WDI+GQ+R+G MTR YYK+A  A IV D TR  T+E A++WKTDLD KVTL +G+ +P+ILL NK D    ++L D+   D     + F G   TSAKE++GIEE+   L   ++   Q G+   P   +   +N+ +       +SK  CC
Sbjct:   12 YKVLVIGDPGVGKTSIIRRFVHNVFSSNYKTTIGVDFALKILPVDENTVVHLQIWDISGQDRYGVMTRVYYKDAHAAIIVLDSTRERTIEGALRWKTDLDQKVTLADGSPVPAILLANKCDI--DNKLGDDKLYD-LETNNGFVGSFRTSAKESVGIEEAFKFLANTVISTEQGGQYDVPFMNREGNVNLDDNTTHSRYDSK--CC 212          
BLAST of ras-related protein Rab-32 vs. Ensembl Celegans
Match: rab-19 (RAB family [Source:UniProtKB/TrEMBL;Acc:Q9U1W9])

HSP 1 Score: 115.546 bits (288), Expect = 1.337e-30
Identity = 70/213 (32.86%), Postives = 114/213 (53.52%), Query Frame = 2
Query:   92 NYLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRS-------LTSAKENIGIEESVNELVEIMMKASQEGEPKEGKINTINVTNKANQQTENSKTNCC 709
            +YLFK+++VG+   GKT +++R+ +G F     TTIGVDF +K L + D K VK+Q+WD  GQERF  +T+SYY+ A+G  + YD+T   +  +  +W  D+ SK   PN   +  +L+G K D      L D+  ++   +E E   R+        TSAK N+ ++ +  EL  I+ +   +G  ++G   T  + +       +    CC
Sbjct:    8 DYLFKIVLVGDMGVGKTCVVQRFRNGTFVDRQGTTIGVDFTMKTL-VVDGKRVKLQIWDTGGQERFRTITQSYYRSANGIVLCYDITCKQSFGSLQRWIDDV-SKFAAPN---VVKLLIGTKCD------LEDQRAIEA--EEAEMLQRANGMFAMLETSAKGNVNVDNAFLELATILKRQYDQGVVEQGSSGTFQLGSGGTTALGSPWQRCC 207          
BLAST of ras-related protein Rab-32 vs. Ensembl Celegans
Match: rab-19 (RAB family [Source:UniProtKB/TrEMBL;Acc:Q9U1W9])

HSP 1 Score: 115.546 bits (288), Expect = 1.337e-30
Identity = 70/213 (32.86%), Postives = 114/213 (53.52%), Query Frame = 2
Query:   92 NYLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRS-------LTSAKENIGIEESVNELVEIMMKASQEGEPKEGKINTINVTNKANQQTENSKTNCC 709
            +YLFK+++VG+   GKT +++R+ +G F     TTIGVDF +K L + D K VK+Q+WD  GQERF  +T+SYY+ A+G  + YD+T   +  +  +W  D+ SK   PN   +  +L+G K D      L D+  ++   +E E   R+        TSAK N+ ++ +  EL  I+ +   +G  ++G   T  + +       +    CC
Sbjct:    8 DYLFKIVLVGDMGVGKTCVVQRFRNGTFVDRQGTTIGVDFTMKTL-VVDGKRVKLQIWDTGGQERFRTITQSYYRSANGIVLCYDITCKQSFGSLQRWIDDV-SKFAAPN---VVKLLIGTKCD------LEDQRAIEA--EEAEMLQRANGMFAMLETSAKGNVNVDNAFLELATILKRQYDQGVVEQGSSGTFQLGSGGTTALGSPWQRCC 207          
BLAST of ras-related protein Rab-32 vs. Ensembl Celegans
Match: rab-19 (RAB family [Source:UniProtKB/TrEMBL;Acc:Q9U1W9])

HSP 1 Score: 115.546 bits (288), Expect = 1.337e-30
Identity = 70/213 (32.86%), Postives = 114/213 (53.52%), Query Frame = 2
Query:   92 NYLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRS-------LTSAKENIGIEESVNELVEIMMKASQEGEPKEGKINTINVTNKANQQTENSKTNCC 709
            +YLFK+++VG+   GKT +++R+ +G F     TTIGVDF +K L + D K VK+Q+WD  GQERF  +T+SYY+ A+G  + YD+T   +  +  +W  D+ SK   PN   +  +L+G K D      L D+  ++   +E E   R+        TSAK N+ ++ +  EL  I+ +   +G  ++G   T  + +       +    CC
Sbjct:    8 DYLFKIVLVGDMGVGKTCVVQRFRNGTFVDRQGTTIGVDFTMKTL-VVDGKRVKLQIWDTGGQERFRTITQSYYRSANGIVLCYDITCKQSFGSLQRWIDDV-SKFAAPN---VVKLLIGTKCD------LEDQRAIEA--EEAEMLQRANGMFAMLETSAKGNVNVDNAFLELATILKRQYDQGVVEQGSSGTFQLGSGGTTALGSPWQRCC 207          
BLAST of ras-related protein Rab-32 vs. Ensembl Celegans
Match: rab-19 (RAB family [Source:UniProtKB/TrEMBL;Acc:Q9U1W9])

HSP 1 Score: 115.546 bits (288), Expect = 1.337e-30
Identity = 70/213 (32.86%), Postives = 114/213 (53.52%), Query Frame = 2
Query:   92 NYLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRS-------LTSAKENIGIEESVNELVEIMMKASQEGEPKEGKINTINVTNKANQQTENSKTNCC 709
            +YLFK+++VG+   GKT +++R+ +G F     TTIGVDF +K L + D K VK+Q+WD  GQERF  +T+SYY+ A+G  + YD+T   +  +  +W  D+ SK   PN   +  +L+G K D      L D+  ++   +E E   R+        TSAK N+ ++ +  EL  I+ +   +G  ++G   T  + +       +    CC
Sbjct:    8 DYLFKIVLVGDMGVGKTCVVQRFRNGTFVDRQGTTIGVDFTMKTL-VVDGKRVKLQIWDTGGQERFRTITQSYYRSANGIVLCYDITCKQSFGSLQRWIDDV-SKFAAPN---VVKLLIGTKCD------LEDQRAIEA--EEAEMLQRANGMFAMLETSAKGNVNVDNAFLELATILKRQYDQGVVEQGSSGTFQLGSGGTTALGSPWQRCC 207          
BLAST of ras-related protein Rab-32 vs. Ensembl Fly
Match: Rab32 (gene:FBgn0002567 transcript:FBtr0339369)

HSP 1 Score: 209.149 bits (531), Expect = 1.912e-66
Identity = 100/171 (58.48%), Postives = 127/171 (74.27%), Query Frame = 2
Query:   95 YLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMM 607
            +L+K+LV+GE  TGKTS IKRYVH +FS +YR TIGVDFALKVL  + + IV++QLWDIAGQERFGNMTR YYKEA GAFIV+DVTR  T +   KWK DLDSKV LP+G+ IP ILL NK D  +   +     +D++++E+ F+G   TSAKENI I+E+   LV  ++
Sbjct:   10 HLYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAGQERFGNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANKCDQEKQGIITQPEKMDEYVRENGFAGWFETSAKENINIDEAARALVNKIL 180          
BLAST of ras-related protein Rab-32 vs. Ensembl Fly
Match: Rab32 (gene:FBgn0002567 transcript:FBtr0346636)

HSP 1 Score: 209.149 bits (531), Expect = 1.912e-66
Identity = 100/171 (58.48%), Postives = 127/171 (74.27%), Query Frame = 2
Query:   95 YLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMM 607
            +L+K+LV+GE  TGKTS IKRYVH +FS +YR TIGVDFALKVL  + + IV++QLWDIAGQERFGNMTR YYKEA GAFIV+DVTR  T +   KWK DLDSKV LP+G+ IP ILL NK D  +   +     +D++++E+ F+G   TSAKENI I+E+   LV  ++
Sbjct:   10 HLYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAGQERFGNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANKCDQEKQGIITQPEKMDEYVRENGFAGWFETSAKENINIDEAARALVNKIL 180          
BLAST of ras-related protein Rab-32 vs. Ensembl Fly
Match: Rab32 (gene:FBgn0002567 transcript:FBtr0089933)

HSP 1 Score: 209.149 bits (531), Expect = 2.337e-66
Identity = 100/171 (58.48%), Postives = 127/171 (74.27%), Query Frame = 2
Query:   95 YLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMM 607
            +L+K+LV+GE  TGKTS IKRYVH +FS +YR TIGVDFALKVL  + + IV++QLWDIAGQERFGNMTR YYKEA GAFIV+DVTR  T +   KWK DLDSKV LP+G+ IP ILL NK D  +   +     +D++++E+ F+G   TSAKENI I+E+   LV  ++
Sbjct:   18 HLYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAGQERFGNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANKCDQEKQGIITQPEKMDEYVRENGFAGWFETSAKENINIDEAARALVNKIL 188          
BLAST of ras-related protein Rab-32 vs. Ensembl Fly
Match: Rab32 (gene:FBgn0002567 transcript:FBtr0346635)

HSP 1 Score: 211.075 bits (536), Expect = 4.770e-65
Identity = 100/171 (58.48%), Postives = 127/171 (74.27%), Query Frame = 2
Query:   95 YLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMM 607
            +L+K+LV+GE  TGKTS IKRYVH +FS +YR TIGVDFALKVL  + + IV++QLWDIAGQERFGNMTR YYKEA GAFIV+DVTR  T +   KWK DLDSKV LP+G+ IP ILL NK D  +   +     +D++++E+ F+G   TSAKENI I+E+   LV  ++
Sbjct:  185 HLYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAGQERFGNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANKCDQEKQGIITQPEKMDEYVRENGFAGWFETSAKENINIDEAARALVNKIL 355          
BLAST of ras-related protein Rab-32 vs. Ensembl Fly
Match: Rab32 (gene:FBgn0002567 transcript:FBtr0089932)

HSP 1 Score: 210.305 bits (534), Expect = 1.004e-64
Identity = 100/171 (58.48%), Postives = 127/171 (74.27%), Query Frame = 2
Query:   95 YLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMM 607
            +L+K+LV+GE  TGKTS IKRYVH +FS +YR TIGVDFALKVL  + + IV++QLWDIAGQERFGNMTR YYKEA GAFIV+DVTR  T +   KWK DLDSKV LP+G+ IP ILL NK D  +   +     +D++++E+ F+G   TSAKENI I+E+   LV  ++
Sbjct:  184 HLYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAGQERFGNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANKCDQEKQGIITQPEKMDEYVRENGFAGWFETSAKENINIDEAARALVNKIL 354          
BLAST of ras-related protein Rab-32 vs. Ensembl Zebrafish
Match: rab32a (RAB32a, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-031006-10])

