slc38a-5

Overview
Nameslc38a-5 (AKN21664.1)
Smed IDSMED30029096
Length (bp)1981
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc38a-5 (SMED30029096) t-SNE clustered cells

Violin plots show distribution of expression levels for slc38a-5 (SMED30029096) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc38a-5 (SMED30029096) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc38a-5 (SMED30029096) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029096

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30029096h1SMcG0008728 Contig577GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30029096h1SMcG0007115 Contig577GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30029096h1SMcG0007115 dd_Smed_v4_2530_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029096h1SMcG0007115 dd_Smed_v4_2530_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30029096h1SMcG0007115 dd_Smed_v4_2530_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30029096h1SMcG0007115 dd_Smed_v4_2530_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30029096h1SMcG0007115 dd_Smed_v4_2530_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc38a-5 vs. Ensembl Human
Match: SLC38A7 (solute carrier family 38 member 7 [Source:HGNC Symbol;Acc:HGNC:25582])

HSP 1 Score: 145.976 bits (367), Expect = 5.182e-37
Identity = 104/356 (29.21%), Postives = 181/356 (50.84%), Query Frame = 3
Query:  543 GILIMANVCLGMGILNFPRIFYEAGGITVTL-ISLAIFVVLIAGSLXXXXXXXXXXXXVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDRLYSI-------ASGSEFTKHYYLMPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYILKE----PGDPELFIETKDQTRDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFYSSVVSTISHEKIKDFLENFAIARVLQTLXXXXXXXXCAVVIPNISNAISIIGAVS 1574
             I I+ N CLG G+LNFP  F  AGG+   + + + + V +I+G L I+AYC +      YQ++V   CG+  G++C V++     G+ I  ++++ DQ D++ ++       ASG  +T   + + + A +  LP+   R+    KY S   V+   Y+T  + ++ YI  +    PG+  +          FN + P + +G+  HV +  VF+ +++ ++  +   V + + I+   Y  TG+ G+LTFG   D D LL+YP ++    VA   +   + TS+P+L F  R+V  G +         E +          RVLQTL+ F   ++ A+ IP+I   IS+IG ++
Sbjct:   56 AIFIVVNACLGAGLLNFPAAFSTAGGVAAGIALQMGMLVFIISG-LVILAYCSQASNERTYQEVVWAVCGKLTGVLCEVAIAVYTFGTCIAFLIIIGDQQDKIIAVMAKEPEGASGPWYTDRKFTISLTAFLFILPLSIPREIGFQKYASFLSVVGTWYVT-AIVIIKYIWPDKEMTPGN--ILTRPASWMAVFNAM-PTICFGFQCHVSSVPVFNSMQQPEVKTWGGVVTAAMVIALAVYMGTGICGFLTFGAAVDPDVLLSYPSEDMAVAVARAFIILSVLTSYPILHFCGRAVVEGLWLRYQGVPVEEDVGRERRR----RVLQTLVWFLLTLLLALFIPDIGKVISVIGGLA 402          
BLAST of slc38a-5 vs. Ensembl Human
Match: SLC38A7 (solute carrier family 38 member 7 [Source:HGNC Symbol;Acc:HGNC:25582])

HSP 1 Score: 145.976 bits (367), Expect = 5.182e-37
Identity = 104/356 (29.21%), Postives = 181/356 (50.84%), Query Frame = 3
Query:  543 GILIMANVCLGMGILNFPRIFYEAGGITVTL-ISLAIFVVLIAGSLXXXXXXXXXXXXVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDRLYSI-------ASGSEFTKHYYLMPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYILKE----PGDPELFIETKDQTRDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFYSSVVSTISHEKIKDFLENFAIARVLQTLXXXXXXXXCAVVIPNISNAISIIGAVS 1574
             I I+ N CLG G+LNFP  F  AGG+   + + + + V +I+G L I+AYC +      YQ++V   CG+  G++C V++     G+ I  ++++ DQ D++ ++       ASG  +T   + + + A +  LP+   R+    KY S   V+   Y+T  + ++ YI  +    PG+  +          FN + P + +G+  HV +  VF+ +++ ++  +   V + + I+   Y  TG+ G+LTFG   D D LL+YP ++    VA   +   + TS+P+L F  R+V  G +         E +          RVLQTL+ F   ++ A+ IP+I   IS+IG ++
Sbjct:   56 AIFIVVNACLGAGLLNFPAAFSTAGGVAAGIALQMGMLVFIISG-LVILAYCSQASNERTYQEVVWAVCGKLTGVLCEVAIAVYTFGTCIAFLIIIGDQQDKIIAVMAKEPEGASGPWYTDRKFTISLTAFLFILPLSIPREIGFQKYASFLSVVGTWYVT-AIVIIKYIWPDKEMTPGN--ILTRPASWMAVFNAM-PTICFGFQCHVSSVPVFNSMQQPEVKTWGGVVTAAMVIALAVYMGTGICGFLTFGAAVDPDVLLSYPSEDMAVAVARAFIILSVLTSYPILHFCGRAVVEGLWLRYQGVPVEEDVGRERRR----RVLQTLVWFLLTLLLALFIPDIGKVISVIGGLA 402          
BLAST of slc38a-5 vs. Ensembl Human
Match: SLC38A8 (solute carrier family 38 member 8 [Source:HGNC Symbol;Acc:HGNC:32434])

HSP 1 Score: 135.576 bits (340), Expect = 1.267e-33
Identity = 114/412 (27.67%), Postives = 199/412 (48.30%), Query Frame = 3
Query:  543 GILIMANVCLGMGILNFPRIFYEAGGITVT-LISLAIFVVLIAGSLXXXXXXXXXXXXVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDRLY-SIASGSE------FTKHYYLMPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYI----LKEPGDPELFIETKDQTRDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFY-SSVVSTISHEKIKDFLENFAIARVLQTLXXXXXXXXCAVVIPNISNAISIIGAVSCHXXXXXXXXXXXXXYQKATISNRKHFIRKIGGIFYILLGTFCFGVNFTVAIQSL 1739
             + I+    LG G+LNFP  F +AGG+    L+ L   V LI+G L I+ Y         YQ +VR  CG   G +C       L    +  + V+ DQL++L  S+ SG+       +    + +P++++++ LP+   R+    KY S+ G LAA Y+   +++  Y+    L     P L       T  F++  P + +G+  H  A  ++  ++K+ L ++       L    + Y++TGV+G+LTFG     D L++YP ++    VA ++ +  + T +P++ F+ RSV   F+  S +       + D   +    R+  T++     +  A+ +P++S  +SIIG +S  F F FPGLC         I  R     ++ G+  +L+GTF FG +   A+  +
Sbjct:   29 AVFILMKSALGAGLLNFPWAFSKAGGVVPAFLVELVSLVFLISG-LVILGYAAAVSGQATYQGVVRGLCGPAIGKLCEACFLLNLLMISVAFLRVIGDQLEKLCDSLLSGTPPAPQPWYADQRFTLPLLSVLVILPLSAPREIAFQKYTSILGTLAACYLALVITVQYYLWPQGLVRESHPSL--SPASWTSVFSVF-PTICFGFQCHEAAVSIYCSMRKRSLSHWALVSVLSLLACCLIYSLTGVYGFLTFGTEVSADVLMSYPGNDMVIIVARVLFAVSIVTVYPIVLFLGRSVMQDFWRRSCLGGWGPSALAD--PSGLWVRMPLTILWVTVTLAMALFMPDLSEIVSIIGGISSFFIFIFPGLCLICAMGVEPIGPRVKCCLEVWGVVSVLVGTFIFGQSTAAAVWEM 434          
BLAST of slc38a-5 vs. Ensembl Human
Match: SLC38A7 (solute carrier family 38 member 7 [Source:HGNC Symbol;Acc:HGNC:25582])

HSP 1 Score: 119.398 bits (298), Expect = 1.541e-28
Identity = 81/297 (27.27%), Postives = 147/297 (49.49%), Query Frame = 3
Query:  717 NYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDRLYSI-------ASGSEFTKHYYLMPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYILKE----PGDPELFIETKDQTRDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFYSSVVSTISHEKIKDFLENFAIARVLQTLXXXXXXXXCAVVIPNISNAISIIGAVS 1574
             YQ++V   CG+  G++C V++     G+ I  ++++ DQ D++ ++       ASG  +T   + + + A +  LP+   R+    KY S   V+   Y+T  + ++ YI  +    PG+  +          FN + P + +G+  HV +  VF+ +++ ++  +   V + + I+   Y  TG+ G+LTFG   D D LL+YP ++    VA   +   + TS+P+L F  R+V  G +         E +          RVLQTL+ F   ++ A+ IP+I   IS+IG ++
Sbjct:   25 TYQEVVWAVCGKLTGVLCEVAIAVYTFGTCIAFLIIIGDQQDKIIAVMAKEPEGASGPWYTDRKFTISLTAFLFILPLSIPREIGFQKYASFLSVVGTWYVT-AIVIIKYIWPDKEMTPGN--ILTRPASWMAVFNAM-PTICFGFQCHVSSVPVFNSMQQPEVKTWGGVVTAAMVIALAVYMGTGICGFLTFGAAVDPDVLLSYPSEDMAVAVARAFIILSVLTSYPILHFCGRAVVEGLWLRYQGVPVEEDVGRERRR----RVLQTLVWFLLTLLLALFIPDIGKVISVIGGLA 313          
BLAST of slc38a-5 vs. Ensembl Human
Match: SLC38A7 (solute carrier family 38 member 7 [Source:HGNC Symbol;Acc:HGNC:25582])

HSP 1 Score: 90.5077 bits (223), Expect = 6.810e-19
Identity = 65/240 (27.08%), Postives = 122/240 (50.83%), Query Frame = 3
Query:  546 ILIMANVCLGMGILNFPRIFYEAGGITVTL-ISLAIFVVLIAGSLXXXXXXXXXXXXVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDRLYSI-------ASGSEFTKHYYLMPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYILKE----PGDPELFIETKDQTRDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCY 1229
            I I+ N CLG G+LNFP  F  AGG+   + + + + V +I+G L I+AYC +      YQ++V   CG+  G++C V++     G+ I  ++++ DQ D++ ++       ASG  +T   + + + A +  LP+   R+    KY S   V+   Y+T  + ++ YI  +    PG+  +          FN + P + +G+  HV +  VF+ +++ ++  +   V + + I+   Y
Sbjct:   57 IFIVVNACLGAGLLNFPAAFSTAGGVAAGIALQMGMLVFIISG-LVILAYCSQASNERTYQEVVWAVCGKLTGVLCEVAIAVYTFGTCIAFLIIIGDQQDKIIAVMAKEPEGASGPWYTDRKFTISLTAFLFILPLSIPREIGFQKYASFLSVVGTWYVT-AIVIIKYIWPDKEMTPGN--ILTRPASWMAVFNAM-PTICFGFQCHVSSVPVFNSMQQPEVKTWGGVVTAAMVIALAVY 291          
BLAST of slc38a-5 vs. Ensembl Fly
Match: CG13384 (gene:FBgn0032036 transcript:FBtr0303469)

HSP 1 Score: 50.8322 bits (120), Expect = 3.125e-6
Identity = 60/244 (24.59%), Postives = 104/244 (42.62%), Query Frame = 3
Query:  867 SEFTKHYYLMP--IVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMV-GYILKEPGDPELFIETKDQTRDFNLLIPL----LVYGYHG-HVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFYSSVVSTISHEKIKDFLENFAIARVLQTLXXXXXXXXCAVVIPNISNAISIIGAVS 1574
             +   HYY MP  I  +++  PM  +      KY++   ++AAL    G+++   Y+L +  D    + T      +  L PL     +Y + G  V  PL  +    +        + + + I    Y   G FGYL +G   +    LN P+ +  + +  + ++  +F S+ + F+V  ++   F  S   T    + KD L    +  VL T          A  IPN+ + IS++GAVS
Sbjct:  197 KDVMDHYYKMPVQIYLLIMLGPMILLNLVRNLKYLTPVSLVAALLTVAGLAITFSYMLVDLPD----VHTVKPVATWATL-PLYFGTAIYAFEGIGVVLPLENNMRTPEDFGGTTGVLNTGMVIVACLYTAVGFFGYLKYGEHVEGSITLNLPQGDTLSQLVRISMAVAIFLSYTLQFYVPVNIVEPFVRSHFDT---TRAKD-LSATVLRVVLVTFTFLL-----ATCIPNLGSIISLVGAVS 426          
BLAST of slc38a-5 vs. Ensembl Fly
Match: CG13384 (gene:FBgn0032036 transcript:FBtr0079657)