HSP 1 Score: 218.009 bits (554), Expect = 7.768e-70
Identity = 120/208 (57.69%), Postives = 144/208 (69.23%), Query Frame = 2
Query:   95 YLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKASQEGEP-KEGKINTINVTNKANQQT--ENSKTNCC 709
            YLFKVLV+GE   GKTSIIKRYVH  FS HYR TIGVDFALKVLN +   +V++QLWDIAGQERFGNMTR YYKEA GAFIV+D+TR ST EA  KWK DLD+KV L NGN IPS+LL NK D  +     + + +D F KE  F G   TSAKENI ++E+   LVE ++  + +G P +E   + I    K +QQT    SK+ CC
Sbjct:   12 YLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSKTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFIVFDITRGSTFEAVSKWKHDLDTKVKLANGNPIPSVLLANKCD-QKKDGSNNSSLMDNFCKEAGFLGWFETSAKENINVDEAARFLVENIL-LNDKGLPYEENNGDKI----KLDQQTAPAESKSGCC 213          
BLAST of ras-related protein Rab-32 vs. Ensembl Zebrafish
Match: rab32a (RAB32a, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-031006-10])

HSP 1 Score: 211.46 bits (537), Expect = 6.588e-67
Identity = 112/210 (53.33%), Postives = 138/210 (65.71%), Query Frame = 2
Query:   95 YLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENI--GIEESVNELVEIMMKASQEGEPKEGKINTINVTNKANQQTENSKTNCC*SR 718
            YLFKVLV+GE   GKTSIIKRYVH  FS HYR TIGVDFALKVLN +   +V++QLWDIAGQERFGNMTR YYKEA GAFIV+D+TR ST EA  KWK DLD+KV L NGN IPS+LL NK D  +     + + +D F KE  F G   TSAK+ +   I + V ++ +I+     +  P+   +  I+ ++  N QT      C  SR
Sbjct:   12 YLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSKTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFIVFDITRGSTFEAVSKWKHDLDTKVKLANGNPIPSVLLANKCD-QKKDGSNNSSLMDNFCKEAGFLGWFETSAKKTMKAAILDQVFKMADILYGIRAKTAPQRQILKNISHSSCLNHQTHVKCAACSSSR 220          
BLAST of ras-related protein Rab-32 vs. Ensembl Zebrafish
Match: zgc:162171 (zgc:162171 [Source:ZFIN;Acc:ZDB-GENE-070424-24])

HSP 1 Score: 207.994 bits (528), Expect = 7.366e-66
Identity = 103/203 (50.74%), Postives = 133/203 (65.52%), Query Frame = 2
Query:   98 LFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKASQEGEPKEGKINTINVTNKANQQTENSKTNC 706
            L KVLV+G+   GKTSIIKRYVH  FS HYR TIGVDFALKVLN +   +V++QLWDIAGQER+GNMTR YY+EA GA +V+D+TR ST +A +KWK DLDSKV L NG  +P++LL NK D  R    +    L+ F ++H F G   TSAK+N  I+ ++  LVE +M   +E  P E   + + +        E S + C
Sbjct:    6 LLKVLVIGDLGVGKTSIIKRYVHQIFSQHYRATIGVDFALKVLNWDHRTVVRLQLWDIAGQERYGNMTRVYYREAVGALVVFDMTRASTFQAVLKWKKDLDSKVALGNGRPLPAVLLANKCDQQRYGLCSKLPKLEHFSRDHGFVGWYETSAKDNTNIDAAIMRLVENIMAVEEENVPVESDPSVLILPAFDYNLKERSDSRC 208          
BLAST of ras-related protein Rab-32 vs. Ensembl Zebrafish
Match: rab38c (RAB38c, member of RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-091118-91])

HSP 1 Score: 204.912 bits (520), Expect = 8.844e-65
Identity = 106/204 (51.96%), Postives = 135/204 (66.18%), Query Frame = 2
Query:   95 YLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKASQEGEPKEGKINTINVTNKANQQTENSKTNC 706
            +LFKVLV+G+   GKTSIIKRYVH  FS HYR TIGVDFALKVL+ +   +V++QLWDIAGQER+GNMTR YY+EA GA IV+DVTR ST +A +KWK DLD KV+L NG  +P++LL NKSD  R    +    LD F KE+ F G   TSAKEN  IE +   LV+ ++ A +E        + + +    N   E  ++ C
Sbjct:    5 HLFKVLVIGDLGVGKTSIIKRYVHQIFSQHYRATIGVDFALKVLHWDSQTVVRLQLWDIAGQERYGNMTRVYYREAVGALIVFDVTRSSTFDAVLKWKDDLDLKVSLNNGKPVPAVLLANKSDQSREGLCSQIPKLDTFCKENGFVGWFETSAKENSNIEAAAKCLVDHIL-AHEENIVNNTDPDVVALPGYNNNTKERVRSRC 207          
BLAST of ras-related protein Rab-32 vs. Ensembl Zebrafish
Match: rab38b (RAB38b, member of RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-091204-345])

HSP 1 Score: 194.512 bits (493), Expect = 1.150e-60
Identity = 98/176 (55.68%), Postives = 127/176 (72.16%), Query Frame = 2
Query:   95 YLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKASQE 622
            +L+K+LV+G+   GKTSIIKRYVH  +S +YR TIGVDFALKVLN  D + V++QLWDIAGQERFGNMTR YY+EA GAFIV+DVTR +T EA  KWK DLDSK+ L NG  I ++LL NK D  R     +   +DQ+ +E+ F G   TSAKEN+ I ++ N LV+ ++ +  +
Sbjct:    8 HLYKILVIGDLGVGKTSIIKRYVHQTYSTNYRATIGVDFALKVLNW-DSETVRLQLWDIAGQERFGNMTRVYYREAMGAFIVFDVTRPATFEAVSKWKEDLDSKLILSNGQSIATVLLANKCDQNRDFLTNNGLKMDQYCRENGFVGWFETSAKENVNINDAANFLVKHIIASEND 182          
BLAST of ras-related protein Rab-32 vs. Ensembl Xenopus
Match: rab32 (RAB32, member RAS oncogene family [Source:NCBI gene;Acc:496729])

HSP 1 Score: 224.942 bits (572), Expect = 3.270e-72
Identity = 113/205 (55.12%), Postives = 142/205 (69.27%), Query Frame = 2
Query:   95 YLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKASQEGEPKEGKINTINVTNKANQQTENSKTNCC 709
            YLFKVLV+GE   GKTSIIKRYVH  FS HYR TIGVDFALKV+N +   +V++QLWDIAGQERFGNMTR YYKEA GAF+V+DVTR ST EA  KWK+DLDSKV LP+G  IP++LL NK D  + + L   + +D F KE+ F+    TSAK+N+ I+E+   LVE ++  ++    +E    +I V  +A      SK  CC
Sbjct:   21 YLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVINWDSSTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDVTRGSTFEAITKWKSDLDSKVFLPSGGPIPAVLLANKCDQKKENSLQSPHQMDNFCKENGFAAWFETSAKDNMNIDEAARCLVENILANAKNFPVEENDDGSIRVDQEA--MPAESKFQCC 223          
BLAST of ras-related protein Rab-32 vs. Ensembl Xenopus
Match: gpx1 (glutathione peroxidase 1 [Source:Xenbase;Acc:XB-GENE-922630])

HSP 1 Score: 208.764 bits (530), Expect = 4.401e-66
Identity = 107/194 (55.15%), Postives = 134/194 (69.07%), Query Frame = 2
Query:   95 YLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELV-EIMMKASQEGEPKEGKINTINVTNKA 673
            +L+K+LV+G+   GKTSIIKRYVH  FS HYR TIGVDFALKVL+ + D +V++QLWDIAGQERFGNMTR YY+EA GAFIV+DVTR +T EA  KWK DLDSK+TL NG  + ++LL NK D  + +       +DQF KEH F     TSAKENI I+E+   LV  I+   S + +P E  I    + N +
Sbjct:    8 HLYKILVIGDLGVGKTSIIKRYVHQNFSPHYRATIGVDFALKVLSWDSDTVVRLQLWDIAGQERFGNMTRVYYREAVGAFIVFDVTRPATFEAVAKWKEDLDSKLTLANGVPVSAVLLANKCDQGKDNFKNHFTKMDQFCKEHGFVAWYETSAKENINIDEASRCLVSHIIASESDQMQPVEPDIVKPQILNSS 201          
BLAST of ras-related protein Rab-32 vs. Ensembl Xenopus
Match: rab32 (RAB32, member RAS oncogene family [Source:NCBI gene;Acc:496729])

HSP 1 Score: 207.608 bits (527), Expect = 4.335e-65
Identity = 113/240 (47.08%), Postives = 142/240 (59.17%), Query Frame = 2
Query:   95 YLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIA-----------------------------------GQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKASQEGEPKEGKINTINVTNKANQQTENSKTNCC 709
            YLFKVLV+GE   GKTSIIKRYVH  FS HYR TIGVDFALKV+N +   +V++QLWDIA                                   GQERFGNMTR YYKEA GAF+V+DVTR ST EA  KWK+DLDSKV LP+G  IP++LL NK D  + + L   + +D F KE+ F+    TSAK+N+ I+E+   LVE ++  ++    +E    +I V  +A      SK  CC
Sbjct:   21 YLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVINWDSSTLVRLQLWDIAALQLKRAQLLLYINVNNTQMVHSIQSAITFALSTTGQERFGNMTRVYYKEAVGAFVVFDVTRGSTFEAITKWKSDLDSKVFLPSGGPIPAVLLANKCDQKKENSLQSPHQMDNFCKENGFAAWFETSAKDNMNIDEAARCLVENILANAKNFPVEENDDGSIRVDQEA--MPAESKFQCC 258          
BLAST of ras-related protein Rab-32 vs. Ensembl Xenopus
Match: ENSXETT00000035921.1 (ras-related protein Rab-32-like [Source:NCBI gene;Acc:100496061])

HSP 1 Score: 196.052 bits (497), Expect = 3.611e-61
Identity = 102/204 (50.00%), Postives = 136/204 (66.67%), Query Frame = 2
Query:   98 LFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKASQEGEPKEGKINTINVTNKANQQTENSKTNCC 709
            L KVLVVG+   GKTSII+RYVH  FS  YR TIGVDFALK++N + + +V++QLWDIAGQERFG+MTR YY+EA GA +V D+ R +T+E+  +WK DLDSKV L NGN IP ILLGNK D V     A    L+Q  +E  FS   +TSAKEN+ IE +++ L++ M+   ++ EP+    N  N+   +   + N   + C
Sbjct:   10 LCKVLVVGDLGVGKTSIIQRYVHNVFSQCYRATIGVDFALKIVNWDLNTMVRLQLWDIAGQERFGHMTRLYYREAVGALVVCDLGRVATVESVSRWKEDLDSKVCLQNGNPIPVILLGNKCDQVPLGTSASN--LEQLGEELGFSHSHMTSAKENVNIEMAISSLIKEMIANDEDYEPR----NDPNIIQPSLHPSVNKACSQC 207          
BLAST of ras-related protein Rab-32 vs. Ensembl Xenopus
Match: rab29 (RAB29, member RAS oncogene family [Source:NCBI gene;Acc:100135159])

HSP 1 Score: 184.496 bits (467), Expect = 8.147e-57
Identity = 93/190 (48.95%), Postives = 123/190 (64.74%), Query Frame = 2
Query:   80 MADNNYLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKASQEGE---PKEG 640
            M+  ++LFKVLVVG+   GKTS+++RYVH  F   Y+ T+GVDFALKV+   D + V++QLWDIAGQERF +MTR YYK+AS   I++D+T   +      WK DLD+KV LPNG+ +P ILL NK  C  +        +DQF KE+ F G + TS KENI I ES+  L+E MM + + G    P  G
Sbjct:    1 MSSFDHLFKVLVVGDSTVGKTSLLQRYVHDVFGKDYKMTMGVDFALKVVQWSDTETVRLQLWDIAGQERFASMTRLYYKQASACVIMFDLTNSESFRNCQMWKDDLDNKVILPNGDFVPCILLANK--CDLSPWAVSRQQIDQFSKENNFIGWTETSVKENININESMRVLIERMMASREAGNSSFPAHG 188          
BLAST of ras-related protein Rab-32 vs. Ensembl Mouse
Match: Rab32 (RAB32, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1915094])

HSP 1 Score: 227.639 bits (579), Expect = 2.022e-73
Identity = 114/205 (55.61%), Postives = 147/205 (71.71%), Query Frame = 2
Query:   95 YLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKASQEGEPKEGKINTINVTNKANQQTENSKTNCC 709
            +LFKVLV+GE   GKTSIIKRYVH  FS HYR TIGVDFALKVLN +   +V++QLWDIAGQERFGNMTR YYKEA GAF+V+D++R ST +A +KWK DLDSKV LPNG+ IP++LL NK D  + +  +  + +DQF K+H F+G   TSAK+NI I+E+   LVE M+ A+Q+  P E +I+   +       T   ++ CC
Sbjct:   22 HLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQLWDIAGQERFGNMTRVYYKEALGAFVVFDISRSSTFDAVLKWKNDLDSKVHLPNGSPIPAVLLANKCDQKKDNSQS-PSQMDQFCKDHGFTGWFETSAKDNINIDEATRFLVENML-ANQQSFPSE-EIDLDRIKLVEEPPTTKPRSQCC 223          
BLAST of ras-related protein Rab-32 vs. Ensembl Mouse
Match: Rab38 (RAB38, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1919683])

HSP 1 Score: 208.764 bits (530), Expect = 3.597e-66
Identity = 102/171 (59.65%), Postives = 128/171 (74.85%), Query Frame = 2
Query:   95 YLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMM 607
            +L+K+LV+G+   GKTSIIKRYVH  FS HYR TIGVDFALKVL+ + + +V++QLWDIAGQERFGNMTR YY+EA GAFIV+DVTR +T EA  KWK DLDSK+TLPNG  +  +LL NK D  +   + +   +DQF KEH F G   TSAKENI I+E+   LV+ ++
Sbjct:    8 HLYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKVLHWDPETVVRLQLWDIAGQERFGNMTRVYYREAMGAFIVFDVTRPATFEAVAKWKNDLDSKLTLPNGKPVSVVLLANKCDQGKDVLMNNGLKMDQFCKEHGFVGWFETSAKENINIDEASRCLVKHIL 178          
BLAST of ras-related protein Rab-32 vs. Ensembl Mouse
Match: Rab29 (RAB29, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:2385107])

HSP 1 Score: 194.512 bits (493), Expect = 8.366e-61
Identity = 98/214 (45.79%), Postives = 139/214 (64.95%), Query Frame = 2
Query:   80 MADNNYLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKASQEGEPKEGKINTINVTNKAN----QQTENSKTNCC 709
            M   ++LFKVLVVG+   GKTS+++RY    FS HY++T+GVDFALKVL   D ++V++QLWDIAGQERF +MTR YY++AS   I++DVT  +T   + +WK DLDSK+TLP+G  +P +LL NKSD   +      + +DQF KE+ F+G + TS KEN  I E++  LVE MM  S+E        + ++++ + N    Q   +S   CC
Sbjct:    1 MGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDSEMVRLQLWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPSGEPVPCLLLANKSDL--SPWAVSRDQIDQFSKENGFTGWTETSVKENKNINEAMRVLVEKMMNNSRE--------DVMSLSTQGNYINLQAKPSSGWTCC 204          
BLAST of ras-related protein Rab-32 vs. Ensembl Mouse
Match: Rab29 (RAB29, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:2385107])

HSP 1 Score: 194.512 bits (493), Expect = 8.366e-61
Identity = 98/214 (45.79%), Postives = 139/214 (64.95%), Query Frame = 2
Query:   80 MADNNYLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKASQEGEPKEGKINTINVTNKAN----QQTENSKTNCC 709
            M   ++LFKVLVVG+   GKTS+++RY    FS HY++T+GVDFALKVL   D ++V++QLWDIAGQERF +MTR YY++AS   I++DVT  +T   + +WK DLDSK+TLP+G  +P +LL NKSD   +      + +DQF KE+ F+G + TS KEN  I E++  LVE MM  S+E        + ++++ + N    Q   +S   CC
Sbjct:    1 MGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDSEMVRLQLWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPSGEPVPCLLLANKSDL--SPWAVSRDQIDQFSKENGFTGWTETSVKENKNINEAMRVLVEKMMNNSRE--------DVMSLSTQGNYINLQAKPSSGWTCC 204          
BLAST of ras-related protein Rab-32 vs. Ensembl Mouse
Match: Rab38 (RAB38, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1919683])

HSP 1 Score: 169.474 bits (428), Expect = 3.250e-52
Identity = 78/110 (70.91%), Postives = 93/110 (84.55%), Query Frame = 2
Query:   95 YLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNG 424
            +L+K+LV+G+   GKTSIIKRYVH  FS HYR TIGVDFALKVL+ + + +V++QLWDIAGQERFGNMTR YY+EA GAFIV+DVTR +T EA  KWK DLDSK+TLPNG
Sbjct:    8 HLYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKVLHWDPETVVRLQLWDIAGQERFGNMTRVYYREAMGAFIVFDVTRPATFEAVAKWKNDLDSKLTLPNG 117          
BLAST of ras-related protein Rab-32 vs. UniProt/SwissProt
Match: sp|Q13637|RAB32_HUMAN (Ras-related protein Rab-32 OS=Homo sapiens OX=9606 GN=RAB32 PE=1 SV=3)

HSP 1 Score: 228.409 bits (581), Expect = 6.544e-73
Identity = 116/205 (56.59%), Postives = 148/205 (72.20%), Query Frame = 2
Query:   95 YLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKASQEGEPKEGKINTINVTNKANQQTENSKTNCC 709
            +LFKVLV+GE   GKTSIIKRYVH  FS HYR TIGVDFALKVLN +   +V++QLWDIAGQERFGNMTR YYKEA GAF+V+D++R ST EA +KWK+DLDSKV LPNG+ IP++LL NK D  +    +  + +DQF KEH F+G   TSAK+NI IEE+   LVE ++   Q    +E  ++ I + ++   + EN K+ CC
Sbjct:   24 HLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQNKDSSQS-PSQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILVNHQSFPNEENDVDKIKL-DQETLRAEN-KSQCC 225          
BLAST of ras-related protein Rab-32 vs. UniProt/SwissProt
Match: sp|Q9CZE3|RAB32_MOUSE (Ras-related protein Rab-32 OS=Mus musculus OX=10090 GN=Rab32 PE=1 SV=3)

HSP 1 Score: 227.639 bits (579), Expect = 1.414e-72
Identity = 114/205 (55.61%), Postives = 147/205 (71.71%), Query Frame = 2
Query:   95 YLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKASQEGEPKEGKINTINVTNKANQQTENSKTNCC 709
            +LFKVLV+GE   GKTSIIKRYVH  FS HYR TIGVDFALKVLN +   +V++QLWDIAGQERFGNMTR YYKEA GAF+V+D++R ST +A +KWK DLDSKV LPNG+ IP++LL NK D  + +  +  + +DQF K+H F+G   TSAK+NI I+E+   LVE M+ A+Q+  P E +I+   +       T   ++ CC
Sbjct:   22 HLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQLWDIAGQERFGNMTRVYYKEALGAFVVFDISRSSTFDAVLKWKNDLDSKVHLPNGSPIPAVLLANKCDQKKDNSQS-PSQMDQFCKDHGFTGWFETSAKDNINIDEATRFLVENML-ANQQSFPSE-EIDLDRIKLVEEPPTTKPRSQCC 223          
BLAST of ras-related protein Rab-32 vs. UniProt/SwissProt
Match: sp|Q06AU5|RAB32_PIG (Ras-related protein Rab-32 OS=Sus scrofa OX=9823 GN=RAB32 PE=2 SV=1)

HSP 1 Score: 221.476 bits (563), Expect = 3.973e-70
Identity = 114/207 (55.07%), Postives = 144/207 (69.57%), Query Frame = 2
Query:   95 YLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKASQ--EGEPKEGKINTINVTNKANQQTENSKTNCC 709
            +LFKVLV+GE   GKTSIIKRYVH  FS HYR TIGVDFALKVLN +   +V++QLWDIAGQERFGNMTR YYKEA GA +V+D++R S  EA +KWK DLDSKV LPNG+ IP++LL NK D  +     + + +DQF KEH F+G   TSAK+NI I+E+   LVE ++   Q    E  +G+I     T K     + +K++CC
Sbjct:   26 HLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQLWDIAGQERFGNMTRVYYKEAVGALVVFDISRGSPFEAVLKWKNDLDSKVHLPNGSPIPAVLLANKCD-QKKDSGQNPSQMDQFCKEHGFTGWFETSAKDNINIDEAARFLVENILANHQSFPSEENDGRIKLDEETMK-----KENKSHCC 226          
BLAST of ras-related protein Rab-32 vs. UniProt/SwissProt
Match: sp|Q8QZZ8|RAB38_MOUSE (Ras-related protein Rab-38 OS=Mus musculus OX=10090 GN=Rab38 PE=1 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 2.516e-65
Identity = 102/171 (59.65%), Postives = 128/171 (74.85%), Query Frame = 2
Query:   95 YLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMM 607
            +L+K+LV+G+   GKTSIIKRYVH  FS HYR TIGVDFALKVL+ + + +V++QLWDIAGQERFGNMTR YY+EA GAFIV+DVTR +T EA  KWK DLDSK+TLPNG  +  +LL NK D  +   + +   +DQF KEH F G   TSAKENI I+E+   LV+ ++
Sbjct:    8 HLYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKVLHWDPETVVRLQLWDIAGQERFGNMTRVYYREAMGAFIVFDVTRPATFEAVAKWKNDLDSKLTLPNGKPVSVVLLANKCDQGKDVLMNNGLKMDQFCKEHGFVGWFETSAKENINIDEASRCLVKHIL 178          
BLAST of ras-related protein Rab-32 vs. UniProt/SwissProt
Match: sp|P57729|RAB38_HUMAN (Ras-related protein Rab-38 OS=Homo sapiens OX=9606 GN=RAB38 PE=1 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 6.887e-65
Identity = 101/171 (59.06%), Postives = 128/171 (74.85%), Query Frame = 2
Query:   95 YLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMM 607
            +L+K+LV+G+   GKTSIIKRYVH  FS HYR TIGVDFALKVL+ + + +V++QLWDIAGQERFGNMTR YY+EA GAFIV+DVTR +T EA  KWK DLDSK++LPNG  +  +LL NK D  +   + +   +DQF KEH F G   TSAKENI I+E+   LV+ ++
Sbjct:    8 HLYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKVLHWDPETVVRLQLWDIAGQERFGNMTRVYYREAMGAFIVFDVTRPATFEAVAKWKNDLDSKLSLPNGKPVSVVLLANKCDQGKDVLMNNGLKMDQFCKEHGFVGWFETSAKENINIDEASRCLVKHIL 178          
BLAST of ras-related protein Rab-32 vs. TrEMBL
Match: A0A2I3H8M2 (Uncharacterized protein OS=Nomascus leucogenys OX=61853 GN=RAB32 PE=4 SV=1)