HSP 1 Score: 50.8322 bits (120), Expect = 3.125e-6
Identity = 60/244 (24.59%), Postives = 104/244 (42.62%), Query Frame = 3
Query:  867 SEFTKHYYLMP--IVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMV-GYILKEPGDPELFIETKDQTRDFNLLIPL----LVYGYHG-HVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFYSSVVSTISHEKIKDFLENFAIARVLQTLXXXXXXXXCAVVIPNISNAISIIGAVS 1574
             +   HYY MP  I  +++  PM  +      KY++   ++AAL    G+++   Y+L +  D    + T      +  L PL     +Y + G  V  PL  +    +        + + + I    Y   G FGYL +G   +    LN P+ +  + +  + ++  +F S+ + F+V  ++   F  S   T    + KD L    +  VL T          A  IPN+ + IS++GAVS
Sbjct:  197 KDVMDHYYKMPVQIYLLIMLGPMILLNLVRNLKYLTPVSLVAALLTVAGLAITFSYMLVDLPD----VHTVKPVATWATL-PLYFGTAIYAFEGIGVVLPLENNMRTPEDFGGTTGVLNTGMVIVACLYTAVGFFGYLKYGEHVEGSITLNLPQGDTLSQLVRISMAVAIFLSYTLQFYVPVNIVEPFVRSHFDT---TRAKD-LSATVLRVVLVTFTFLL-----ATCIPNLGSIISLVGAVS 426          
BLAST of slc38a-5 vs. Ensembl Fly
Match: CG13384 (gene:FBgn0032036 transcript:FBtr0079653)

HSP 1 Score: 50.8322 bits (120), Expect = 3.331e-6
Identity = 60/244 (24.59%), Postives = 104/244 (42.62%), Query Frame = 3
Query:  867 SEFTKHYYLMP--IVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMV-GYILKEPGDPELFIETKDQTRDFNLLIPL----LVYGYHG-HVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFYSSVVSTISHEKIKDFLENFAIARVLQTLXXXXXXXXCAVVIPNISNAISIIGAVS 1574
             +   HYY MP  I  +++  PM  +      KY++   ++AAL    G+++   Y+L +  D    + T      +  L PL     +Y + G  V  PL  +    +        + + + I    Y   G FGYL +G   +    LN P+ +  + +  + ++  +F S+ + F+V  ++   F  S   T    + KD L    +  VL T          A  IPN+ + IS++GAVS
Sbjct:  193 KDVMDHYYKMPVQIYLLIMLGPMILLNLVRNLKYLTPVSLVAALLTVAGLAITFSYMLVDLPD----VHTVKPVATWATL-PLYFGTAIYAFEGIGVVLPLENNMRTPEDFGGTTGVLNTGMVIVACLYTAVGFFGYLKYGEHVEGSITLNLPQGDTLSQLVRISMAVAIFLSYTLQFYVPVNIVEPFVRSHFDT---TRAKD-LSATVLRVVLVTFTFLL-----ATCIPNLGSIISLVGAVS 422          
BLAST of slc38a-5 vs. Ensembl Fly
Match: CG13384 (gene:FBgn0032036 transcript:FBtr0303470)

HSP 1 Score: 50.8322 bits (120), Expect = 3.331e-6
Identity = 60/244 (24.59%), Postives = 104/244 (42.62%), Query Frame = 3
Query:  867 SEFTKHYYLMP--IVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMV-GYILKEPGDPELFIETKDQTRDFNLLIPL----LVYGYHG-HVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFYSSVVSTISHEKIKDFLENFAIARVLQTLXXXXXXXXCAVVIPNISNAISIIGAVS 1574
             +   HYY MP  I  +++  PM  +      KY++   ++AAL    G+++   Y+L +  D    + T      +  L PL     +Y + G  V  PL  +    +        + + + I    Y   G FGYL +G   +    LN P+ +  + +  + ++  +F S+ + F+V  ++   F  S   T    + KD L    +  VL T          A  IPN+ + IS++GAVS
Sbjct:  193 KDVMDHYYKMPVQIYLLIMLGPMILLNLVRNLKYLTPVSLVAALLTVAGLAITFSYMLVDLPD----VHTVKPVATWATL-PLYFGTAIYAFEGIGVVLPLENNMRTPEDFGGTTGVLNTGMVIVACLYTAVGFFGYLKYGEHVEGSITLNLPQGDTLSQLVRISMAVAIFLSYTLQFYVPVNIVEPFVRSHFDT---TRAKD-LSATVLRVVLVTFTFLL-----ATCIPNLGSIISLVGAVS 422          
BLAST of slc38a-5 vs. Ensembl Fly
Match: CG13384 (gene:FBgn0032036 transcript:FBtr0303471)

HSP 1 Score: 50.8322 bits (120), Expect = 3.331e-6
Identity = 60/244 (24.59%), Postives = 104/244 (42.62%), Query Frame = 3
Query:  867 SEFTKHYYLMP--IVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMV-GYILKEPGDPELFIETKDQTRDFNLLIPL----LVYGYHG-HVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFYSSVVSTISHEKIKDFLENFAIARVLQTLXXXXXXXXCAVVIPNISNAISIIGAVS 1574
             +   HYY MP  I  +++  PM  +      KY++   ++AAL    G+++   Y+L +  D    + T      +  L PL     +Y + G  V  PL  +    +        + + + I    Y   G FGYL +G   +    LN P+ +  + +  + ++  +F S+ + F+V  ++   F  S   T    + KD L    +  VL T          A  IPN+ + IS++GAVS
Sbjct:  193 KDVMDHYYKMPVQIYLLIMLGPMILLNLVRNLKYLTPVSLVAALLTVAGLAITFSYMLVDLPD----VHTVKPVATWATL-PLYFGTAIYAFEGIGVVLPLENNMRTPEDFGGTTGVLNTGMVIVACLYTAVGFFGYLKYGEHVEGSITLNLPQGDTLSQLVRISMAVAIFLSYTLQFYVPVNIVEPFVRSHFDT---TRAKD-LSATVLRVVLVTFTFLL-----ATCIPNLGSIISLVGAVS 422          
BLAST of slc38a-5 vs. Ensembl Zebrafish
Match: slc38a7 (solute carrier family 38 member 7 [Source:NCBI gene;Acc:445254])

HSP 1 Score: 147.132 bits (370), Expect = 1.068e-37
Identity = 120/448 (26.79%), Postives = 208/448 (46.43%), Query Frame = 3
Query:  468 FLQDGSL--VDENDEESNFTGGAGWPSGILIMANVCLGMGILNFPRIFYEAGGITVTLISLAIFVVLIAGSLXXXXXXXXXXXXVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDRLYSI---ASGSEFTKHYYL-----MPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYIL--KEPGDPELFIETKDQTRDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFY-----SSVVSTISHEKIKDFLENFAIARVLQTLXXXXXXXXCAVVIPNISNAISIIGAV-SCHXXXXXXXXXXXXXYQKATISNRKHFIRKIGGIFYILLGTFCFGVNFTVAIQSLLKSRPS 1757
             LQ  S+  V    +  +  GG      + I+ N  LG G+LNFP  F  AGG+T  +      +  I   L I+AYC +      YQ++VR  CG+  G++C +++     G+ I  ++++ DQLD+L       S  E + H+Y      + + +++I LP+   ++    KY S   V+   Y+T  + +V YI   K+     + +     T  FN + P + +G+  HV +  VF+ +KK ++  +   V   + I    Y  TGV G+L+FG +   D L++YP D+    +A   +   + TS+P+L F  R+V  G +       V + ++ E+ +         R+LQTL+ F   +I A+ IP+I   IS+IG + +C                +  + +         G+  + +G F FG   T AI   + + P+
Sbjct:   27 LLQSPSVDSVQPPSQSDDSRGGTSSLGAVFIVVNAALGAGLLNFPAAFNMAGGVTAGVTLQMCMMAFIITGLVILAYCSQVSNESTYQEVVRAVCGKALGVICELAIAVYTFGTCIAFLIIIGDQLDKLIGAINNESEKEISLHWYTDRKFTITLTSVLIILPLSIPKEIGFQKYASTLSVIGTWYVTI-IVIVKYIWPSKDVSPGIIPVRPASWTDVFNAM-PTICFGFQCHVSSVPVFNSMKKPEIRPWWGVVTISMIICLFVYTGTGVCGFLSFGSSVSQDVLMSYPSDDVAVAIARAFIIICVVTSYPILHFCGRAVLEGLWLRFKGEEVETDVAKERRR---------RILQTLVWFCLTLILALFIPDIGRVISLIGGLAACFIFVFPGLCLIQAKLSEHDVRSNSWNAMVAYGVIMVTIGAFIFGQTTTNAIYKDIINNPN 463          
BLAST of slc38a-5 vs. Ensembl Zebrafish
Match: slc38a7 (solute carrier family 38 member 7 [Source:NCBI gene;Acc:445254])

HSP 1 Score: 147.132 bits (370), Expect = 1.068e-37
Identity = 120/448 (26.79%), Postives = 208/448 (46.43%), Query Frame = 3
Query:  468 FLQDGSL--VDENDEESNFTGGAGWPSGILIMANVCLGMGILNFPRIFYEAGGITVTLISLAIFVVLIAGSLXXXXXXXXXXXXVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDRLYSI---ASGSEFTKHYYL-----MPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYIL--KEPGDPELFIETKDQTRDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFY-----SSVVSTISHEKIKDFLENFAIARVLQTLXXXXXXXXCAVVIPNISNAISIIGAV-SCHXXXXXXXXXXXXXYQKATISNRKHFIRKIGGIFYILLGTFCFGVNFTVAIQSLLKSRPS 1757
             LQ  S+  V    +  +  GG      + I+ N  LG G+LNFP  F  AGG+T  +      +  I   L I+AYC +      YQ++VR  CG+  G++C +++     G+ I  ++++ DQLD+L       S  E + H+Y      + + +++I LP+   ++    KY S   V+   Y+T  + +V YI   K+     + +     T  FN + P + +G+  HV +  VF+ +KK ++  +   V   + I    Y  TGV G+L+FG +   D L++YP D+    +A   +   + TS+P+L F  R+V  G +       V + ++ E+ +         R+LQTL+ F   +I A+ IP+I   IS+IG + +C                +  + +         G+  + +G F FG   T AI   + + P+
Sbjct:   27 LLQSPSVDSVQPPSQSDDSRGGTSSLGAVFIVVNAALGAGLLNFPAAFNMAGGVTAGVTLQMCMMAFIITGLVILAYCSQVSNESTYQEVVRAVCGKALGVICELAIAVYTFGTCIAFLIIIGDQLDKLIGAINNESEKEISLHWYTDRKFTITLTSVLIILPLSIPKEIGFQKYASTLSVIGTWYVTI-IVIVKYIWPSKDVSPGIIPVRPASWTDVFNAM-PTICFGFQCHVSSVPVFNSMKKPEIRPWWGVVTISMIICLFVYTGTGVCGFLSFGSSVSQDVLMSYPSDDVAVAIARAFIIICVVTSYPILHFCGRAVLEGLWLRFKGEEVETDVAKERRR---------RILQTLVWFCLTLILALFIPDIGRVISLIGGLAACFIFVFPGLCLIQAKLSEHDVRSNSWNAMVAYGVIMVTIGAFIFGQTTTNAIYKDIINNPN 463          
BLAST of slc38a-5 vs. Ensembl Zebrafish
Match: slc38a7 (solute carrier family 38 member 7 [Source:NCBI gene;Acc:445254])

HSP 1 Score: 147.132 bits (370), Expect = 1.068e-37
Identity = 120/448 (26.79%), Postives = 208/448 (46.43%), Query Frame = 3
Query:  468 FLQDGSL--VDENDEESNFTGGAGWPSGILIMANVCLGMGILNFPRIFYEAGGITVTLISLAIFVVLIAGSLXXXXXXXXXXXXVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDRLYSI---ASGSEFTKHYYL-----MPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYIL--KEPGDPELFIETKDQTRDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFY-----SSVVSTISHEKIKDFLENFAIARVLQTLXXXXXXXXCAVVIPNISNAISIIGAV-SCHXXXXXXXXXXXXXYQKATISNRKHFIRKIGGIFYILLGTFCFGVNFTVAIQSLLKSRPS 1757
             LQ  S+  V    +  +  GG      + I+ N  LG G+LNFP  F  AGG+T  +      +  I   L I+AYC +      YQ++VR  CG+  G++C +++     G+ I  ++++ DQLD+L       S  E + H+Y      + + +++I LP+   ++    KY S   V+   Y+T  + +V YI   K+     + +     T  FN + P + +G+  HV +  VF+ +KK ++  +   V   + I    Y  TGV G+L+FG +   D L++YP D+    +A   +   + TS+P+L F  R+V  G +       V + ++ E+ +         R+LQTL+ F   +I A+ IP+I   IS+IG + +C                +  + +         G+  + +G F FG   T AI   + + P+
Sbjct:   27 LLQSPSVDSVQPPSQSDDSRGGTSSLGAVFIVVNAALGAGLLNFPAAFNMAGGVTAGVTLQMCMMAFIITGLVILAYCSQVSNESTYQEVVRAVCGKALGVICELAIAVYTFGTCIAFLIIIGDQLDKLIGAINNESEKEISLHWYTDRKFTITLTSVLIILPLSIPKEIGFQKYASTLSVIGTWYVTI-IVIVKYIWPSKDVSPGIIPVRPASWTDVFNAM-PTICFGFQCHVSSVPVFNSMKKPEIRPWWGVVTISMIICLFVYTGTGVCGFLSFGSSVSQDVLMSYPSDDVAVAIARAFIIICVVTSYPILHFCGRAVLEGLWLRFKGEEVETDVAKERRR---------RILQTLVWFCLTLILALFIPDIGRVISLIGGLAACFIFVFPGLCLIQAKLSEHDVRSNSWNAMVAYGVIMVTIGAFIFGQTTTNAIYKDIINNPN 463          
BLAST of slc38a-5 vs. Ensembl Zebrafish
Match: slc38a8b (solute carrier family 38 member 8b [Source:ZFIN;Acc:ZDB-GENE-121005-6])