HSP 1 Score: 231.491 bits (589), Expect = 1.155e-71
Identity = 117/205 (57.07%), Postives = 149/205 (72.68%), Query Frame = 2
Query:   95 YLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKASQEGEPKEGKINTINVTNKANQQTENSKTNCC 709
            +LFKVLV+GE   GKTSIIKRYVH  FS HYR TIGVDFALKVLN +   +V++QLWDIAGQERFGNMTR YYKEA GAF+V+D++R ST EA +KWK+DLDSKV LPNG+ IP++LL NK D  +    +  + +DQF KEH F+G   TSAK+NI IEE+   LVE ++   Q    +E  ++ I + ++ N + E SK+ CC
Sbjct:   24 HLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQNKDSSQS-PSQMDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILANHQSFPNEENDVDKIKL-DQENLRAE-SKSQCC 225          
BLAST of ras-related protein Rab-32 vs. TrEMBL
Match: H2PKJ3 (RAB32 isoform 1 OS=Pongo abelii OX=9601 GN=RAB32 PE=4 SV=1)

HSP 1 Score: 231.491 bits (589), Expect = 1.450e-71
Identity = 118/207 (57.00%), Postives = 148/207 (71.50%), Query Frame = 2
Query:   95 YLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKASQEGEPKEGKINTINVTNKANQQT--ENSKTNCC 709
            +LFKVLV+GE   GKTSIIKRYVH  FS HYR TIGVDFALKVLN +   +V++QLWDIAGQERFGNMTR YYKEA GAF+V+D++R ST EA +KWK+DLDSKV LPNG+ IP++LL NK D  +    +  + +DQF KEH F+G   TSAK+NI IEE+   LVE ++   Q    +E  ++ I    K +Q+T    SK+ CC
Sbjct:   24 HLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQNKDSSQS-PSQMDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILANHQSFPNEENDVDKI----KLDQETMRAESKSQCC 225          
BLAST of ras-related protein Rab-32 vs. TrEMBL
Match: A0A2K5JTR6 (RAB32, member RAS oncogene family OS=Colobus angolensis palliatus OX=336983 GN=RAB32 PE=4 SV=1)

HSP 1 Score: 230.72 bits (587), Expect = 1.544e-71
Identity = 118/207 (57.00%), Postives = 147/207 (71.01%), Query Frame = 2
Query:   95 YLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKASQEGEPKEGKINTINVTNKANQQT--ENSKTNCC 709
            +LFKVLV+GE   GKTSIIKRYVH  FS HYR TIGVDFALKVLN +   +V++QLWDIAGQERFGNMTR YYKEA GAF+V+D++R ST EA +KWK+DLDSKV LPNG+ IP++LL NK D  +    +  + +DQF KEH F+G   TSAK+NI IEE+   LVE ++   Q    +E  +  I    K +Q+T    SK+ CC
Sbjct:    6 HLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQNKDSSQS-PSQMDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILANHQSFPNEENDVGKI----KLDQETLRAESKSQCC 207          
BLAST of ras-related protein Rab-32 vs. TrEMBL
Match: A0A2U3YUM4 (ras-related protein Rab-32 OS=Leptonychotes weddellii OX=9713 GN=RAB32 PE=4 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 2.660e-71
Identity = 114/205 (55.61%), Postives = 146/205 (71.22%), Query Frame = 2
Query:   95 YLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKASQEGEPKEGKINTINVTNKANQQTENSKTNCC 709
            +LFKVLV+GE   GKTSIIKRYVH  FS HYR TIGVDFALKVLN ++  +V++QLWDIAGQERFGNMTR YYKEA GAF+V+D++R ST EA +KWK+DLDSKV LPNG+ IP++LL NK D  +     +   +DQF KEH FSG   TSAK+N+ I+E+   LVE ++   Q    +E  ++ + +  +    T  SK+ CC
Sbjct:   10 HLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDNRTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCD-QKKDGGQNPPQMDQFCKEHGFSGWFETSAKDNVNIDEAARFLVENILANQQSFPNEENDVDKVKLDQET--LTAESKSQCC 211          
BLAST of ras-related protein Rab-32 vs. TrEMBL
Match: A0A0D9RX45 (Uncharacterized protein OS=Chlorocebus sabaeus OX=60711 PE=4 SV=1)

HSP 1 Score: 230.72 bits (587), Expect = 3.066e-71
Identity = 118/207 (57.00%), Postives = 147/207 (71.01%), Query Frame = 2
Query:   95 YLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKASQEGEPKEGKINTINVTNKANQQT--ENSKTNCC 709
            +LFKVLV+GE   GKTSIIKRYVH  FS HYR TIGVDFALKVLN +   +V++QLWDIAGQERFGNMTR YYKEA GAF+V+D++R ST EA +KWK+DLDSKV LPNG+ IP++LL NK D  +    +  + +DQF KEH F+G   TSAK+NI IEE+   LVE ++   Q    +E  +  I    K +Q+T    SK+ CC
Sbjct:   24 HLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQNKDSSQS-PSQMDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILANHQSFPNEENDVGKI----KLDQETLRAESKSQCC 225          
BLAST of ras-related protein Rab-32 vs. Ensembl Cavefish
Match: rab38c (ras-related protein Rab-38-like [Source:NCBI gene;Acc:103035037])

HSP 1 Score: 216.468 bits (550), Expect = 2.844e-69
Identity = 108/204 (52.94%), Postives = 140/204 (68.63%), Query Frame = 2
Query:   95 YLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKASQEGEPKEGKINTINVTNKANQQTENSKTNC 706
            +LFKVLV+G+   GKTSIIKRYVH  FS HYR TIGVDFALKVLN +   ++++QLWDIAGQER+GNMTR YY+EA GA IV+DVTR ST +A +KWK DLDSKVTL NG  +P++LL NKSD +R    +    LD F KE+ F     TSAKEN  IE +   LV+ ++ A +E    +   +T+ +    N   ++ +T+C
Sbjct:    5 HLFKVLVIGDLGVGKTSIIKRYVHQIFSQHYRATIGVDFALKVLNWDSQTVIRLQLWDIAGQERYGNMTRVYYREAVGALIVFDVTRASTFDAVLKWKDDLDSKVTLSNGKPVPAVLLANKSDQLREGVCSQIPKLDTFCKENGFVSWFETSAKENTNIEAAARCLVQHIL-AHEENTVNDSDPDTVTLPGYNNNTKDHGRTSC 207          
BLAST of ras-related protein Rab-32 vs. Ensembl Cavefish
Match: rab32a (ras-related protein Rab-32 [Source:NCBI gene;Acc:103025939])

HSP 1 Score: 213.001 bits (541), Expect = 6.586e-68
Identity = 111/181 (61.33%), Postives = 130/181 (71.82%), Query Frame = 2
Query:   95 YLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKASQEGEPKE 637
            YLFKVLV+GE   GKTSIIKRYVH  FS HYR TIGVDFALKV+N +   +V++QLWDIAGQERFGNMTR YYKEA GAF+V+DVTR ST EA  KWK DLDSKV L NGN IPS+LL NK D  +       + +D F KE  F G   TSAKENI ++E+   LVE ++  + +G P E
Sbjct:   12 YLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVINWDSKTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDVTRSSTFEAVSKWKHDLDSKVKLANGNPIPSVLLANKCD-QKKDGSNSASLMDTFCKETGFLGWFETSAKENINVDEAARFLVENIL-LNDKGLPYE 190          
BLAST of ras-related protein Rab-32 vs. Ensembl Cavefish
Match: zgc:162171 (ras-related protein Rab-38-like [Source:NCBI gene;Acc:103045050])

HSP 1 Score: 200.29 bits (508), Expect = 7.434e-63
Identity = 96/175 (54.86%), Postives = 124/175 (70.86%), Query Frame = 2
Query:   98 LFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKASQE 622
            L KVLV+G+   GKT+IIKRYVH  FS HYR TIGVDFALKVLN +   ++++QLWDIAGQER+GNMTR YY+EA GA +V+D+TR ST +A +KWK DLDSKV L NG  +P++LL NK D  +    A    LD F ++H F G   TSAK+N  I+ ++  LVE ++ +  E
Sbjct:    6 LLKVLVIGDLGVGKTAIIKRYVHQVFSQHYRATIGVDFALKVLNWDHRTVIRLQLWDIAGQERYGNMTRVYYREAVGALVVFDMTRASTFQAVLKWKMDLDSKVALNNGRPVPAVLLANKCDQQKQGLCARLPKLDTFSRDHGFVGWYETSAKDNTNIDAAIMCLVENILASDVE 180          
BLAST of ras-related protein Rab-32 vs. Ensembl Cavefish
Match: zgc:162171 (ras-related protein Rab-38-like [Source:NCBI gene;Acc:103045050])

HSP 1 Score: 200.29 bits (508), Expect = 7.434e-63
Identity = 96/175 (54.86%), Postives = 124/175 (70.86%), Query Frame = 2
Query:   98 LFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKASQE 622
            L KVLV+G+   GKT+IIKRYVH  FS HYR TIGVDFALKVLN +   ++++QLWDIAGQER+GNMTR YY+EA GA +V+D+TR ST +A +KWK DLDSKV L NG  +P++LL NK D  +    A    LD F ++H F G   TSAK+N  I+ ++  LVE ++ +  E
Sbjct:    6 LLKVLVIGDLGVGKTAIIKRYVHQVFSQHYRATIGVDFALKVLNWDHRTVIRLQLWDIAGQERYGNMTRVYYREAVGALVVFDMTRASTFQAVLKWKMDLDSKVALNNGRPVPAVLLANKCDQQKQGLCARLPKLDTFSRDHGFVGWYETSAKDNTNIDAAIMCLVENILASDVE 180          
BLAST of ras-related protein Rab-32 vs. Ensembl Cavefish
Match: rab38b (ras-related protein Rab-38-like [Source:NCBI gene;Acc:103040837])