HSP 1 Score: 145.206 bits (365), Expect = 1.746e-36
Identity = 122/423 (28.84%), Postives = 208/423 (49.17%), Query Frame = 3
Query:  543 GILIMANVCLGMGILNFPRIFYEAGGITVTL-ISLAIFVVLIAGSLXXXXXXXXXXXXVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDRL----YSIASG---SEFTKHYYL-----MPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYILKEPGDPELFIETKDQTRDFNLL---IPLLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFYSSVVSTISHEKIKDFLENFAI--------ARVLQTLXXXXXXXXCAVVIPNISNAISIIGAVSCHXXXXXXXXXXXXXYQKATISNRKHFIRKIGGIFYILLGTFCFGVNFTVAIQSL 1739
             I IM    LG G+LNFP  F +AGG+   + + +   V LI+G L I+ Y         Y D+VR  CGR  G +C +   F L    +  +VV+ DQL++L    Y   +G   +E   H+Y      +  + ++I LP+   ++    KY SV G LAA Y++  V +  Y LK+    +L  E       +  +   +P + +G+  H  +  ++S ++ +K+ +++    + +    + Y +TGVFG+LTFGR    D L++YP ++    +A L+    + T +P++  + RSV               +I  F E   I         R++ T++     ++ A+ +P++S  IS+IG +S  F F FPGLC  F+ Q   I++R   +    G+  I++G F FG + T+A+  L
Sbjct:  146 AIFIMLKSALGAGLLNFPWAFEKAGGVNTAISVEMVSLVFLISG-LVILGYASSISRQNTYHDVVRNVCGRRIGHLCEICFVFNLFMISVAFLVVVQDQLEKLCLSLYETVTGNTEAEMPHHWYTDYRFALSFMCLIIILPLSIPKEIGIQKYTSVMGTLAATYLSVAV-IAKYYLKDTHTADLTPEHSQGLGSWASMFSVVPTICFGFQCHEASIAIYSSMENKKITHWVFISVTSMIFCLLIYTLTGVFGFLTFGRKVASDILMSYPGNDVVMIIARLLFGISIVTIYPIILLLGRSVIL------------TQILRFWERRTIMTPVFEGRCRLILTILWITVTLLIAIFVPDMSEVISVIGGISAFFIFIFPGLCLIFVMQTEPINHRIRILLTGWGVVTIVIGAFIFGQSTTIAVMEL 554          
BLAST of slc38a-5 vs. Ensembl Zebrafish
Match: slc38a8b (solute carrier family 38 member 8b [Source:ZFIN;Acc:ZDB-GENE-121005-6])

HSP 1 Score: 130.954 bits (328), Expect = 4.951e-32
Identity = 123/451 (27.27%), Postives = 209/451 (46.34%), Query Frame = 3
Query:  543 GILIMANVCLGMGILNFPRIFYEAGGI-TVTLISLAIFVVLIAGSLXXXXXXXXXXXXVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDRL----YSIASG---SEFTKHYYL-----MPIVAIVIFLPMCFIRDFTCFKY----------------------------VSVGGVLAALYITFGVSMVGYILKEPGDPELFIETKDQTRDFNLL---IPLLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFYSSVVSTISHEKIKDFLENFAI--------ARVLQTLXXXXXXXXCAVVIPNISNAISIIGAVSCHXXXXXXXXXXXXXYQKATISNRKHFIRKIGGIFYILLGTFCFGVNFTVAIQSL 1739
             I IM    LG G+LNFP  F +AGG+ T   + +   V LI+G L I+ Y         Y D+VR  CGR  G +C +   F L    +  +VV+ DQL++L    Y   +G   +E   H+Y      +  + ++I LP+   ++    KY                            +SV G LAA Y++  V +  Y LK+    +L  E       +  +   +P + +G+  H  +  ++S ++ +K+ +++    + +    + Y +TGVFG+LTFGR    D L++YP ++    +A L+    + T +P++  + RSV               +I  F E   I         R++ T++     ++ A+ +P++S  IS+IG +S  F F FPGLC  F+ Q   I++R   +    G+  I++G F FG + T+A+  L
Sbjct:   32 AIFIMLKSALGAGLLNFPWAFEKAGGVNTAISVEMVSLVFLISG-LVILGYASSISRQNTYHDVVRNVCGRRIGHLCEICFVFNLFMISVAFLVVVQDQLEKLCLSLYETVTGNTEAEMPHHWYTDYRFALSFMCLIIILPLSIPKEIGIQKYTRCVRGYAMLFLLLYHYVCSLNISLCSFISVMGTLAATYLSVAV-IAKYYLKDTHTADLTPEHSQGLGSWASMFSVVPTICFGFQCHEASIAIYSSMENKKITHWVFISVTSMIFCLLIYTLTGVFGFLTFGRKVASDILMSYPGNDVVMIIARLLFGISIVTIYPIILLLGRSVI------------LTQILRFWERRTIMTPVFEGRCRLILTILWITVTLLIAIFVPDMSEVISVIGGISAFFIFIFPGLCLIFVMQTEPINHRIRILLTGWGVVTIVIGAFIFGQSTTIAVMEL 468          
BLAST of slc38a-5 vs. Ensembl Xenopus
Match: kcnh6 (potassium channel, voltage gated eag related subfamily H, member 6 [Source:Xenbase;Acc:XB-GENE-990943])

HSP 1 Score: 128.642 bits (322), Expect = 2.897e-31
Identity = 120/432 (27.78%), Postives = 197/432 (45.60%), Query Frame = 3
Query:  468 FLQDGSLVDENDEESNFTGGAGWPSGILIMANVCLGMGILNFPRIFYEAGGITVTLISLAIFVVLIAGSLXXXXXXXXXXXXVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDRLYSIASGSE-------FTKHYYLMPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYILKEPGDPELFIETKDQT--RDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFYSSVVSTISHEKIKDFLENFAIARVLQTLXXXXXXXXCAVVIPNISNAISIIGAV-SCHXXXXXXXXXXXXXYQKATISNRKHFIRKIG-GIFYILLGTFCFGVNFTVAI 1730
             LQ  S+       S   GG      + I+ N  LG G+LNFP  F  AGGIT ++    + ++ I   L I+A+C    +   YQ++VR  CGR  G+ C V +     G+ I   +++ DQLD+L      ++       +    + + +  I++ LP+   R+ +  KY S   VL   Y+T  + +V  I  +   P   I +   +    FN  +P + +GY  HV +  V+  +++Q +  +   V   +FI+   Y  TGV G+L FG   + D LL++P D+    VA   +   + TS+P+L +  R+V  G +    S    E+           RVLQT+I F   ++ A+ IP+I   IS+IG + +C                +      K +   +  G+  + +GTF FG   T AI
Sbjct:   22 LLQSPSVATPELRRS--AGGTSPAGAVFIVVNAALGAGLLNFPAAFSAAGGITASISLQLVLLLFIISGLVILAHCADACSERTYQEVVRGVCGRTAGVFCEVLIAVYTFGTCIAFFIIIGDQLDKLLGAMMHTKAESPLPWYADRKFTISVTGILLILPLSLPREISVQKYASFLSVLGTCYVTV-IVIVRCIWPDTTIPSHDIPSSPSSWLAVFN-AVPTICFGYQCHVSSVPVYGSMQQQDIKRWGCIVTVAMFIALCVYTGTGVCGFLLFGSDVNQDVLLSFPSDDIAVAVARAFIILCVLTSYPILHYCGRAVLEGLWLRFTSQEPGEEPSKERRR----RVLQTVIWFLLTLLLALFIPDIGRVISLIGGLAACFIFIFPGLCLIHLKLSEIHEHKSKSWWALLSYGVSMVTIGTFIFGQTTTKAI 445          
BLAST of slc38a-5 vs. Ensembl Xenopus
Match: slc38a8 (solute carrier family 38 member 8 [Source:NCBI gene;Acc:733502])

HSP 1 Score: 124.02 bits (310), Expect = 9.838e-30
Identity = 117/452 (25.88%), Postives = 213/452 (47.12%), Query Frame = 3
Query:  474 QDGSLVDENDEESNFTGGAGWPSG---------ILIMANVCLGMGILNFPRIFYEAGGI-TVTLISLAIFVVLIAGSLXXXXXXXXXXXXVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDRLY-------SIASGSEFTKHYYLMP-----IVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYILKEPG--DPELFIETKDQTRDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSV-----FNGFYSSVVSTISHEKIKDFLENFAIARVLQTLXXXXXXXXCAVVIPNISNAISIIGAVSCHXXXXXXXXXXXXXYQKATISNRKHFIRKIGGIFYILLGTFCFGVNFTVAIQSLL 1742
            QD  + +   E  +  G +G   G         I IM    LG G+LNFP  F + GG+ T  ++ L   + LI+G L I+ Y         YQ +V+  CG   G +C +     L    +  + V+ DQL++L        ++ + SE ++ +Y+ P     ++ +VI LP+   ++ +  KY S+ G LAA Y+T  + +  Y+++ P     E           F++ +P + +G+  H     ++S +K + L N+       + I  + Y+ TG++G LTFG     D L++YP ++    +A L+ +  + T +P++  + R V      N    S+  T+++E+           RV+ T++     ++ A+ +P+IS  IS+IG +S  F F FPGLC     +   ++ +        G   ++ G F FG + T+A+  ++
Sbjct:    5 QDHRMEELARESISLLGKSGLEGGTPSLSSMGAIFIMLKSALGAGLLNFPWAFNKVGGMHTAIMVELVSLIFLISG-LVILGYASSLSKHSTYQGVVKDLCGPAIGKLCGICYIINLFMICVAFLRVVEDQLEKLCDSIHSNNTLYAMSEVSQSWYMDPRFAITVLCLVIILPLSIPKEISFQKYTSILGTLAACYLTVMIIIKYYVMEHPVLIKHEFSSNAASWASMFSV-VPTICFGFQCHEACVTIYSSMKNKCLSNWAAVSVVSMLICLLIYSFTGIYGSLTFGEAVAADILMSYPGNDVAVIIARLLFTISIITIYPIILLLGRCVIQEAWLNHREKSLFVTLTYER---------CVRVVITVLWILVTLLIALFVPDISEVISVIGGISAFFIFIFPGLCLVCAVESEPMNTKAKSCLTAWGAISVVCGAFVFGQSTTIAVMEII 445          
BLAST of slc38a-5 vs. Ensembl Xenopus
Match: slc38a8 (solute carrier family 38 member 8 [Source:NCBI gene;Acc:733502])

HSP 1 Score: 122.094 bits (305), Expect = 5.042e-29
Identity = 116/437 (26.54%), Postives = 209/437 (47.83%), Query Frame = 3
Query:  507 ESNFTGGAGWPS-----GILIMANVCLGMGILNFPRIFYEAGGI-TVTLISLAIFVVLIAGSLXXXXXXXXXXXXVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDRLY-------SIASGSEFTKHYYLMP-----IVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYILKEPG--DPELFIETKDQTRDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSV-----FNGFYSSVVSTISHEKIKDFLENFAIARVLQTLXXXXXXXXCAVVIPNISNAISIIGAVSCHXXXXXXXXXXXXXYQKATISNRKHFIRKIGGIFYILLGTFCFGVNFTVAIQSLL 1742
            +S   GG   PS      I IM    LG G+LNFP  F + GG+ T  ++ L   + LI+G L I+ Y         YQ +V+  CG   G +C +     L    +  + V+ DQL++L        ++ + SE ++ +Y+ P     ++ +VI LP+   ++ +  KY S+ G LAA Y+T  + +  Y+++ P     E           F++ +P + +G+  H     ++S +K + L N+       + I  + Y+ TG++G LTFG     D L++YP ++    +A L+ +  + T +P++  + R V      N    S+  T+++E+           RV+ T++     ++ A+ +P+IS  IS+IG +S  F F FPGLC     +   ++ +        G   ++ G F FG + T+A+  ++
Sbjct:   14 KSGLEGGT--PSLSSMGAIFIMLKSALGAGLLNFPWAFNKVGGMHTAIMVELVSLIFLISG-LVILGYASSLSKHSTYQGVVKDLCGPAIGKLCGICYIINLFMICVAFLRVVEDQLEKLCDSIHSNNTLYAMSEVSQSWYMDPRFAITVLCLVIILPLSIPKEISFQKYTSILGTLAACYLTVMIIIKYYVMEHPVLIKHEFSSNAASWASMFSV-VPTICFGFQCHEACVTIYSSMKNKCLSNWAAVSVVSMLICLLIYSFTGIYGSLTFGEAVAADILMSYPGNDVAVIIARLLFTISIITIYPIILLLGRCVIQEAWLNHREKSLFVTLTYER---------CVRVVITVLWILVTLLIALFVPDISEVISVIGGISAFFIFIFPGLCLVCAVESEPMNTKAKSCLTAWGAISVVCGAFVFGQSTTIAVMEII 437          
BLAST of slc38a-5 vs. Ensembl Xenopus
Match: kcnh6 (potassium channel, voltage gated eag related subfamily H, member 6 [Source:Xenbase;Acc:XB-GENE-990943])