HSP 1 Score: 198.364 bits (503), Expect = 2.726e-62
Identity = 103/170 (60.59%), Postives = 127/170 (74.71%), Query Frame = 2
Query:   95 YLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYL--DQFIKEHEFSGRSLTSAKENIGIEESVNELVE 598
            +L+K+LV+G+   GKTSIIKRYVH  +S +YR TIGVDFALKVLN  D + V++QLWDIAGQERFGNMTR YY+EA GAFIV+DVTR +TLEA  KWK DLDSK+TL NG  I ++LL NK  C ++ ++   N L  DQF +E+   G   TSAKENI I E+ N LV+
Sbjct:    8 HLYKILVIGDLGVGKTSIIKRYVHQTYSTNYRATIGVDFALKVLNW-DSETVRLQLWDIAGQERFGNMTRVYYREAMGAFIVFDVTRPTTLEAVTKWKEDLDSKLTLANGKSIATVLLANK--CDQSKEVVANNGLKMDQFCQENGIVGWFETSAKENININEAANFLVK 174          
BLAST of ras-related protein Rab-32 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000406.1 (pep scaffold:Pmarinus_7.0:GL478061:71799:86849:1 gene:ENSPMAG00000000366.1 transcript:ENSPMAT00000000406.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 205.682 bits (522), Expect = 9.829e-66
Identity = 107/211 (50.71%), Postives = 139/211 (65.88%), Query Frame = 2
Query:   95 YLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAH---QLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMK---ASQEGEPKEGKINTINVTNKANQQTENSKTNCC 709
            +LFKVLV+GE   GKTSIIKRYVH  FS+ YR TIGVDFALKVL  + D  V++QLWDIAGQERFGNMTR YYKEA GA +V+DVTR +T EA  KWK DLDSKVTLP+G  IP++LL NK D        + +D   LD++ ++  F G   TSAKENI +E +   LV+ ++    +S +G  +    +++ +T +        +  CC
Sbjct:   11 FLFKVLVIGELGVGKTSIIKRYVHHVFSHGYRATIGVDFALKVLGWDADTTVRLQLWDIAGQERFGNMTRVYYKEAVGAMVVFDVTRATTFEAVSKWKHDLDSKVTLPSGKPIPTVLLANKCDGDGGDARGEWSDTAQLDRYCRDEGFVGWFETSAKENINVEAAAQLLVQRILANDVSSAQGCRRCEDTDSVKLTTRNGGA---RRRKCC 218          
BLAST of ras-related protein Rab-32 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006605.1 (pep scaffold:Pmarinus_7.0:GL479131:3746:14175:-1 gene:ENSPMAG00000005962.1 transcript:ENSPMAT00000006605.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 140.969 bits (354), Expect = 6.439e-41
Identity = 78/205 (38.05%), Postives = 126/205 (61.46%), Query Frame = 2
Query:   98 LFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCV-RAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKASQEGEPKEGKINTINVTNKANQQTENSKTNCC 709
            LFKV+VVGE + GKTS ++RY    F+ +YR T+GVDFA KVL   D +++K+ LWD+AGQER+ + T+ +Y+ ASG  ++YD+T   + + A+ WK  +D+  +LP+G+ +P +LLGNKSD   R    AD   +++  +EH+F      S K+N  I +++  LVE MM    +   +  + + + + N+     E +  +CC
Sbjct:    7 LFKVVVVGEVQVGKTSFVQRYSRNAFTENYRMTMGVDFAYKVLKWTDTQMIKLHLWDVAGQERYMSATKQFYRGASGCVVIYDLTSRQSFDKALLWKESIDAHASLPDGSPVPCLLLGNKSDLSEREVSAAD---MERACREHKFLACKEVSVKKNKNIGDAMRCLVEAMMGWVAKNSSQSLEQDNVQLNNE-----EKASWSCC 203          
BLAST of ras-related protein Rab-32 vs. Ensembl Sea Lamprey
Match: rab30 (RAB30, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-040718-250])

HSP 1 Score: 107.842 bits (268), Expect = 3.259e-28
Identity = 68/219 (31.05%), Postives = 109/219 (49.77%), Query Frame = 2
Query:   77 KMADNNYLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSL-TSAKENIGIEESVNELV-EIMMKASQ------EGEPKEGKINTINVTNKANQQTENSKTNCC 709
            +M D + LFK++++G    GKT +++R+  G F      TIGVDF +K + ++  KI K+Q+WD AGQERF ++T+SYY+ A    + YDV+   T      W  +++   +      +P +L+GNK D     Q+  E   + F + H    R L TSAKE   +E    EL   + + A Q       G P+        +    + +  +  T+CC
Sbjct:    2 RMEDCDLLFKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEVDGTKI-KLQIWDTAGQERFRSITQSYYRSAHALVLTYDVSSEETFACLPAWLREMEQHAS----AHVPRVLVGNKLDLADVRQVTREQA-EAFARLHGL--RYLETSAKEAENVERLFVELARRLALDARQPALGDAPGPPRSHSCGPGGL--PGDGKPVSYFTSCC 210          
BLAST of ras-related protein Rab-32 vs. Ensembl Sea Lamprey
Match: rab4b (RAB4B, member RAS oncogene family [Source:NCBI gene;Acc:445498])

HSP 1 Score: 103.219 bits (256), Expect = 2.126e-26
Identity = 64/164 (39.02%), Postives = 92/164 (56.10%), Query Frame = 2
Query:   92 NYLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFS--TLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDC--------VRAHQLADENYLDQFIKEHEFSGRSLTSA 553
            ++LFK LV+G   TGK+ ++ +++   F      TIGV+F  KV+N    K VK+Q+WD AGQERF ++TRSYY+ A+GA +VYD+T  S  T  A   W  D  +  + PN   I  IL GNK D         + A + A EN L  F++    +G ++  A
Sbjct:   10 DFLFKFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGVEFGSKVVN-TGGKTVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSGSRETYNALTNWLADARTLAS-PN---IAIILCGNKKDLEPDREVTFLEASRFAQENEL-MFLETSALTGENVEEA 167          
BLAST of ras-related protein Rab-32 vs. Ensembl Sea Lamprey
Match: RAB29 (RAB29, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9789])

HSP 1 Score: 99.7525 bits (247), Expect = 5.413e-26
Identity = 52/119 (43.70%), Postives = 68/119 (57.14%), Query Frame = 2
Query:  275 GQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKASQEGEP 631
            GQERF +MTR YYK+A+G  +++DV    +    +KWK DLDSK  LP+G  IP ILL NKSD            ++QF ++  F G + TS K N  I +S+  LVE MM      EP
Sbjct:    1 GQERFTSMTRLYYKDAAGCIVMFDVASLPSFHNCLKWKRDLDSKAFLPDGRPIPCILLANKSD--LPDWAMSRAEIEQFSRDSGFLGWAETSVKMNHNITDSIRVLVEEMMCVGSAEEP 117          
BLAST of ras-related protein Rab-32 vs. Ensembl Yeast
Match: YPT7 (Rab family GTPase; GTP-binding protein of the rab family; required for homotypic fusion event in vacuole inheritance, for endosome-endosome fusion; localizes to sites of contact between the vacuole and mitochondria (vCLAMPs); interacts with the cargo selection/retromer complex for retrograde sorting; similar to mammalian Rab7 [Source:SGD;Acc:S000004460])

HSP 1 Score: 109.768 bits (273), Expect = 4.187e-29
Identity = 55/174 (31.61%), Postives = 95/174 (54.60%), Query Frame = 2
Query:   98 LFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKASQ 619
            + KV+++G+   GKTS++ RYV+  +S  Y+ TIG DF  K + ++ DK+  +Q+WD AGQERF ++  ++Y+ A    +VYDVT  S+ E    W+ +      + +    P ++LGNK D   + ++  E    +  K        LTSAK  I ++ +  E+    ++ +Q
Sbjct:    8 ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDGDKVATMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFPFVILGNKIDAEESKKIVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQNQ 181          
BLAST of ras-related protein Rab-32 vs. Ensembl Yeast
Match: YPT6 (Rab family GTPase; required for endosome-to-Golgii, intra-Golgi retrograde, and retrograde Golgi-to-ER transport; temporarily at the Golgi, dissociating into the cytosol on arrival of the late Golgi GTPase Ypt32p; Golgi-localized form is GTP bound, while cytosolic form is GDP-bound; required for delivery of Atg9p to the phagophore assembly site during autophagy under heat stress, with Ypt6p for starvation induced autophagy and for the CVT pathway; homolog of mammalian Rab6 [Source:SGD;Acc:S000004252])

HSP 1 Score: 101.679 bits (252), Expect = 4.820e-26
Identity = 52/131 (39.69%), Postives = 82/131 (62.60%), Query Frame = 2
Query:  101 FKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADE 493
            +K++ +GE   GKTS+I R+++  F  HY+ TIG+DF  K + L DDK +++QLWD AGQERF ++  SY +++  A IVYD+T+  + E   KW  D+ ++    N   +   ++GNKSD     Q++ E
Sbjct:   11 YKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYL-DDKTIRLQLWDTAGQERFRSLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDVKNERGDEN---VILCIVGNKSDLSDERQISTE 137          
BLAST of ras-related protein Rab-32 vs. Ensembl Yeast
Match: YPT32 (Rab family GTPase involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; protein abundance increases in response to DNA replication stress; YPT32 has a paralog, YPT31, that arose from the whole genome duplication [Source:SGD;Acc:S000003178])

HSP 1 Score: 101.679 bits (252), Expect = 6.404e-26
Identity = 67/221 (30.32%), Postives = 115/221 (52.04%), Query Frame = 2
Query:   86 DNNYLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNEL-VEIMMKASQE------------GEPKEGKINTINVTNKANQQTENSKTNCC 709
            D +YLFK++++G+   GK++++ R+    F+   ++TIGV+FA + + +E+ KI K Q+WD AGQER+  +T +YY+ A GA IVYD+++ S+ E    W T+L         + +   L+GNKSD      +  +     F  E++    + TSA  +  ++++  EL V I    S+             G     K  TI++T    +  +   +NCC
Sbjct:    9 DYDYLFKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVENKKI-KAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENAD----DNVAVGLIGNKSDLAHLRAVPTDE-AKNFAMENQML-FTETSALNSDNVDKAFRELIVAIFQMVSKHQVDLSGSGTNNMGSNGAPKGPTISLTPAPKEDKKKKSSNCC 222          
BLAST of ras-related protein Rab-32 vs. Ensembl Yeast
Match: YPT31 (Rab family GTPase; involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; YPT31 has a paralog, YPT32, that arose from the whole genome duplication; localizes to the transitional and late Golgi [Source:SGD;Acc:S000000833])