HSP 1 Score: 117.857 bits (294), Expect = 9.168e-28
Identity = 107/369 (29.00%), Postives = 172/369 (46.61%), Query Frame = 3
Query:  468 FLQDGSLVDENDEESNFTGGAGWPSGILIMANVCLGMGILNFPRIFYEAGGITVTLISLAIFVVLIAGSLXXXXXXXXXXXXVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDRLYSIASGSEFTKHYYLMPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYILKEPGDPELFIETKDQTRDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFYSSVVSTISHEKIKDFLENFAIARVLQTLXXXXXXXXCAVVIPNISNAISIIGAVS 1574
             LQ  S+       S   GG      + I+ N  LG G+LNFP  F  AGGIT ++    + ++ I   L I+A+C    +   YQ++VR  CGR  G+ C V +     G+ I   +++ DQLD+L         TK    +P  A          R FT    +SV G+L  L ++    +    +++   P  ++        FN  +P + +GY  HV +  V+  +++Q +  +   V   +FI+   Y  TGV G+L FG   + D LL++P D+    VA   +   + TS+P+L +  R+V  G +    S    E+           RVLQT+I F   ++ A+ IP+I   IS+IG ++
Sbjct:   22 LLQSPSVATPELRRS--AGGTSPAGAVFIVVNAALGAGLLNFPAAFSAAGGITASISLQLVLLLFIISGLVILAHCADACSERTYQEVVRGVCGRTAGVFCEVLIAVYTFGTCIAFFIIIGDQLDKLLG---AMMHTKAESPLPWYAD---------RKFT----ISVTGILLILPLSLPREIS---VQKYASPSSWLAV------FNA-VPTICFGYQCHVSSVPVYGSMQQQDIKRWGCIVTVAMFIALCVYTGTGVCGFLLFGSDVNQDVLLSFPSDDIAVAVARAFIILCVLTSYPILHYCGRAVLEGLWLRFTSQEPGEEPSKERRR----RVLQTVIWFLLTLLLALFIPDIGRVISLIGGLA 358          
BLAST of slc38a-5 vs. Ensembl Xenopus
Match: SLC36A4 (solute carrier family 36 (proton/amino acid symporter), member 4 [Source:NCBI gene;Acc:100493349])

HSP 1 Score: 53.9138 bits (128), Expect = 5.977e-7
Identity = 56/222 (25.23%), Postives = 99/222 (44.59%), Query Frame = 3
Query:  915 IFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMV-GYILKEPGDPELFIETKDQTRDFNLLIPLLVYGYHG-HVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFYSSVVSTISHEKIKDFLENFAIARVLQTLXXXXXXXXCAVVIPNISNAISIIGAVS 1574
            + +P+ FIRD    K +S+   LA L +   + +V  Y+++   DP   +      + + L     ++ + G  V  PL  + ++ +K  +F K +   + I T  Y      GY  FG        LN P+D+W   V  ++ SF ++ ++ + ++V   +     +S V     +K +  L  F +   L  L   F     AV+IP +   IS +GAVS
Sbjct:  245 LIIPLVFIRDL---KNLSLLSFLANLSMAISLIIVYQYVIRNLSDPRA-LPLGTSWKTYPLFFGTAIFAFEGIGVVLPLE-NRMRDKK--DFSKALNIGMAIVTALYISLATLGYFCFGDQIKGSITLNLPQDSWLYQVVKILYSFGIYVTYAIQYYVPAEIILPAVTSRV-----QKTRKLLCEFTMRFFLVCLTCAF-----AVLIPRLDLVISFVGAVS 449          
BLAST of slc38a-5 vs. Ensembl Mouse
Match: Slc38a8 (solute carrier family 38, member 8 [Source:MGI Symbol;Acc:MGI:2685433])

HSP 1 Score: 144.436 bits (363), Expect = 7.074e-37
Identity = 122/413 (29.54%), Postives = 203/413 (49.15%), Query Frame = 3
Query:  543 GILIMANVCLGMGILNFPRIFYEAGGITVT-LISLAIFVVLIAGSLXXXXXXXXXXXXVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQL----DRLYSIASGSEFTKHYYLMPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYI-----LKEPGDPELFIETKDQTRDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVC--YAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFY-SSVVSTISHEKIKDFLENFAIARVLQTLXXXXXXXXCAVVIPNISNAISIIGAVSCHXXXXXXXXXXXXXYQKATISNRKHFIRKIGGIFYILLGTFCFGVNFTVAIQSLL 1742
             + I+    LG G+LNFP  FY+AGG+  T L++L   V LI+G L I+ Y         YQ +VR  CG   G +C +     L    +  + V+ DQL    D L   A    +    + +P++++++  P+  +R+    KY S+ G LAA Y+   +++  Y+     +++PG     +     T  F++  P + +G+  H  A  ++  +  Q L ++  T+ S L +   C  Y +TGV+G+LTFG     D L++YP ++    VA ++ +  + T +P++ F+ RSV   F+  S  +T     + D   +    R+  T +     +  A+ +P++S  ISIIG VS  F F FPGLC         +  R     +  GI  +L+GTF FG +  VA+  LL
Sbjct:   29 AVFILLKSALGAGLLNFPWAFYKAGGMLPTFLVALVSLVFLISG-LVILGYAASVSGQTTYQGVVRELCGPAMGKLCEICFLTNLLMISVAFLRVIGDQLEKLCDSLLPDAPQPWYAAQNFTLPLISMLVIFPLSALREIALQKYTSILGTLAACYLALVITVQYYLWPQGLIRQPGP---LLSPSPWTSVFSVF-PTICFGFQCHEAAVSIYCSMWNQSLSHW--TLVSVLSLLACCLVYTLTGVYGFLTFGPEVSADILMSYPGNDTAIIVARVLFAVSIVTVYPIVLFLGRSVMQDFWKKSYWATRGPPVLAD--PSGPWVRLPLTFLWVVVTLTMALFLPDLSEIISIIGGVSSFFIFIFPGLCLICAVDTEPMGPRVKCCLEAWGILSVLVGTFIFGQSTAVAMVELL 432          
BLAST of slc38a-5 vs. Ensembl Mouse
Match: Slc38a7 (solute carrier family 38, member 7 [Source:MGI Symbol;Acc:MGI:2679005])

HSP 1 Score: 141.739 bits (356), Expect = 4.347e-36
Identity = 107/372 (28.76%), Postives = 186/372 (50.00%), Query Frame = 3
Query:  498 NDEESNFTGGAGWPSGILIMANVCLGMGILNFPRIFYEAGGITVTL-ISLAIFVVLIAGSLXXXXXXXXXXXXVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDRLYSI-------ASGSE-FTKHYYLMPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYILKE----PGDPELFIETKDQTRDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFYSSVVSTISHEKIKDFLENFAIARVLQTLXXXXXXXXCAVVIPNISNAISIIGAVS 1574
             D +S  T   G    + I+ N CLG G+LNFP  F  AGG+   + + + + V +I+G L I+AYC +      YQ++V   CG+  G++C V++     G+ I  ++++ DQ D++ ++       ASGS  +T   + + + A +  LP+   ++    KY S   V+   Y+T  + ++ YI  +    PGD  +          FN + P + +G+  HV +  VF+ +++ ++  +   V + + I+   Y  TG+ G+LTFG   D D L +YP ++    VA   +   + TS+P+L F  R+V  G +         E +          RVLQTL+ F   ++ A+ IP+I   IS+IG ++
Sbjct:   44 GDPDSGTTSTLG---AVFIVVNACLGAGLLNFPAAFSTAGGVAAGIALQMGMLVFIISG-LVILAYCSQASNERTYQEVVWAVCGKLTGVLCEVAIAVYTFGTCIAFLIIIGDQQDKIIAVMSKEPDGASGSPWYTDRKFTISLTAFLFILPLSIPKEIGFQKYASFLSVVGTWYVT-AIIIIKYIWPDKEMRPGD--ILTRPASWMAVFNAM-PTICFGFQCHVSSVPVFNSMRQPEVKTWGGVVTAAMVIALAVYMGTGICGFLTFGAAVDPDVLRSYPSEDVAVAVARAFIILSVLTSYPILHFCGRAVVEGLWLRYKGMPVEEDVGRERRR----RVLQTLVWFLLTLLLALFIPDIGKVISVIGGLA 403          
BLAST of slc38a-5 vs. Ensembl Mouse
Match: Slc38a7 (solute carrier family 38, member 7 [Source:MGI Symbol;Acc:MGI:2679005])

HSP 1 Score: 141.354 bits (355), Expect = 1.424e-35
Identity = 107/372 (28.76%), Postives = 186/372 (50.00%), Query Frame = 3
Query:  498 NDEESNFTGGAGWPSGILIMANVCLGMGILNFPRIFYEAGGITVTL-ISLAIFVVLIAGSLXXXXXXXXXXXXVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDRLYSI-------ASGSE-FTKHYYLMPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYILKE----PGDPELFIETKDQTRDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFYSSVVSTISHEKIKDFLENFAIARVLQTLXXXXXXXXCAVVIPNISNAISIIGAVS 1574
             D +S  T   G    + I+ N CLG G+LNFP  F  AGG+   + + + + V +I+G L I+AYC +      YQ++V   CG+  G++C V++     G+ I  ++++ DQ D++ ++       ASGS  +T   + + + A +  LP+   ++    KY S   V+   Y+T  + ++ YI  +    PGD  +          FN + P + +G+  HV +  VF+ +++ ++  +   V + + I+   Y  TG+ G+LTFG   D D L +YP ++    VA   +   + TS+P+L F  R+V  G +         E +          RVLQTL+ F   ++ A+ IP+I   IS+IG ++
Sbjct:   44 GDPDSGTTSTLG---AVFIVVNACLGAGLLNFPAAFSTAGGVAAGIALQMGMLVFIISG-LVILAYCSQASNERTYQEVVWAVCGKLTGVLCEVAIAVYTFGTCIAFLIIIGDQQDKIIAVMSKEPDGASGSPWYTDRKFTISLTAFLFILPLSIPKEIGFQKYASFLSVVGTWYVT-AIIIIKYIWPDKEMRPGD--ILTRPASWMAVFNAM-PTICFGFQCHVSSVPVFNSMRQPEVKTWGGVVTAAMVIALAVYMGTGICGFLTFGAAVDPDVLRSYPSEDVAVAVARAFIILSVLTSYPILHFCGRAVVEGLWLRYKGMPVEEDVGRERRR----RVLQTLVWFLLTLLLALFIPDIGKVISVIGGLA 403          
BLAST of slc38a-5 vs. Ensembl Mouse
Match: Slc38a7 (solute carrier family 38, member 7 [Source:MGI Symbol;Acc:MGI:2679005])

HSP 1 Score: 141.354 bits (355), Expect = 1.424e-35
Identity = 107/372 (28.76%), Postives = 186/372 (50.00%), Query Frame = 3
Query:  498 NDEESNFTGGAGWPSGILIMANVCLGMGILNFPRIFYEAGGITVTL-ISLAIFVVLIAGSLXXXXXXXXXXXXVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDRLYSI-------ASGSE-FTKHYYLMPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYILKE----PGDPELFIETKDQTRDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFYSSVVSTISHEKIKDFLENFAIARVLQTLXXXXXXXXCAVVIPNISNAISIIGAVS 1574
             D +S  T   G    + I+ N CLG G+LNFP  F  AGG+   + + + + V +I+G L I+AYC +      YQ++V   CG+  G++C V++     G+ I  ++++ DQ D++ ++       ASGS  +T   + + + A +  LP+   ++    KY S   V+   Y+T  + ++ YI  +    PGD  +          FN + P + +G+  HV +  VF+ +++ ++  +   V + + I+   Y  TG+ G+LTFG   D D L +YP ++    VA   +   + TS+P+L F  R+V  G +         E +          RVLQTL+ F   ++ A+ IP+I   IS+IG ++
Sbjct:   44 GDPDSGTTSTLG---AVFIVVNACLGAGLLNFPAAFSTAGGVAAGIALQMGMLVFIISG-LVILAYCSQASNERTYQEVVWAVCGKLTGVLCEVAIAVYTFGTCIAFLIIIGDQQDKIIAVMSKEPDGASGSPWYTDRKFTISLTAFLFILPLSIPKEIGFQKYASFLSVVGTWYVT-AIIIIKYIWPDKEMRPGD--ILTRPASWMAVFNAM-PTICFGFQCHVSSVPVFNSMRQPEVKTWGGVVTAAMVIALAVYMGTGICGFLTFGAAVDPDVLRSYPSEDVAVAVARAFIILSVLTSYPILHFCGRAVVEGLWLRYKGMPVEEDVGRERRR----RVLQTLVWFLLTLLLALFIPDIGKVISVIGGLA 403          
BLAST of slc38a-5 vs. Ensembl Mouse
Match: Slc38a8 (solute carrier family 38, member 8 [Source:MGI Symbol;Acc:MGI:2685433])

HSP 1 Score: 76.6406 bits (187), Expect = 1.963e-15
Identity = 53/178 (29.78%), Postives = 89/178 (50.00%), Query Frame = 3
Query:  543 GILIMANVCLGMGILNFPRIFYEAGGITVT-LISLAIFVVLIAGSLXXXXXXXXXXXXVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQL----DRLYSIASGSEFTKHYYLMPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGY-----ILKEPGD 1046
             + I+    LG G+LNFP  FY+AGG+  T L++L   V LI+G L I+ Y         YQ +VR  CG   G +C +     L    +  + V+ DQL    D L   A    +    + +P++++++  P+  +R+    KY S+ G LAA Y+   +++  Y     ++++PG 
Sbjct:   29 AVFILLKSALGAGLLNFPWAFYKAGGMLPTFLVALVSLVFLISG-LVILGYAASVSGQTTYQGVVRELCGPAMGKLCEICFLTNLLMISVAFLRVIGDQLEKLCDSLLPDAPQPWYAAQNFTLPLISMLVIFPLSALREIALQKYTSILGTLAACYLALVITVQYYLWPQGLIRQPGP 205          
BLAST of slc38a-5 vs. UniProt/SwissProt
Match: sp|Q6DEL1|S38A7_DANRE (Putative sodium-coupled neutral amino acid transporter 7 OS=Danio rerio OX=7955 GN=slc38a7 PE=2 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 5.642e-37
Identity = 121/448 (27.01%), Postives = 208/448 (46.43%), Query Frame = 3
Query:  468 FLQDGSL--VDENDEESNFTGGAGWPSGILIMANVCLGMGILNFPRIFYEAGGITVTLISLAIFVVLIAGSLXXXXXXXXXXXXVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDRLYSI---ASGSEFTKHYYL-----MPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYIL--KEPGDPELFIETKDQTRDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFY-----SSVVSTISHEKIKDFLENFAIARVLQTLXXXXXXXXCAVVIPNISNAISIIGAV-SCHXXXXXXXXXXXXXYQKATISNRKHFIRKIGGIFYILLGTFCFGVNFTVAIQSLLKSRPS 1757
             LQ  S+  V    +  +  GG      + I+ N  LG G+LNFP  F  AGGIT  +      +  I   L I+AYC +      YQ++VR  CG+  G++C +++     G+ I  ++++ DQLD+L       S  E + H+Y      + + +++I LP+   ++    KY S   V+   Y+T  + +V YI   K+     + +     T  FN + P + +G+  HV +  VF+ +KK ++  +   V   + I    Y  TGV G+L+FG +   D L++YP D+    +A   +   + TS+P+L F  R+V  G +       V + ++ E+ +         R+LQTL+ F   +I A+ IP+I   IS+IG + +C                +  + +         G+  + +G F FG   T AI   + + P+
Sbjct:   27 LLQSPSVDSVQPPSQSDDSRGGTSSLGAVFIVVNAALGAGLLNFPAAFNMAGGITAGVTLQMCMMAFIITGLVILAYCSQVSNESTYQEVVRAVCGKALGVICELAIAVYTFGTCIAFLIIIGDQLDKLIGAINNESEKEISLHWYTDRKFTITLTSVLIILPLSIPKEIGFQKYASTLSVIGTWYVTI-IVIVKYIWPSKDVSPGIIPVRPASWTDVFNAM-PTICFGFQCHVSSVPVFNSMKKPEIRPWWGVVTISMIICLFVYTGTGVCGFLSFGSSVSQDVLMSYPSDDVAVAIARAFIIICVVTSYPILHFCGRAVLEGLWLRFKGEEVETDVAKERRR---------RILQTLVWFCLTLILALFIPDIGRVISLIGGLAACFIFVFPGLCLIQAKLSEHDVRSNSWNAMVAYGVIMVTIGAFIFGQTTTNAIYKDIINNPN 463          
BLAST of slc38a-5 vs. UniProt/SwissProt
Match: sp|Q5R9F5|S38A7_PONAB (Putative sodium-coupled neutral amino acid transporter 7 OS=Pongo abelii OX=9601 GN=SLC38A7 PE=2 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 1.036e-36
Identity = 106/361 (29.36%), Postives = 185/361 (51.25%), Query Frame = 3
Query:  543 GILIMANVCLGMGILNFPRIFYEAGGITVTL-ISLAIFVVLIAGSLXXXXXXXXXXXXVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDRLYSI-------ASGSEFTKHYYLMPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYILKE----PGDPELFIETKDQTRDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFY-----SSVVSTISHEKIKDFLENFAIARVLQTLXXXXXXXXCAVVIPNISNAISIIGAVS 1574
             I I+ N CLG G+LNFP  F  AGG+   + + + + V +I+G L I+AYC +      YQ++V   CG+  G++C V++     G+ I  ++++ DQ D++ ++       ASG  +T   + + + A +  LP+   R+    KY S   V+   Y+T  + ++ YI  +    PG+  +          FN + P + +G+  HV +  VF+ +++ ++  +   V + + I+   Y  TG+ G+LTFG   D D LL+YP ++    VA   +   + TS+P+L F  R+V  G +      SV   +  E+ +         RVLQTL+ F   ++ A+ IP+I   IS+IG ++
Sbjct:   56 AIFIVVNACLGAGLLNFPAAFSTAGGVAAGIALQMGMLVFIISG-LVILAYCSQASNERTYQEVVWAVCGKLTGVLCEVAIAVYTFGTCIAFLIIIGDQQDKIIAVMAKEPEGASGPWYTDRKFTISLTAFLFILPLSIPREIGFQKYASFLSVVGTWYVT-AIVIIKYIWPDKEMTPGN--ILTRPASWMAVFNAM-PTICFGFQCHVSSVPVFNSMQQPEVKTWGGVVTAAMVIALAVYMGTGICGFLTFGAAVDPDVLLSYPSEDMAVAVARAFIILSVLTSYPILHFCGRAVVEGLWLRYQGVSVEEDVGRERRR---------RVLQTLVWFLLTLLLALFIPDIGKVISVIGGLA 402          
BLAST of slc38a-5 vs. UniProt/SwissProt
Match: sp|Q9NVC3|S38A7_HUMAN (Putative sodium-coupled neutral amino acid transporter 7 OS=Homo sapiens OX=9606 GN=SLC38A7 PE=1 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 2.488e-36
Identity = 104/356 (29.21%), Postives = 181/356 (50.84%), Query Frame = 3
Query:  543 GILIMANVCLGMGILNFPRIFYEAGGITVTL-ISLAIFVVLIAGSLXXXXXXXXXXXXVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDRLYSI-------ASGSEFTKHYYLMPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYILKE----PGDPELFIETKDQTRDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFYSSVVSTISHEKIKDFLENFAIARVLQTLXXXXXXXXCAVVIPNISNAISIIGAVS 1574
             I I+ N CLG G+LNFP  F  AGG+   + + + + V +I+G L I+AYC +      YQ++V   CG+  G++C V++     G+ I  ++++ DQ D++ ++       ASG  +T   + + + A +  LP+   R+    KY S   V+   Y+T  + ++ YI  +    PG+  +          FN + P + +G+  HV +  VF+ +++ ++  +   V + + I+   Y  TG+ G+LTFG   D D LL+YP ++    VA   +   + TS+P+L F  R+V  G +         E +          RVLQTL+ F   ++ A+ IP+I   IS+IG ++
Sbjct:   56 AIFIVVNACLGAGLLNFPAAFSTAGGVAAGIALQMGMLVFIISG-LVILAYCSQASNERTYQEVVWAVCGKLTGVLCEVAIAVYTFGTCIAFLIIIGDQQDKIIAVMAKEPEGASGPWYTDRKFTISLTAFLFILPLSIPREIGFQKYASFLSVVGTWYVT-AIVIIKYIWPDKEMTPGN--ILTRPASWMAVFNAM-PTICFGFQCHVSSVPVFNSMQQPEVKTWGGVVTAAMVIALAVYMGTGICGFLTFGAAVDPDVLLSYPSEDMAVAVARAFIILSVLTSYPILHFCGRAVVEGLWLRYQGVPVEEDVGRERRR----RVLQTLVWFLLTLLLALFIPDIGKVISVIGGLA 402          
BLAST of slc38a-5 vs. UniProt/SwissProt
Match: sp|Q5HZH7|S38A8_MOUSE (Putative sodium-coupled neutral amino acid transporter 8 OS=Mus musculus OX=10090 GN=Slc38a8 PE=2 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 4.948e-36
Identity = 122/413 (29.54%), Postives = 203/413 (49.15%), Query Frame = 3
Query:  543 GILIMANVCLGMGILNFPRIFYEAGGITVT-LISLAIFVVLIAGSLXXXXXXXXXXXXVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQL----DRLYSIASGSEFTKHYYLMPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYI-----LKEPGDPELFIETKDQTRDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVC--YAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFY-SSVVSTISHEKIKDFLENFAIARVLQTLXXXXXXXXCAVVIPNISNAISIIGAVSCHXXXXXXXXXXXXXYQKATISNRKHFIRKIGGIFYILLGTFCFGVNFTVAIQSLL 1742
             + I+    LG G+LNFP  FY+AGG+  T L++L   V LI+G L I+ Y         YQ +VR  CG   G +C +     L    +  + V+ DQL    D L   A    +    + +P++++++  P+  +R+    KY S+ G LAA Y+   +++  Y+     +++PG     +     T  F++  P + +G+  H  A  ++  +  Q L ++  T+ S L +   C  Y +TGV+G+LTFG     D L++YP ++    VA ++ +  + T +P++ F+ RSV   F+  S  +T     + D   +    R+  T +     +  A+ +P++S  ISIIG VS  F F FPGLC         +  R     +  GI  +L+GTF FG +  VA+  LL
Sbjct:   29 AVFILLKSALGAGLLNFPWAFYKAGGMLPTFLVALVSLVFLISG-LVILGYAASVSGQTTYQGVVRELCGPAMGKLCEICFLTNLLMISVAFLRVIGDQLEKLCDSLLPDAPQPWYAAQNFTLPLISMLVIFPLSALREIALQKYTSILGTLAACYLALVITVQYYLWPQGLIRQPGP---LLSPSPWTSVFSVF-PTICFGFQCHEAAVSIYCSMWNQSLSHW--TLVSVLSLLACCLVYTLTGVYGFLTFGPEVSADILMSYPGNDTAIIVARVLFAVSIVTVYPIVLFLGRSVMQDFWKKSYWATRGPPVLAD--PSGPWVRLPLTFLWVVVTLTMALFLPDLSEIISIIGGVSSFFIFIFPGLCLICAVDTEPMGPRVKCCLEAWGILSVLVGTFIFGQSTAVAMVELL 432          
BLAST of slc38a-5 vs. UniProt/SwissProt
Match: sp|Q6JWR2|S38A7_RAT (Putative sodium-coupled neutral amino acid transporter 7 OS=Rattus norvegicus OX=10116 GN=Slc38a7 PE=2 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 1.211e-35
Identity = 107/372 (28.76%), Postives = 187/372 (50.27%), Query Frame = 3
Query:  498 NDEESNFTGGAGWPSGILIMANVCLGMGILNFPRIFYEAGGITVTL-ISLAIFVVLIAGSLXXXXXXXXXXXXVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDRLYSI-------ASGSE-FTKHYYLMPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYILKE----PGDPELFIETKDQTRDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFYSSVVSTISHEKIKDFLENFAIARVLQTLXXXXXXXXCAVVIPNISNAISIIGAVS 1574
             D +S  T   G    + I+ N CLG G+LNFP  F  AGG+   + + + + V +I+G L I+AYC +      YQ++V   CG+  G++C +++     G+ I  ++++ DQ D++ ++       ASGS  +T   + + + A +  LP+   ++    KY S   V+   Y+T  + ++ YI  +    PGD  +          FN + P + +G+  HV +  VF+ +++ ++  +   V + + I+   Y  TG+ G+LTFG   D D L +YP ++    VA   +   + TS+P+L F  R+V  G +     T   E +          RVLQTL+ F   ++ A+ IP+I   IS+IG ++
Sbjct:   44 GDPDSGTTSTLG---AVFIVVNACLGAGLLNFPAAFSTAGGVAAGIALQMGMLVFIISG-LVILAYCSQASNERTYQEVVWAVCGKLTGVLCEIAIAVYTFGTCIAFLIIIGDQQDKIIAVMAKEPDGASGSPWYTDRKFTISLTAFLFILPLSIPKEIGFQKYASSLSVVGTWYVT-AIVIIKYIWPDKEMRPGD--ILTRPASWMAVFNAM-PTICFGFQCHVSSVPVFNSMRQPQVKTWGGVVTAAMVIALAVYMGTGICGFLTFGAAVDPDVLRSYPSEDVAVAVARAFIILSVLTSYPILHFCGRAVVEGLWLRYKGTPVEEDVGRERRR----RVLQTLVWFLLTLLLALFIPDIGKVISVIGGLA 403          
BLAST of slc38a-5 vs. TrEMBL
Match: A0A0H3YJJ8 (Slc38a-5 OS=Schmidtea mediterranea OX=79327 GN=slc38a-5 PE=2 SV=1)