HSP 1 Score: 100.908 bits (250), Expect = 1.095e-25
Identity = 65/221 (29.41%), Postives = 113/221 (51.13%), Query Frame = 2
Query:   86 DNNYLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEF---SGRSLTSAKENIGIEESVNELVEIMMKASQE--GEPKEGKIN--------TINVTNKANQQTENSKTNCC 709
            D + LFK++++G+   GK++++ R+    F+   ++TIGV+FA + L + D K +K Q+WD AGQER+  +T +YY+ A GA IVYD+++ S+ E    W ++L         + +   L+GNKSD      +  E     F +E++       +L S   +   EE +N + + + K   +       G  N        TI++T   N+  + +  NCC
Sbjct:    9 DYDLLFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEI-DGKRIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENAD----DNVAVGLIGNKSDLAHLRAVPTEES-KTFAQENQLLFTETSALNSENVDKAFEELINTIYQKVSKHQMDLGDSSANGNANGASAPNGPTISLTPTPNENKKANGNNCC 223          
BLAST of ras-related protein Rab-32 vs. Ensembl Yeast
Match: YPT1 (Rab family GTPase; involved in the ER-to-Golgi step of the secretory pathway; complex formation with the Rab escort protein Mrs6p is required for prenylation of Ypt1p by type II protein geranylgeranyltransferase (Bet2p-Bet4p); binds to unspliced HAC1 mRNA; regulates the unfolded protein response (UPR) by promoting the decay of HAC1 RNA; localizes to the early Golgi, the transitional Golgi and ER membranes, pre-autophagosomal structures, and cytoplasmic vesicles [Source:SGD;Acc:S000001856])

HSP 1 Score: 99.3673 bits (246), Expect = 2.933e-25
Identity = 67/209 (32.06%), Postives = 112/209 (53.59%), Query Frame = 2
Query:   92 NYLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELV-EIMMKASQE--GEPKEGKINTINVTNKANQQTENSKTNCC 709
            +YLFK+L++G    GK+ ++ R+    ++  Y +TIGVDF +K + L D K VK+Q+WD AGQERF  +T SYY+ + G  IVYDVT   +      W  ++D   T    + +  +L+GNK D ++  ++ + +   +F   ++      TSA ++  +E++   +  +I    SQ+   E  + K +  NV N   Q   N+   CC
Sbjct:    6 DYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVEL-DGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYAT----STVLKLLVGNKCD-LKDKRVVEYDVAKEFADANKMPFLE-TSALDSTNVEDAFLTMARQIKESMSQQNLNETTQKKEDKGNV-NLKGQSLTNTGGGCC 206          
BLAST of ras-related protein Rab-32 vs. Ensembl Nematostella
Match: EDO36757 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHS5])

HSP 1 Score: 180.259 bits (456), Expect = 2.906e-55
Identity = 92/199 (46.23%), Postives = 131/199 (65.83%), Query Frame = 2
Query:   95 YLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKASQEGEPKEGKINTINVTNKANQQTEN 691
            +L+KVLV+GEY  GKTSII+RY  GYFS +Y+ TIGVDFALK+++ ++   + +QLWD+AG ERFG+MTR YYK A  A IV+D++R +T +A +KW  D++ KV L N N IP I+L NK  C       DE  LDQF + + F+G   TSAKE+  I++++  LV+ ++  S  GE ++  +     T+  N   EN
Sbjct:   15 HLYKVLVIGEYGVGKTSIIRRYTEGYFSPNYKLTIGVDFALKIIHWDEKTKINLQLWDVAGHERFGHMTRVYYKYAIAAIIVFDLSRSATFDAILKWYRDVNQKVMLTNENPIPVIILANK--CDLEDYPVDEEKLDQFCQNNGFAGWFATSAKEDYNIDDAMRFLVQAILSTS--GECRKPSLQDSRCTSPINVLAEN 209          
BLAST of ras-related protein Rab-32 vs. Ensembl Nematostella
Match: EDO48072 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK04])

HSP 1 Score: 172.94 bits (437), Expect = 1.700e-53
Identity = 83/162 (51.23%), Postives = 109/162 (67.28%), Query Frame = 2
Query:   98 LFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESV 583
            LFKVL+VG+   GKTS ++RYVHG     Y+ TIGVDFALKV+    D  V++QLWDIAGQERF +MTR YYK A+   I++D+T   T  + IKWK DLDSK  LPNG  IP IL+GNKSD + A  +  E  +D+  ++H F G +  S KE + + E++
Sbjct:    5 LFKVLIVGDATVGKTSFVQRYVHGNTRREYKPTIGVDFALKVIPWAQDATVRLQLWDIAGQERFTSMTRVYYKGAAACVIMFDLTSQQTFNSTIKWKNDLDSKCKLPNGKPIPCILVGNKSD-LSARPVPKET-IDKLCRDHSFLGWTEMSVKEEVNVSETM 164          
BLAST of ras-related protein Rab-32 vs. Ensembl Nematostella
Match: EDO46057 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR62])

HSP 1 Score: 159.073 bits (401), Expect = 1.324e-47
Identity = 80/178 (44.94%), Postives = 115/178 (64.61%), Query Frame = 2
Query:  101 FKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKASQEGEPK 634
            FKVLVVG+  TGK S +KRYV+  +   Y+ TIGVDFALK +    +  +++Q+W IAGQERF +MTR YYK A    +++D+ R +TL+ AIKWK DLDSK  L +   +P IL+GNKSD     +  D+  +D+  KEH F   +  S KE+I +++ +  LV+ +M+  +EG  K
Sbjct:    9 FKVLVVGDILTGKQSFVKRYVNNIWHPLYKPTIGVDFALKTIQWAQNTTIRLQIWLIAGQERFSSMTRVYYKGADACVVLFDLERQTTLDGAIKWKKDLDSKYKLHSRKPVPCILVGNKSDL--PDRPVDKEIIDKLCKEHSFLCWTEMSVKEDINVKKPMEYLVKHLMEDGKEGNKK 184          
BLAST of ras-related protein Rab-32 vs. Ensembl Nematostella
Match: EDO44528 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV85])

HSP 1 Score: 119.783 bits (299), Expect = 1.373e-32
Identity = 66/186 (35.48%), Postives = 109/186 (58.60%), Query Frame = 2
Query:   86 DNNYLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCV--RAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKASQEGEPKE 637
            D ++LFK+L++G+   GK+S++ R+    FS  Y TTIGVDF ++ +N++ +K VK+Q+WD AGQERF  +T +YY+   G  +VYDVT   T     +W  ++D      N + +  IL+GNK DC   +  + AD     + +    F     TSAKENI +EE  + + +++++  +  + K+
Sbjct:    4 DYDHLFKLLIIGDSGVGKSSLLLRFADNMFSGSYITTIGVDFKIRTINIDGEK-VKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSADTFVNVKRWLHEID-----QNCDDVIRILVGNKDDCPSKKVVETADLQKFGEQMNIRVFE----TSAKENINVEEIFSSITKLVLEKKKADQVKQ 179          
BLAST of ras-related protein Rab-32 vs. Ensembl Nematostella
Match: EDO47471 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMA6])

HSP 1 Score: 111.694 bits (278), Expect = 1.879e-29
Identity = 70/207 (33.82%), Postives = 116/207 (56.04%), Query Frame = 2
Query:   92 NYLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSL-TSAKENIGIEESVNELVEIMMKASQEGEPKEGKINTINVTNKANQQTENSKTNCC 709
            +YLFK+L++G+   GKT I+ R+    F+  + +TIG+DF +K + ++  KI K+Q+WD AGQERF  +T SYY+ A G  +VYD+T+  T +   KW  +++          +  ++LGNK D +   ++      +Q  +EH    R L TSAK NI IE++   L + ++K     + +E   N I+V ++ ++     K  CC
Sbjct:    7 DYLFKLLLIGDSGVGKTCILFRFSDDAFNTTFISTIGIDFKIKTIEMQGKKI-KLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITQEKTFDNISKWLRNIEEHAN----EDVEKMILGNKCD-MDDRRIVSRERGEQIAREHGI--RFLETSAKTNINIEQAFQYLAQDILKKELNKDSEEPS-NNIHVHDQKDK-----KGGCC 199          
BLAST of ras-related protein Rab-32 vs. Ensembl Medaka
Match: rab32a (RAB32, member RAS oncogene family [Source:NCBI gene;Acc:101161453])

HSP 1 Score: 214.927 bits (546), Expect = 1.095e-68
Identity = 112/205 (54.63%), Postives = 141/205 (68.78%), Query Frame = 2
Query:   95 YLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKASQEGEPKEGKINTINVTNKANQQTENSKTNCC 709
            YLFKVLV+GE   GKTSIIKRYVH  FS HYR TIGVDFALKV+N +   +V++QLWDIAGQERFGNMTR YYKEA GAF+V+DVTR +T EA  KWK DLDSKV L NGN IP++LL NK D  +     +   +D+F K+  F G   TSAK+NI ++++   LVE ++ A+ +G P+E + N  +           SK+ CC
Sbjct:   12 YLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVINWDSKTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDVTRGATFEAVSKWKHDLDSKVKLTNGNPIPAVLLANKCD-QKKESPNNTPLMDKFCKDTGFLGWFETSAKDNINVDDAARFLVEHIL-ANDKGLPQE-ESNGDHFKLDPKTAAAESKSGCC 213          
BLAST of ras-related protein Rab-32 vs. Ensembl Medaka
Match: rab38c (ras-related protein Rab-32-like [Source:NCBI gene;Acc:101156599])

HSP 1 Score: 213.001 bits (541), Expect = 6.826e-68
Identity = 107/212 (50.47%), Postives = 145/212 (68.40%), Query Frame = 2
Query:   77 KMADNNYLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADE-NYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKASQEGEPKEGKINTINVTNKANQQTENSKTNCC 709
            +M    +LFKVLV+G+   GKTSIIKRYVH  FS HYR TIGVDF LKVL  ++D++V++QLWDIAGQER+GNMTR YY+EA GA +V+DVTR ST +A +KWK DLDSKVTL +G  +P++LL NKSD     Q+A +   LD F +E+ F G   TSAK+N  IEE+   LVE ++  ++E    E +  ++ ++   N    + + + C
Sbjct:    9 EMQQQEFLFKVLVIGDLGVGKTSIIKRYVHQIFSQHYRATIGVDFVLKVLQWDNDRVVRLQLWDIAGQERYGNMTRVYYREAVGALVVFDVTRASTFDAVLKWKDDLDSKVTLSHGRPVPAVLLANKSD-----QMASQVPKLDSFCRENGFVGWFGTSAKDNTNIEEAARCLVEHIL-TNEESPAAERESGSLILSGHTNTTKNHFRCSSC 214          
BLAST of ras-related protein Rab-32 vs. Ensembl Medaka
Match: rab38c (ras-related protein Rab-32-like [Source:NCBI gene;Acc:101156599])

HSP 1 Score: 210.69 bits (535), Expect = 5.610e-67
Identity = 106/206 (51.46%), Postives = 143/206 (69.42%), Query Frame = 2
Query:   95 YLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADE-NYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKASQEGEPKEGKINTINVTNKANQQTENSKTNCC 709
            +LFKVLV+G+   GKTSIIKRYVH  FS HYR TIGVDF LKVL  ++D++V++QLWDIAGQER+GNMTR YY+EA GA +V+DVTR ST +A +KWK DLDSKVTL +G  +P++LL NKSD     Q+A +   LD F +E+ F G   TSAK+N  IEE+   LVE ++  ++E    E +  ++ ++   N    + + + C
Sbjct:   24 FLFKVLVIGDLGVGKTSIIKRYVHQIFSQHYRATIGVDFVLKVLQWDNDRVVRLQLWDIAGQERYGNMTRVYYREAVGALVVFDVTRASTFDAVLKWKDDLDSKVTLSHGRPVPAVLLANKSD-----QMASQVPKLDSFCRENGFVGWFGTSAKDNTNIEEAARCLVEHIL-TNEESPAAERESGSLILSGHTNTTKNHFRCSSC 223          
BLAST of ras-related protein Rab-32 vs. Ensembl Medaka
Match: rab38b (ras-related protein Rab-38 [Source:NCBI gene;Acc:101171270])

HSP 1 Score: 201.06 bits (510), Expect = 2.902e-63
Identity = 101/177 (57.06%), Postives = 130/177 (73.45%), Query Frame = 2
Query:   95 YLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENY-LDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKASQE 622
            +L+KVLV+G+   GKTSII+RYVH  +S +YR TIGVDFALKVLN  D + V++QLWDIAGQERFGNMTR YY+EA GAFIV+DVTR +T EA +KWK DLDSK  L NG+ I ++LL NK D +R   L +    +DQF K+H F G   TSAK+N+ ++E+ N L++ MM    +
Sbjct:   18 HLYKVLVIGDLGVGKTSIIRRYVHQTYSTNYRATIGVDFALKVLNW-DSETVRLQLWDIAGQERFGNMTRVYYREAMGAFIVFDVTRPTTFEAVLKWKEDLDSKAMLANGSSIATVLLANKCDQIR--DLTNNGLKMDQFCKDHGFIGWFETSAKDNLNLKEAANFLIKHMMATEND 191          
BLAST of ras-related protein Rab-32 vs. Ensembl Medaka
Match: RAB38 (RAB38, member RAS oncogene family [Source:NCBI gene;Acc:101170204])

HSP 1 Score: 199.519 bits (506), Expect = 2.075e-61
Identity = 104/183 (56.83%), Postives = 133/183 (72.68%), Query Frame = 2
Query:   80 MADNNY---LFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADEN--YLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKA 613
            M +N++   L+K+LV+G+   GKTSIIKRYVH  FS +YR TIGVDFALKVLN E +  V++QLWDIAGQERFGNMTR YY+EA GAFIV+DVTR ++ EA  KWK DLDSKVTL NG  + ++LL NK  C +   +   N   +DQF +E+ F G   TSAKENI I+E+ N LV+ ++ +
Sbjct:   96 MQNNHHKERLYKILVIGDLGVGKTSIIKRYVHHNFSPNYRATIGVDFALKVLNWEQE-TVRLQLWDIAGQERFGNMTRVYYREAMGAFIVFDVTRPASFEAVTKWKEDLDSKVTLSNGKHVATVLLANK--CDQGQDVLTNNGIKMDQFCQENGFVGWFETSAKENINIDEAANCLVKHIISS 275          
BLAST of ras-related protein Rab-32 vs. Planmine SMEST
Match: SMESG000060721.1 (SMESG000060721.1)

HSP 1 Score: 436.032 bits (1120), Expect = 4.781e-156
Identity = 209/210 (99.52%), Postives = 210/210 (100.00%), Query Frame = 2
Query:   80 MADNNYLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKASQEGEPKEGKINTINVTNKANQQTENSKTNCC 709
            MADNNYLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENY+DQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKASQEGEPKEGKINTINVTNKANQQTENSKTNCC
Sbjct:    1 MADNNYLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYMDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKASQEGEPKEGKINTINVTNKANQQTENSKTNCC 210          
BLAST of ras-related protein Rab-32 vs. Planmine SMEST
Match: SMESG000060721.1 (SMESG000060721.1)

HSP 1 Score: 286.574 bits (732), Expect = 4.883e-98
Identity = 137/138 (99.28%), Postives = 138/138 (100.00%), Query Frame = 2
Query:  296 MTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKASQEGEPKEGKINTINVTNKANQQTENSKTNCC 709
            MTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENY+DQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKASQEGEPKEGKINTINVTNKANQQTENSKTNCC
Sbjct:    1 MTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYMDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKASQEGEPKEGKINTINVTNKANQQTENSKTNCC 138          
BLAST of ras-related protein Rab-32 vs. Planmine SMEST
Match: SMESG000060723.1 (SMESG000060723.1)

HSP 1 Score: 258.455 bits (659), Expect = 6.675e-86
Identity = 126/210 (60.00%), Postives = 150/210 (71.43%), Query Frame = 2
Query:   80 MADNNYLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMMKASQEGEPKEGKINTINVTNKANQQTENSKTNCC 709
            M++  YLFKVLV+GE  +GKTSIIKRYVH +FS HYR TIGVDFALKVL  +D  +V++QLWDIAGQERFGNM R YYK+A GAFIVYDVTR ST EA +KWK DLD+KVT PNG  IP ILLGNK DC    +L+D  YLD+F+ EH F  R  TSAKENIGI+E+ N LVE MM   Q  E  +   + I + N+ +       + CC
Sbjct:    1 MSEKEYLFKVLVIGELGSGKTSIIKRYVHKFFSQHYRATIGVDFALKVLPRDDSSVVRLQLWDIAGQERFGNMLRVYYKDAMGAFIVYDVTRMSTFEAVVKWKKDLDNKVTQPNGEPIPCILLGNKCDCEPEGKLSDSAYLDEFVNEHGFVARFNTSAKENIGIDEAANALVEKMMTIIQGPEVNKDN-DLIKLGNQKSTDKPAQNSKCC 209          
BLAST of ras-related protein Rab-32 vs. Planmine SMEST
Match: SMESG000038328.1 (SMESG000038328.1)

HSP 1 Score: 169.859 bits (429), Expect = 2.706e-51
Identity = 86/207 (41.55%), Postives = 130/207 (62.80%), Query Frame = 2
Query:   95 YLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMM---KASQEGEPKEGKINTINVTNKANQQTENSKTNC 706
            +LFKVL++G+ + GKT+ + RYVH  F   Y+ TIGVDFALK +   D K +K+QLWDIAGQER+ +MTR YYKE+SG  +++D++  ++  + +KWK DLDSK    +G  IP ILL NKSD    ++  D+N ++   KE+ F G S  S KEN+ +E S++ L+E ++   K  ++    +   N  N   + + ++ N K  C
Sbjct:    3 FLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDI--KNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGIEDSLDSQNIRNNRNGVYRLDDKSHNKKVAC 207          
BLAST of ras-related protein Rab-32 vs. Planmine SMEST
Match: SMESG000038167.1 (SMESG000038167.1)