HSP 1 Score: 869.766 bits (2246), Expect = 0.000e+0
Identity = 484/484 (100.00%), Postives = 484/484 (100.00%), Query Frame = 3
Query:  309 MANKNNENLSSSGNVIEDNPNNAQLTTFESTDSDIFYXXXXXXXXXXXASSGGFLQDGSLVDENDEESNFTGGAGWPSGILIMANVCLGMGILNFPRIFYEAGGITVTLISLAIFVVLIAGSLXXXXXXXXXXXXVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDRLYSIASGSEFTKHYYLMPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYILKEPGDPELFIETKDQTRDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFYSSVVSTISHEKIKDFLENFAIARVLQTLXXXXXXXXCAVVIPNISNAISIIGAVSCHXXXXXXXXXXXXXYQKATISNRKHFIRKIGGIFYILLGTFCFGVNFTVAIQSLLKSRPSI 1760
            MANKNNENLSSSGNVIEDNPNNAQLTTFESTDSDIFYNNNNNKRKRSSASSGGFLQDGSLVDENDEESNFTGGAGWPSGILIMANVCLGMGILNFPRIFYEAGGITVTLISLAIFVVLIAGSLYIIAYCCRYYACVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDRLYSIASGSEFTKHYYLMPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYILKEPGDPELFIETKDQTRDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFYSSVVSTISHEKIKDFLENFAIARVLQTLIIFFFIIICAVVIPNISNAISIIGAVSCHFCFTFPGLCFFFLYQKATISNRKHFIRKIGGIFYILLGTFCFGVNFTVAIQSLLKSRPSI
Sbjct:    1 MANKNNENLSSSGNVIEDNPNNAQLTTFESTDSDIFYNNNNNKRKRSSASSGGFLQDGSLVDENDEESNFTGGAGWPSGILIMANVCLGMGILNFPRIFYEAGGITVTLISLAIFVVLIAGSLYIIAYCCRYYACVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDRLYSIASGSEFTKHYYLMPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYILKEPGDPELFIETKDQTRDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFYSSVVSTISHEKIKDFLENFAIARVLQTLIIFFFIIICAVVIPNISNAISIIGAVSCHFCFTFPGLCFFFLYQKATISNRKHFIRKIGGIFYILLGTFCFGVNFTVAIQSLLKSRPSI 484          
BLAST of slc38a-5 vs. TrEMBL
Match: A0A0H3YFA8 (Slc38a-1 OS=Schmidtea mediterranea OX=79327 GN=slc38a-1 PE=2 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 3.095e-49
Identity = 139/443 (31.38%), Postives = 233/443 (52.60%), Query Frame = 3
Query:  456 SSGGFLQDGSLVDENDEES-----NFT-----GGAGWPSGILIMANVCLGMGILNFPRIFYEAGGITVTLISLAIFVVLIAGSLXXXXXXXXXXXXVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDRLYSIASGSEFTKHYYL-----MPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYILKEPGDPELFIETKDQT-RDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFYSSVVSTISHEKIKDFLENFAIARVLQTLXXXXXXXXCAVVIPNISNAISIIGAVSCHXXXXXXXXXXXXXYQKATISNRKHFIRKIGGIFYILLGTFCFGVNFTVAIQS 1736
            S+    +  S+++ N+E S     NF+      G  W S +LIMAN  +GMG+LNFP     AGG  V + +  + +  I  SL ++ Y  +YY  V++Q ++  H G+    +C + +F    G+LIV ++V+ DQ + +       E   H+ L     +PI++IV   P+C +++F  FKY S  GV+AALYI+FG+    Y          F+E K+    +   +IPL+ + Y  H+E P + + +KKQ +  + K ++ Y+ +S++ Y+  G+FGYLTFG  T  D L  Y   + +  VA+++++ K+ T++P++F+ +R V   +    +S        D L  +++  VL     F   ++ A+ + NIS  I++IG +S  F F FPG+CF  LY  +    +   I  I G  YI LG F   V+   +I+ 
Sbjct:   60 STEPIFRRSSVIEINNESSETSVINFSELYSYTGTSWFSAVLIMANCTIGMGLLNFPFAIMNAGGNLVGMFTQMVIIAFIVVSLNMMCYLSQYYGDVSFQGVIGSHLGKVSKEICRILIFLNNFGALIVSLIVIGDQFEHISRAIWAHEEALHWLLDRRVMVPIISIVFIFPLCLLKNFDIFKYTSFLGVIAALYISFGLIFKSYFTLNGSK---FVEVKESNLSNLVKIIPLICFTYECHIEIPPMIACLKKQNICYYEKMIFGYVILSSIVYSFAGIFGYLTFGAATPDDILTAYDPKDPYVIVAMVLITLKIVTTYPIVFYCLRIVVEDYVKVFISKFQQRSRCDSLIKYSLTIVL-----FSSTVLIAIFVQNISTVINLIGGISAVFIFIFPGMCFLKLYSSSPRKWKWSLI--ILGSLYIALGVFISAVSTAHSIEE 492          
BLAST of slc38a-5 vs. TrEMBL
Match: T1INZ5 (Aa_trans domain-containing protein OS=Strigamia maritima OX=126957 PE=4 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 4.338e-43
Identity = 112/370 (30.27%), Postives = 189/370 (51.08%), Query Frame = 3
Query:  486 LVDENDEESNFTGGAGWPSGILIMANVCLGMGILNFPRIFYEAGGITVTLISLAIFVV-LIAGSLXXXXXXXXXXXXVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDRLYSIASGSEFTKHYYL-----MPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYILKEPGDPELFIETKD-QTRDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFYSSVVSTISHEKIKDFLENFAIARVLQTLXXXXXXXXCAVVIPNISNAISIIGAVS 1574
            L+  +    N   G  W   I ++ N  LG G+LNFP+ +  AGG+T  LI  A+ +V ++A  L + +      +   YQD+V   CG  +  +C+V +     G+ I  +V++ DQ DR+ +   G  F  ++Y+     + + ++V  LP+CF R     KYVS  GV+A  Y+ F   ++ Y   E  D    I+T+  +  D   ++P + +GY  HV A  ++S + K+ + NF KTV++ + I  + Y++ G +GY TFG     D L +Y        V IL+++ K  T++P+L F  R   +G    + S ISH      + N    R++  L+ F   +I    +PNIS+ I I+G+++
Sbjct:   20 LIQRDRTNPNNNKGTTWYGAIFLVVNAALGAGLLNFPQAYDLAGGLTAALIVQAVLIVFVVAALLIMASCANLNESSSTYQDVVLETCGVKYQTICAVGITLYCYGTCITFLVIIGDQYDRVLASLFGQTFCHYWYMNRHFTISVTSVVFILPICFSRRIDFLKYVSSVGVIAIFYVVF---LIIYQYYEQTDHPTDIKTRPAKWMDIFNVVPTICFGYQCHVSAIPIYSCLSKRTVGNFSKTVFAAIIICMLVYSLAGAYGYYTFGSKVPSDVLEDYNAKKPLVLVGILMLTVKTITTYPILLFCGRVAIDGL---IASRISHNSA---ILNEKKRRIIICLVWFATTLIITAFVPNISSVIDILGSLA 380          
BLAST of slc38a-5 vs. TrEMBL
Match: K1R8B6 (Putative sodium-coupled neutral amino acid transporter 7 OS=Crassostrea gigas OX=29159 GN=CGI_10020395 PE=4 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 1.541e-41
Identity = 133/447 (29.75%), Postives = 224/447 (50.11%), Query Frame = 3
Query:  471 LQDGSLVDENDEE--------SNFTGGAGWPSGILIMANVCLGMGILNFPRIFYEAGGITVTLISLAIFVVLIAGSLXXXXXXXXXXXXVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDRLYSIASGSEFTKH--YYLMPIVAIVI-----FLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYILKEPGDPELFIETKDQTRDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFYSSVVSTISHEKIKDFLENFAIARVLQTLXXXXXXXXCAVVIPNISNAISIIGAVSCHXXXXXXXXXXXXXYQKATISNRKHFIRKI-----GGIFYILLGTFCFGVNFTVAIQSLLKSR 1751
            +QD S   E+           S    G+ W S + ++ N  LG G+LNFP  + +AGG+ + ++  AI +V +  ++ I+AYC      + YQD+V   CG+    +C+ ++     G+ I  ++++ DQ +  +  A+ + +  H  +Y+  +  I +      LP+CF +     KY S  GV   LY+   V+ V Y L  P +P        Q  D  L++P + + Y  HV    ++S ++ + L  F KTV   +F+  + Y  T  FGYLTFG     D LL+Y  D W   +A+L+++ K +T++P+L F  R+  +  ++ +   +S +KI+     F   RV  T+I F   +  AV IPNI   I I+GA +  F F FPG+C     QK  +  + H+  ++     G   +I+LG+F FG+  +   QS++K  
Sbjct:    9 VQDSSTASEDSPLLTKEVIIISEPRRGSSWFSSVFLVVNAALGAGLLNFPDAYQQAGGVLIAVLIQAILLVFVVCAIMILAYCSDINKSLTYQDVVESVCGKNAQRLCAFTIMTYCFGTCITFLIIIGDQWEEFFLFAAHNWYCTHSPWYMDRVTTICVSSVFLILPLCFPKRIDFLKYASFIGVFGILYVVALVT-VKYFLPHP-EPGAIAVRPLQWEDVFLVVPTICFSYQCHVSIIPIYSCMENRCLKEFSKTVAVAMFLCVLNYTGTAAFGYLTFGNMITTDILLSYHPDGWVI-IAVLLIAIKTYTTYPILLFCGRAALDCLWTDIFK-MSPDKIEQ--TEFK-RRVSVTIIWFVLTLALAVFIPNIGVVIQILGAFAAIFIFIFPGMCVVSAVQK-RVWQQGHWTTRLKVITAGACAFIVLGSFIFGLTLS---QSIIKDE 444          
BLAST of slc38a-5 vs. TrEMBL
Match: A0A2R5L9I7 (Putative amino acid transporter protein (Fragment) OS=Ornithodoros turicata OX=34597 PE=4 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 1.136e-39
Identity = 115/390 (29.49%), Postives = 200/390 (51.28%), Query Frame = 3
Query:  459 SGGFLQDGSLVDENDEESNFTG-----GAGWPSGILIMANVCLGMGILNFPRIFYEAGGITVTLISLAIFVVLIAGSLXXXXXXXXXXXXVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDRLYSIASGSEFTKHYYLMP---IVAIVIF--LPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYI--------LKEPGDPELFIETKDQTRDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFYSSVVSTISHEKIKDFLENFAIARVLQTLXXXXXXXXCAVVIPNISNAISIIGAVS 1574
            + G ++  S VD+    S+         + W + + ++ N  LG G+L+FP+ F +AGGI  +LI  A+ ++ +  +L ++A C   Y C  YQ++V+  CG +F  +CS+++     G+ I  +V++ D  DRL++    + F   +Y+     I A+ +F  LPMCF +     K  S  GVL+A Y+ F V +  YI         +EPG             D   +IP++ +GY  HV +  ++S ++ +++  F KTV + +F++ + Y + GV+GYLTFG     D L  Y   N F  + I+ ++ K+ T++P+L F  R   N  Y  + + + H   +  L      R+L T + F   +I A ++P I   I IIG+++
Sbjct:   25 TTGSVRLPSFVDQESITSSAPARREHSDSSWYAAVFLIINAALGAGLLDFPQAFDQAGGIAASLILQAVVLIFVVVALLVLARCAETYKCSTYQEVVQHTCGMHFQRICSIAIALYCYGTCITFLVIIGDFSDRLFASLYDASFCLKWYMRRDFVITAVSVFTILPMCFSQKIDFLKIPSALGVLSAFYLVFLVVLQYYIGGYVPQEMQREPGS----------VADVFGVIPVICFGYQCHVSSVPIYSCMEDRRIKTFSKTVLTAIFLTALMYTIAGVYGYLTFGHAVVSDILEMYDASNIFVLIGIVAMAAKIVTTYPILAFCGRIAVNDLYVQIKTHVEHITERQELWR----RILVTSVWFTTSLIVACLVPGIGLVIHIIGSLA 400          
BLAST of slc38a-5 vs. Ensembl Cavefish
Match: slc38a7 (solute carrier family 38 member 7 [Source:NCBI gene;Acc:103025557])