HSP 1 Score: 169.859 bits (429), Expect = 2.706e-51
Identity = 86/207 (41.55%), Postives = 130/207 (62.80%), Query Frame = 2
Query:   95 YLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLNLEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAIKWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEFSGRSLTSAKENIGIEESVNELVEIMM---KASQEGEPKEGKINTINVTNKANQQTENSKTNC 706
            +LFKVL++G+ + GKT+ + RYVH  F   Y+ TIGVDFALK +   D K +K+QLWDIAGQER+ +MTR YYKE+SG  +++D++  ++  + +KWK DLDSK    +G  IP ILL NKSD    ++  D+N ++   KE+ F G S  S KEN+ +E S++ L+E ++   K  ++    +   N  N   + + ++ N K  C
Sbjct:    3 FLFKVLLIGDPKVGKTAFVNRYVHDTFFDEYKVTIGVDFALKEIYWHDHKKIKLQLWDIAGQERYSSMTRVYYKESSGCILMFDLSDRASFTSVLKWKRDLDSKCIFGDGKPIPCILLANKSDI--KNRTIDQNEIEVLCKENGFIGWSEISVKENLMVENSIDYLIECILDRHKGIEDSLDSQNIRNNRNGVYRLDDKSHNKKVAC 207          
The following BLAST results are available for this feature:
BLAST of ras-related protein Rab-32 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RAB321.363e-7356.59RAB32, member RAS oncogene family [Source:HGNC Sym... [more]
RAB381.434e-6559.06RAB38, member RAS oncogene family [Source:HGNC Sym... [more]
RAB295.027e-6146.01RAB29, member RAS oncogene family [Source:HGNC Sym... [more]
RAB295.027e-6146.01RAB29, member RAS oncogene family [Source:HGNC Sym... [more]
RAB295.027e-6146.01RAB29, member RAS oncogene family [Source:HGNC Sym... [more]
back to top
BLAST of ras-related protein Rab-32 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glo-18.154e-5645.63Gut granule LOss; Rab GTPase GLO-1 [Source:UniPro... [more]
rab-191.337e-3032.86RAB family [Source:UniProtKB/TrEMBL;Acc:Q9U1W9][more]
rab-191.337e-3032.86RAB family [Source:UniProtKB/TrEMBL;Acc:Q9U1W9][more]
rab-191.337e-3032.86RAB family [Source:UniProtKB/TrEMBL;Acc:Q9U1W9][more]
rab-191.337e-3032.86RAB family [Source:UniProtKB/TrEMBL;Acc:Q9U1W9][more]
back to top
BLAST of ras-related protein Rab-32 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab321.912e-6658.48gene:FBgn0002567 transcript:FBtr0339369[more]
Rab321.912e-6658.48gene:FBgn0002567 transcript:FBtr0346636[more]
Rab322.337e-6658.48gene:FBgn0002567 transcript:FBtr0089933[more]
Rab324.770e-6558.48gene:FBgn0002567 transcript:FBtr0346635[more]
Rab321.004e-6458.48gene:FBgn0002567 transcript:FBtr0089932[more]
back to top
BLAST of ras-related protein Rab-32 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab32a7.768e-7057.69RAB32a, member RAS oncogene family [Source:ZFIN;Ac... [more]
rab32a6.588e-6753.33RAB32a, member RAS oncogene family [Source:ZFIN;Ac... [more]
zgc:1621717.366e-6650.74zgc:162171 [Source:ZFIN;Acc:ZDB-GENE-070424-24][more]
rab38c8.844e-6551.96RAB38c, member of RAS oncogene family [Source:ZFIN... [more]
rab38b1.150e-6055.68RAB38b, member of RAS oncogene family [Source:ZFIN... [more]
back to top
BLAST of ras-related protein Rab-32 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab323.270e-7255.12RAB32, member RAS oncogene family [Source:NCBI gen... [more]
gpx14.401e-6655.15glutathione peroxidase 1 [Source:Xenbase;Acc:XB-GE... [more]
rab324.335e-6547.08RAB32, member RAS oncogene family [Source:NCBI gen... [more]
ENSXETT00000035921.13.611e-6150.00ras-related protein Rab-32-like [Source:NCBI gene;... [more]
rab298.147e-5748.95RAB29, member RAS oncogene family [Source:NCBI gen... [more]
back to top
BLAST of ras-related protein Rab-32 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab322.022e-7355.61RAB32, member RAS oncogene family [Source:MGI Symb... [more]
Rab383.597e-6659.65RAB38, member RAS oncogene family [Source:MGI Symb... [more]
Rab298.366e-6145.79RAB29, member RAS oncogene family [Source:MGI Symb... [more]
Rab298.366e-6145.79RAB29, member RAS oncogene family [Source:MGI Symb... [more]
Rab383.250e-5270.91RAB38, member RAS oncogene family [Source:MGI Symb... [more]
back to top
BLAST of ras-related protein Rab-32 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q13637|RAB32_HUMAN6.544e-7356.59Ras-related protein Rab-32 OS=Homo sapiens OX=9606... [more]
sp|Q9CZE3|RAB32_MOUSE1.414e-7255.61Ras-related protein Rab-32 OS=Mus musculus OX=1009... [more]
sp|Q06AU5|RAB32_PIG3.973e-7055.07Ras-related protein Rab-32 OS=Sus scrofa OX=9823 G... [more]
sp|Q8QZZ8|RAB38_MOUSE2.516e-6559.65Ras-related protein Rab-38 OS=Mus musculus OX=1009... [more]
sp|P57729|RAB38_HUMAN6.887e-6559.06Ras-related protein Rab-38 OS=Homo sapiens OX=9606... [more]
back to top
BLAST of ras-related protein Rab-32 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2I3H8M21.155e-7157.07Uncharacterized protein OS=Nomascus leucogenys OX=... [more]
H2PKJ31.450e-7157.00RAB32 isoform 1 OS=Pongo abelii OX=9601 GN=RAB32 P... [more]
A0A2K5JTR61.544e-7157.00RAB32, member RAS oncogene family OS=Colobus angol... [more]
A0A2U3YUM42.660e-7155.61ras-related protein Rab-32 OS=Leptonychotes weddel... [more]
A0A0D9RX453.066e-7157.00Uncharacterized protein OS=Chlorocebus sabaeus OX=... [more]
back to top
BLAST of ras-related protein Rab-32 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab38c2.844e-6952.94ras-related protein Rab-38-like [Source:NCBI gene;... [more]
rab32a6.586e-6861.33ras-related protein Rab-32 [Source:NCBI gene;Acc:1... [more]
zgc:1621717.434e-6354.86ras-related protein Rab-38-like [Source:NCBI gene;... [more]
zgc:1621717.434e-6354.86ras-related protein Rab-38-like [Source:NCBI gene;... [more]
rab38b2.726e-6260.59ras-related protein Rab-38-like [Source:NCBI gene;... [more]
back to top
BLAST of ras-related protein Rab-32 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000406.19.829e-6650.71pep scaffold:Pmarinus_7.0:GL478061:71799:86849:1 g... [more]
ENSPMAT00000006605.16.439e-4138.05pep scaffold:Pmarinus_7.0:GL479131:3746:14175:-1 g... [more]
rab303.259e-2831.05RAB30, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab4b2.126e-2639.02RAB4B, member RAS oncogene family [Source:NCBI gen... [more]
RAB295.413e-2643.70RAB29, member RAS oncogene family [Source:HGNC Sym... [more]
back to top
BLAST of ras-related protein Rab-32 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
YPT74.187e-2931.61Rab family GTPase; GTP-binding protein of the rab ... [more]
YPT64.820e-2639.69Rab family GTPase; required for endosome-to-Golgii... [more]
YPT326.404e-2630.32Rab family GTPase involved in the exocytic pathway... [more]
YPT311.095e-2529.41Rab family GTPase; involved in the exocytic pathwa... [more]
YPT12.933e-2532.06Rab family GTPase; involved in the ER-to-Golgi ste... [more]
back to top
BLAST of ras-related protein Rab-32 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO367572.906e-5546.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480721.700e-5351.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460571.324e-4744.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO445281.373e-3235.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474711.879e-2933.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ras-related protein Rab-32 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab32a1.095e-6854.63RAB32, member RAS oncogene family [Source:NCBI gen... [more]
rab38c6.826e-6850.47ras-related protein Rab-32-like [Source:NCBI gene;... [more]
rab38c5.610e-6751.46ras-related protein Rab-32-like [Source:NCBI gene;... [more]
rab38b2.902e-6357.06ras-related protein Rab-38 [Source:NCBI gene;Acc:1... [more]
RAB382.075e-6156.83RAB38, member RAS oncogene family [Source:NCBI gen... [more]
back to top
BLAST of ras-related protein Rab-32 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000060721.14.781e-15699.52SMESG000060721.1[more]
SMESG000060721.14.883e-9899.28SMESG000060721.1[more]
SMESG000060723.16.675e-8660.00SMESG000060723.1[more]
SMESG000038328.12.706e-5141.55SMESG000038328.1[more]
SMESG000038167.12.706e-5141.55SMESG000038167.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029100 ID=SMED30029100|Name=ras-related protein Rab-32|organism=Schmidtea mediterranea sexual|type=transcript|length=1025bp
CTTCACTAAATTAGATTATTTTGGAATTCGAATGGTGAGATTGTTATAGC
AGATTTAGTATTTGTACTGACAATTTAAAATGGCAGATAATAATTATTTA
TTCAAAGTCCTCGTCGTAGGTGAATACGAAACAGGCAAGACAAGTATTAT
CAAACGCTACGTACATGGGTACTTTTCATATCATTACCGTACAACGATTG
GAGTCGACTTTGCGCTGAAGGTTTTGAATTTAGAAGACGACAAGATTGTT
AAGATTCAACTGTGGGACATTGCTGGACAAGAGAGGTTCGGAAACATGAC
GAGGTCGTATTATAAGGAGGCTTCCGGTGCTTTTATTGTGTATGACGTCA
CTCGGTTTAGCACACTGGAAGCTGCGATAAAATGGAAAACGGATCTTGAC
AGTAAAGTTACTTTACCGAATGGGAATAAAATTCCGTCTATTCTTTTGGG
AAATAAGTCAGATTGTGTACGGGCCCACCAGCTAGCCGATGAAAATTATC
TGGATCAATTTATCAAGGAACATGAATTTTCAGGGAGATCTCTTACATCC
GCGAAAGAAAACATTGGTATAGAGGAATCTGTGAATGAATTAGTTGAAAT
AATGATGAAAGCCAGCCAGGAAGGAGAGCCGAAAGAGGGAAAGATAAATA
CCATCAACGTTACAAATAAAGCAAATCAGCAAACGGAAAACAGTAAAACA
AATTGCTGCTAAAGCCGATATTGGATAAAGATAAAATGAAAATTTCTCAC
AAATTTTATTAATTATTTTAGTCGGCAGTCGAATTTTATTTTGTTTATTC
ACTTTGGTGTCGACTATTTGATAAAATTTTCACTGTGCACGAGTAAAACA
AAATATCAATAATGTTTTTTATGATTATCTCGACCCGATTATTGATTCAT
AGAGGACTTTGATCCAATTATTGCAGATCTTATCAATATTATTATATTAT
GTAAATACTGATTTCACCTTGGTCACATTTACATAGCTATTTTCATAGCA
ACATTATTTAGATTTTCGATAATAA
back to top

protein sequence of SMED30029100-orf-1

>SMED30029100-orf-1 ID=SMED30029100-orf-1|Name=SMED30029100-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=211bp
MADNNYLFKVLVVGEYETGKTSIIKRYVHGYFSYHYRTTIGVDFALKVLN
LEDDKIVKIQLWDIAGQERFGNMTRSYYKEASGAFIVYDVTRFSTLEAAI
KWKTDLDSKVTLPNGNKIPSILLGNKSDCVRAHQLADENYLDQFIKEHEF
SGRSLTSAKENIGIEESVNELVEIMMKASQEGEPKEGKINTINVTNKANQ
QTENSKTNCC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR005225Small_GTP-bd_dom
IPR030697Rab29/Rab38/Rab32
IPR027417P-loop_NTPase
IPR001806Small_GTPase
Vocabulary: biological process
TermDefinition
GO:0007264small GTPase mediated signal transduction
GO:0035646endosome to melanosome transport
GO:0061024membrane organization
GO:0072657protein localization to membrane
GO:0090382phagosome maturation
GO:1903232melanosome assembly
GO:0007005mitochondrion organization
GO:0016192vesicle-mediated transport
GO:0019882antigen processing and presentation
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0035650AP-1 adaptor complex binding
GO:0035651AP-3 adaptor complex binding
GO:0036461BLOC-2 complex binding
GO:0000166nucleotide binding
GO:0003924GTPase activity
GO:0005515protein binding
GO:0030742GTP-dependent protein binding
Vocabulary: cellular component
TermDefinition
GO:0033162melanosome membrane
GO:0042470melanosome
GO:0044233ER-mitochondrion membrane contact site
GO:0045335phagocytic vesicle
GO:0005739mitochondrion
GO:0005741mitochondrial outer membrane
GO:0005769early endosome
GO:0005783endoplasmic reticulum
GO:0005794Golgi apparatus
GO:0005802trans-Golgi network
GO:0005829cytosol
GO:0016020membrane
GO:0030670phagocytic vesicle membrane
GO:0031410cytoplasmic vesicle
GO:0031982vesicle
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00449RASTRNSFRMNGcoord: 8..29
score: 33.46
coord: 153..175
score: 25.22
coord: 50..72
score: 41.57
coord: 31..47
score: 33.45
coord: 116..129
score: 42.43
NoneNo IPR availableSMARTSM00173ras_sub_4coord: 5..178
e-value: 6.7E-8
score: 0.3
NoneNo IPR availableSMARTSM00174rho_sub_3coord: 10..178
e-value: 5.9E-5
score: -53.9
NoneNo IPR availableSMARTSM00176ran_sub_2coord: 13..205
e-value: 6.8E-5
score: 20.5
NoneNo IPR availableSMARTSM00175rab_sub_5coord: 8..178
e-value: 1.6E-50
score: 183.8
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 4..181
e-value: 4.7E-49
score: 168.2
NoneNo IPR availablePANTHERPTHR24073:SF897RAB38C, MEMBER OF RAS ONCOGENE FAMILY-RELATEDcoord: 5..179
NoneNo IPR availablePANTHERPTHR24073FAMILY NOT NAMEDcoord: 5..179
NoneNo IPR availablePROSITEPS51419RABcoord: 3..210
score: 28.146
IPR001806Small GTPasePFAMPF00071Rascoord: 9..176
e-value: 1.7E-36
score: 125.3
IPR005225Small GTP-binding protein domainTIGRFAMTIGR00231TIGR00231coord: 7..169
e-value: 1.7E-16
score: 58.4
IPR030697Ras-related protein Rab29/Rab38/Rab32CDDcd04107Rab32_Rab38coord: 8..210
e-value: 2.22323E-103
score: 294.603
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 3..195