HSP 1 Score: 149.058 bits (375), Expect = 2.093e-38
Identity = 118/435 (27.13%), Postives = 203/435 (46.67%), Query Frame = 3
Query:  468 FLQDGSL--VDENDEESNFTGGAGWPSGILIMANVCLGMGILNFPRIFYEAGGITVTLISLAIFVVLIAGSLXXXXXXXXXXXXVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDRLYSI-------ASGSEFTKHYYLMPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYILKE----PGDPELFIETKDQTRDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFYSSVVSTISHEKIKDFLENFAIARVLQTLXXXXXXXXCAVVIPNISNAISIIGAV-SCHXXXXXXXXXXXXXYQKATISNRKHFIRKIGGIFYILLGTFCFGVNFTVAI 1730
             LQ  S+  +    +     GG    + + I+ N  LG G+LNFP  F  AGG+T  ++     +V I   L I+AYC +      YQ++VR  CG+  G++C +++     G+ I  ++++ DQLD+L           S   FT   + + I ++++ LP+   ++    KY S   V+   Y+T  V ++ Y L +    PGD  +       T  FN + P + +G+  HV +  VF+ +KK ++  +   V   + I    Y  TGV G+L+FG     D L++YP D+    +A   +   + TS+P+L F  R+V  G +         E++   +      R++QTL+ F F ++ A+ IP+I   IS+IG + +C                +  + +       + G+  + +G F FG   T AI
Sbjct:   27 LLQSPSVDSIQAPSQSQQSRGGTSTLAAVFIVVNAALGAGLLNFPAAFNMAGGVTAGVVLQMCMLVFIITGLVILAYCSQVSNEGTYQEVVRAVCGKVLGVICEIAIAVYTFGTCIAFLIIIGDQLDKLIGAMTHDSDPVSAHWFTDRRFTITITSVLVILPLSIPKEIGFQKYASTISVIGTWYVTI-VVIIKYFLPDKNITPGD--IPTSPTSWTDVFNAM-PTICFGFQCHVSSVPVFNSMKKAEIRPWGGVVTVSMIICLFVYTGTGVSGFLSFGSNVSQDVLMSYPSDDVAVAIARAFIIICVVTSYPILHFCGRAVIEGLWLR----FKGEEVDTDVAGERRRRLIQTLVWFCFTLLLALFIPDIGRVISLIGGLAACFIFVFPGLCLIQAKLSEHDVRSASWMALVVYGVVMVTIGAFIFGQTTTNAI 453          
BLAST of slc38a-5 vs. Ensembl Cavefish
Match: slc38a8a (solute carrier family 38 member 8 [Source:NCBI gene;Acc:103032292])

HSP 1 Score: 139.813 bits (351), Expect = 2.250e-35
Identity = 118/415 (28.43%), Postives = 201/415 (48.43%), Query Frame = 3
Query:  543 GILIMANVCLGMGILNFPRIFYEAGGITVTLISLAIFVVLIAGSLXXXXXXXXXXXXVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDRL----YSIASG---SEFTKHYYL-----MPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYILKEPGDPELFIETKDQTRDFNLL---IPLLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFYSSVVSTISHEKIKDFLENFAIARVLQTLXXXXXXXXCAVVIPNISNAISIIGAVSCHXXXXXXXXXXXXXYQKATISNRKHFIRKIGGIFYILLGTFCFGVNFTVAIQSLL 1742
             ++IM    LG G+LNFP  F  AGG+   L    + +V +   L I+ Y         YQ +VR  CG   G +C +   F L    +  +V+++DQL +L    Y + +G    +   H+Y      + ++ + + LP+   ++    KY+SV G LAA+Y+T  V +V Y  +   +  LF         +  +   IP + +G+  H     ++S ++ +KL +++      +F   + Y++TG++GY+TFG+    D L++Y   +    +A L+    + T +P++  + RSV       +     H  + +F E     RV  T+      ++ AV +P+IS  IS+IG +S  F F FPGLC  F  Q   +S R  F+    G+  +L GTF FG +  +AI  +L
Sbjct:   29 ALVIMLKSALGAGLLNFPWAFARAGGVHAALTVELVSLVFLVSGLVILGYSSSISGQTTYQAVVRHLCGSAIGKLCEICFVFNLFMISVAFLVIVADQLHKLWVSLYEVITGMSEGDLPHHWYTDQRFTLFLLCVFLILPLSVPKEIEMQKYISVLGTLAAIYLTISV-IVKYYTRAIPETYLFPIYSSGISTWASMFSVIPTICFGFQCHEACIAIYSSMENKKLTHWVFISLMSMFFCLIIYSLTGIYGYMTFGKNVAPDVLMSYSGGDVLMIIARLLFGVSIITIYPIVVLLGRSVIQD--PLLKRRGKHFTVTNFFE--MCTRVSLTVTWIMTTLLIAVFVPDISKVISVIGGISAFFIFIFPGLCLIFAMQSQPVSARLRFVLIAWGVITLLCGTFIFGQSTALAIMHIL 438          
BLAST of slc38a-5 vs. Ensembl Cavefish
Match: slc38a8b (solute carrier family 38 member 8b [Source:ZFIN;Acc:ZDB-GENE-121005-6])

HSP 1 Score: 124.405 bits (311), Expect = 8.069e-30
Identity = 129/419 (30.79%), Postives = 209/419 (49.88%), Query Frame = 3
Query:  543 GILIMANVCLGMGILNFPRIFYEAGG----ITVTLISLAIFVVLIAGSLXXXXXXXXXXXXVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDR---LYSIASGS-EFTKHYY-----LMPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYILKEPGDPELFIETKDQTRDFNLL--IPLLVYGYHGHVEAPLVFSGIKKQKL-HNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFF---VVRSVFNGFYSSV-VSTISHEKIKDFLENFAIARVLQTLXXXXXXXXCAVVIPNISNAISIIGAVSCHXXXXXXXXXXXXXYQKATISNRKHFIRKIGGIFYILLGTFCFGVNFTVAIQSL 1739
             + IM    LG G+LNFP  F  AGG    ITV L+SL   V LI+G L I+ Y         Y D+VR  CGR  G +C +   F L    +  +VV+ DQL++   LY   SG  E   H+Y      + I+ ++I LP+   ++ +  KY +V G LAA Y++  V +V Y +K+        E ++     ++L  +P + +G+  H     ++S ++ +K+ H    +V S +F   + Y +T VFG+LTFG     D L++YP D+    +A L+    +FT +P++     VV ++   +   V V T+  E+           RV  T++     ++ AV +P++S+ IS+IG +S  F F FP    F + Q   + +R   +    G+  ++ G F FG + T+AI  L
Sbjct:   91 AVFIMLKSALGAGLLNFPWAFQRAGGINRAITVELVSL---VFLISG-LVILGYASSVSRQGTYHDVVREVCGRRIGQLCEICFVFNLFMISVAFLVVVQDQLEKCVSLYETVSGEKEMPYHWYTDQSFALFIMCLIIILPLSIPKEISIQKY-TVLGTLAATYLSVAV-IVKYYMKDEAAANPVPEHRELNSWGSVLSVVPTICFGFQCHEACIAIYSSMENKKISHWVFISVMSMIF-CLLIYTLT-VFGFLTFGPLVASDILMSYPGDDVVMIIARLLFGISIFTIYPIILLLGSVVLALVLRYRERVAVVTVVFER---------RCRVGLTVLWIGVTLLIAVYVPDMSDVISVIGGISAFFIFIFPLCLIFAI-QTEPMGHRMMLLTG-WGVVTVVTGAFIFGQSTTIAIMEL 490          
BLAST of slc38a-5 vs. Ensembl Cavefish
Match: slc38a8b (solute carrier family 38 member 8b [Source:ZFIN;Acc:ZDB-GENE-121005-6])

HSP 1 Score: 118.242 bits (295), Expect = 4.750e-28
Identity = 123/419 (29.36%), Postives = 199/419 (47.49%), Query Frame = 3
Query:  543 GILIMANVCLGMGILNFPRIFYEAGGI----TVTLISLAIFVVLIAGSLXXXXXXXXXXXXVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDRL----YSIASGS-EFTKHYYL-----MPIVAIVIFLPMCFIRDFTCFKYVSVGGVL--AALYITFGVSMVGYILKEPGDPELFIETKDQTRDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKL-HNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFYSSVVSTISHEKIKDFLENFAIARVLQTLXXXXXXXXCAVVIPNISNAISIIGAVSCHXXXXXXXXXXXXXY--QKATISNRKHFIRKIG-GIFYILLGTFCFGVNFTVAIQSL 1739
             + IM    LG G+LNFP  F  AGGI    TV L+SL   V LI+G L I+ Y         Y D+VR  CGR  G +C +   F L    +  +VV+ DQL++L    Y   SG  E   H+Y      + I+ ++I LP+   ++ +  KY     V+    ++I     +V  +       +LF    +       ++P + +G+  H     ++S ++ +K+ H    +V S +F   + Y +TGVFG+LTFG     D L++YP D+    +A L+    +FT +P++  + RSV      +  ST    +           RV  T++     ++ AV +P++S+ IS+IG +S  F F FPG      +   +   S R+  +   G G+  ++ G F FG + T+AI  L
Sbjct:   27 AVFIMLKSALGAGLLNFPWAFQRAGGINRAITVELVSL---VFLISG-LVILGYASSVSRQGTYHDVVREVCGRRIGQLCEICFVFNLFMISVAFLVVVQDQLEKLCVSLYETVSGEKEMPYHWYTDQSFALFIMCLIIILPLSIPKEISIQKYTRYTLVIYTETVFIAPQRPLVDLM-----SLKLFCCRLNSWGSVLSVVPTICFGFQCHEACIAIYSSMENKKISHWVFISVMSMIFCLLI-YTLTGVFGFLTFGPLVASDILMSYPGDDVVMIIARLLFGISIFTIYPIILLLGRSV------TYRSTSQSRR----------CRVGLTVLWIGVTLLIAVYVPDMSDVISVIGGISAFFIFIFPGEKNTHTHTLHQQPESERERVMLLTGWGVVTVVTGAFIFGQSTTIAIMEL 419          
BLAST of slc38a-5 vs. Ensembl Cavefish
Match: slc38a8a (solute carrier family 38 member 8 [Source:NCBI gene;Acc:103032292])

HSP 1 Score: 116.701 bits (291), Expect = 1.176e-27
Identity = 110/409 (26.89%), Postives = 188/409 (45.97%), Query Frame = 3
Query:  543 GILIMANVCLGMGILNFPRIFYEAGGITVTLISLAIFVVLIAGSLXXXXXXXXXXXXVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDRL----YSIASG---SEFTKHYYLMPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYILKEPGDPEL--FIETKDQTRDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFYSSVVSTISHEKIKDFLENFAIARVLQTLXXXXXXXXCAVVIPNISNAISIIGAVSCHXXXXXXXXXXXXXYQKATISNRKHFIRKIGGIFYILLGTFCFGVNFTVAIQSLL 1742
             ++IM    LG G+LNFP  F  AGG+   L    + +V +   L I+ Y         YQ +VR  CG   G +C +   F L    +  +V+++DQL +L    Y + +G    +   H+Y                + FT F        L  +++   +S+       P + E+  +I        F++ IP + +G+  H     ++S ++ +KL +++      +F   + Y++TG++GY+TFG+    D L++Y   +    +A L+    + T +P++  + RSV       +     H  + +F E     RV  T+      ++ AV +P+IS  IS+IG +S  F F FPGLC  F  Q   +S R  F+    G+  +L GTF FG +  +AI  +L
Sbjct:   29 ALVIMLKSALGAGLLNFPWAFARAGGVHAALTVELVSLVFLVSGLVILGYSSSISGQTTYQAVVRHLCGSAIGKLCEICFVFNLFMISVAFLVIVADQLHKLWVSLYEVITGMSEGDLPHHWYTD--------------QRFTLF--------LLCVFLILPLSV-------PKEIEMQKYIRISTWASMFSV-IPTICFGFQCHEACIAIYSSMENKKLTHWVFISLMSMFFCLIIYSLTGIYGYMTFGKNVAPDVLMSYSGGDVLMIIARLLFGVSIITIYPIVVLLGRSVIQD--PLLKRRGKHFTVTNFFE--MCTRVSLTVTWIMTTLLIAVFVPDISKVISVIGGISAFFIFIFPGLCLIFAMQSQPVSARLRFVLIAWGVITLLCGTFIFGQSTALAIMHIL 403          
BLAST of slc38a-5 vs. Ensembl Sea Lamprey
Match: slc38a11 (solute carrier family 38 member 11 [Source:NCBI gene;Acc:550337])

HSP 1 Score: 56.225 bits (134), Expect = 1.484e-8
Identity = 68/331 (20.54%), Postives = 131/331 (39.58%), Query Frame = 3
Query:  495 ENDEESNFTGGAGWPSGILIMANVCLGMGILNFPRIFYEAG--------GITVTLISLAIFVVLIAGSLXXXXXXXXXXXXVNYQDMVRVHCGRYFG-LVCSVSLFFELTGSLIVKMVVLSDQLDRLYSIASGSE------FTKHYYLMPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYILKEPGDPELFIETKDQTRDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNG--FYSSVVSTISH 1436
            E ++E +  G +  PS  L + N  +G GI+  P    +AG         +   +   +I +++ +GSL              YQ +V    G YFG +V S+  F     +++   V+  D L +++    G            Y+++ + ++   LP+   RD      VS+  V   L+I   V +  + L  P  P           +    + ++ + +  H    +++  +++  L N+ +  +  +  + +   +    GY TF   T  D   NY K++          +  +  +FP+  FV R VF    F S+  S + H
Sbjct:   26 EVEDEDSRAGTSDLPSASLNVLNSIIGAGIIGLPYALKQAGFPLGLLLLVVVAYVTDYSIILLIKSGSLSGT---------TTYQSLVHSAFG-YFGYIVLSLLQFTYPFIAMVSYNVITGDTLTKVFERIPGESVGEEHILANRYFIIFLTSVFCTLPLSLFRDVAQLGKVSLISVFFTLFILIVVVVRAFTLG-PQIPASMNAWTFAQPNVVQAVGIMAFAFICHHNTFIIYGSLEQPSLSNWSRVTHVSVLSALIISLILAACGYATFTGFTQGDIFENYCKNDDLVTAGRFCYALSILLTFPIECFVTREVFENVFFASAPWSRVRH 345          
BLAST of slc38a-5 vs. Ensembl Yeast
Match: AVT7 (Putative transporter; member of a family of seven S. cerevisiae genes (AVT1-7) related to vesicular GABA-glycine transporters [Source:SGD;Acc:S000001350])

HSP 1 Score: 60.077 bits (144), Expect = 6.473e-10
Identity = 44/182 (24.18%), Postives = 90/182 (49.45%), Query Frame = 3
Query:  879 KHYYLMPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYILKEPGDPELFIETKD-----QTRDFNLLIP---LLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFN 1400
            ++Y++  I + VI +P+C ++     KY S+ G+ A  YI+  + +  + + E G  EL    ++     +  DF  L+    ++++ + G +    + + +K   + N    + + + +ST  + + G+ GYLTFG  T  + +LNY  ++ +  +    +   L  SFP+LF  +R   N
Sbjct:  117 RNYWI--IASAVIIIPLCLVKKLDQLKYSSILGLFALAYIS--ILVFSHFVFELGKGELTNILRNDICWWKIHDFKGLLSTFSIIIFAFTGSMNLFPMINELKDNSMENITFVINNSISLSTALFLIVGLSGYLTFGNETLGNLMLNYDPNSIWIVIGKFCLGSMLILSFPLLFHPLRIAVN 294          
BLAST of slc38a-5 vs. Ensembl Yeast
Match: AVT6 (Vacuolar aspartate and glutamate exporter; member of a family of seven genes (AVT1-7) related to vesicular GABA-glycine transporters; involved in compartmentalizing acidic amino acids in response to nitrogen starvation; AVT6 has a paralog, AVT5, that arose from the whole genome duplication [Source:SGD;Acc:S000000921])

HSP 1 Score: 48.9062 bits (115), Expect = 1.770e-6
Identity = 62/273 (22.71%), Postives = 122/273 (44.69%), Query Frame = 3
Query:  540 SGILIMANVCLGMGILNFPRIFYEAGGIT-VTLISLAIFVVLIAGSLXXXXXXXXXXXXVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDRLYSIASGSEFTKHYYLM----PIVAIVIFL--PMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYILKEPGDPELFIETK------DQTRDFNLL--IPLLVYGYHGHVEAPLVFSGIKKQKLHNF---MKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPK 1304
            SG+L + +   G GIL  P  F   G I  V +I L     + +  +             ++  + R+      G+V  +++  +  G  +  M+V+ D + ++ S+     +T++ +L+     I  I++F   P+ F++     +Y S+  + +  Y+   V ++ Y+   P D  L ++ +       Q+ D N+L  +P+ V+ Y  H     +FS I +Q+   F   MK     + ++ + Y   G  GYLTFG     + ++ YP+
Sbjct:    7 SGVLTLLHTACGAGILAMPYAFKPFGLIPGVIMIVLCGACAMQSLFIQARVAKYVPQGRASFSALTRL-INPNLGIVFDLAIAIKCFGVGVSYMIVVGDLMPQIMSV-----WTRNAWLLNRNVQISLIMLFFVAPLSFLKKLNSLRYASMVAISSVAYLCVLV-LLHYV--APSDEILRLKGRISYLLPPQSHDLNVLNTLPIFVFAYTCHHN---MFSIINEQRSSRFEHVMKIPLIAISLALILYIAIGCAGYLTFGDNIIGNIIMLYPQ 267          
BLAST of slc38a-5 vs. Ensembl Nematostella
Match: EDO32530 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUS1])

HSP 1 Score: 134.806 bits (338), Expect = 2.883e-34
Identity = 120/411 (29.20%), Postives = 198/411 (48.18%), Query Frame = 3
Query:  543 GILIMANVCLGMGILNFPRIFYEAGGITVTLISLAIFVVLIAGSLXXXXXXXXXXXXVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDR----LYSIASGSEFTKHYYLMPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYILKE--PGDPELFIETKDQTRDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFYSSVVSTISHEKIKDFLENFAIARVLQTLXXXXXXXXCAVVIPNISNAISIIGAVSCHXXXXXXXXXXXXXYQKATISNRKHFIRKI--GGIFYILLGTFCFGVNFTVAIQSLLKSR 1751
             + ++ N  +G GILNFP+ F +AGGIT  +    + +V I GS  I+AYC       NYQ++VR   G    L+  V +   + GS I  +++++DQL++       +     +    +L+  V IV  LP+C  +      Y S  G L  LY+ F V+   Y      P   +  +E K  T  F  +IP++ +G+  HV A  V++ +K+  +  F       + +    Y+VT  FG+LTFG     D L+NY  ++   N+A + ++  + ++F  + F  RS   G + +      +E   +  +     RV+QT++   F +  AV + +IS  ISIIG ++  F   FPG+C     +        HF   +    IFYI++G F FG +  +AI   LK +
Sbjct:    4 AVFVVMNAAMGAGILNFPQAFGKAGGITAAMSIELVMLVFITGSFVIMAYCANMCGSRNYQEIVRDMLGTKAYLISEVFVLLYMLGSSIAYLILIADQLEQGIIGKALVPGDPWYVSRTFLLCTVTIVFILPLCIPKTMGILSYTSTAGSLGVLYVCF-VAAYKYFSGSYNPSKIQPHVE-KPWTELFG-VIPIICFGFMCHVPALSVYTELKRPTVPRFGIVCTIAMVLCCTAYSVTACFGFLTFGAKCKSDILMNYSSNDVMVNIARVAIALVVISTFASVHFSGRSAVEGLWLTAWRMTLYEAEINARKR----RVVQTVLWVGFTLFIAVAVSDISYVISIIGGLAALFILFFPGMCPCLFKEIMRHRYLTHFQWALLFTSIFYIVMGVFLFGESEVLAITEDLKPK 407          
BLAST of slc38a-5 vs. Ensembl Nematostella
Match: EDO28861 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5A1])

HSP 1 Score: 65.855 bits (159), Expect = 3.139e-12
Identity = 60/210 (28.57%), Postives = 101/210 (48.10%), Query Frame = 3
Query: 1128 HVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFYSSVVSTISHEKIKDFLENFAIARVLQTLXXXXXXXXCAVVIPNISNAISIIGAVSCHXXXXXXXXXXXXXYQKATISNRKHFIRKI--GGIFYILLGTFCFGVNFTVAIQSLLKSR 1751
            HV A  V++ +K+  +  F       + +    Y+VT  FG+LTFG     D L+NY  ++   N+A + ++  + ++F  + F  RS   G + +      +E   +  +     RV+QT++   F +  AV + +IS  ISIIG ++  F   FPG+C     +        HF   +    IFYI++G F FG +  +AI   LK +
Sbjct:    2 HVPALSVYTELKRPTVPRFGIVCTIAMVLCCTAYSVTACFGFLTFGAKCKSDILMNYSSNDVMVNIARVAIALVVISTFASVHFSGRSAVEGLWLTAWRMTLYEAEINARKR----RVVQTVLWVGFTLFIAVAVSDISYVISIIGGLAALFILFFPGMCPCLFKEIMRHRYLTHFQWALLFTSIFYIVMGVFLFGESEVLAITEDLKPK 207          
BLAST of slc38a-5 vs. Ensembl Nematostella
Match: EDO42878 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S001])

HSP 1 Score: 55.8398 bits (133), Expect = 3.694e-8
Identity = 63/271 (23.25%), Postives = 117/271 (43.17%), Query Frame = 3
Query:  540 SGILIMANVCLGMGILNFPRIFYEAGGITVTLISLAIFVVLIA---GSLXXXXXXXXXXXXVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDRLYSIASG--SEFTKHYYLMPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGV------SMVGYILKEPGDPELFIETKDQTRDFN-LLIPLLVYG--YHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDN 1310
            S I  + +  +G G+L+ P  F + G +  +L+   IFV++ +   G L I +         N +D+ R+  G    ++  + L   L    +   ++++DQL  L+ +  G  S + K   ++ I  +VIF P   ++  +  K+ S   V   +++  G+      S +G  +  P +P      K   +D    L  + + G  +  H     + S ++ Q   N    +YS + I+     V   FG++ F +  D D   NYP DN
Sbjct:   64 SSIFTLVSTMIGGGVLSLPFAFQQGGFVMSSLV--LIFVLMASTHGGFLIINSKKYCQGRIKNVEDVGRIAFGYKGEVLTQLVLIVTLFLCSVAYWILITDQLQPLFFLMCGPNSFWAKKIVVLTIPVLVIF-PFTLLKSMSALKFTSFLSVFCVMFLAGGIVHQSVESHIGGRITRPDNP-----VKWWPKDLGGFLTSVSITGLTFACHFNILPMHSELRYQTRQNKRIILYSAMAITYCLNVVVSFFGFMQFRKYVDQDITKNYPHDN 326          
BLAST of slc38a-5 vs. Ensembl Nematostella
Match: EDO43803 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXM9])

HSP 1 Score: 53.1434 bits (126), Expect = 2.237e-7
Identity = 79/328 (24.09%), Postives = 127/328 (38.72%), Query Frame = 3
Query:  468 FLQDGSLVDENDEESNFTGG-AGWPSGILIMANVCLGMGILNFPRIFYEAGGITVTLISLAIFVVLIAGSLX-------XXXXXXXXXXXVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDRLYSIASGSEFTKHYY-----LMPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYILKEPGDPELFIETKDQTRDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKLH--NFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGF 1406
            F  + SL+++   +   +   AGW      + N+  GMGIL  P    E G      I +   V  + G L              +     NY ++         G V SV    EL  + ++ +++L+            S+ T+ Y      +  ++  V  LP  FI   +   ++S+  VLA L  +  V++   IL         I T D    F +   ++ + Y  H     VF GI+    H  N+ K +++   +S     + G F  LTFG  TD    +N      F   A   V+  +F SFP+  FVV   F+G 
Sbjct:   86 FSMNRSLIEKESPDRRASALLAGWN-----VTNLIQGMGILGIPYAVREGGIAAAVCIFVVAIVCDVTGILLVDCLYEISPRSQKKKRIRSNYPEVGEAVWPGIGGKVVSVVQTIELYTAAMLYLILLTTMF---------SQITEKYISLSMNVWAVLCAVAVLPSVFITRLSLIAWMSMIAVLA-LMSSIAVTLAYCILNYDRWSINNIPTFDG-NTFPIGFGIVTFSYCAHA----VFPGIEASMKHPENYNKMMHTSFLVSATVKTLFGAFAVLTFGLVTDQVVTVNLADSLAFNTAATAFVALNVFFSFPLPLFVVIETFDGL 393          
BLAST of slc38a-5 vs. Ensembl Medaka
Match: slc38a7 (solute carrier family 38 member 7 [Source:NCBI gene;Acc:101168107])

HSP 1 Score: 151.754 bits (382), Expect = 2.095e-39
Identity = 128/434 (29.49%), Postives = 207/434 (47.70%), Query Frame = 3
Query:  453 ASSGGFLQDGSLVD--ENDEESNFTGGAGWPSGILIMANVCLGMGILNFPRIFYEAGGITVTLISLAIFVVLIAGSLXXXXXXXXXXXXVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDRLYSI--------ASGSEFTKHYYLMPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYILKEPGDPELFIETKDQ--TRDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFYSSVVSTISHEKIKDFLENFAIARVLQTLXXXXXXXXCAVVIPNISNAISIIGAVSCHXXXXXXXXXXXXXYQKATISNRKHFIRKIG-GIFYILLGTFCFGVN 1715
            A    +L     VD  ++ E +  + G      + I+ N  LG G+LNFP  F  AGG+T  ++     ++ I   L I+ YC        YQ++VR  CG+  G++C V++     G+ I   +V+ DQLDRL +          S   +T   +   I AI++ LP+   ++    KY S   V+   Y+T  V ++ YI  +      +I T     T  FN + P + +G+  HV    VF+ ++K+++  +   V   + I    Y  TGV GYLTFG + + D L++YP D+     A   +   + TS+P+L F  R+V  G +         E+++  +      R+LQTL+ F   ++ A+ IP+I   IS+IG ++  F F FPGLC        T S    +   +G G+  + LG F FG+ 
Sbjct:   18 AGERAWLLQSPSVDSVQHPEMAERSRGVSTLGAVFIVVNAALGAGLLNFPAAFNMAGGVTAGVVLQMFMLIFIISGLVILGYCSLVSNEATYQEVVRATCGKVTGVLCEVAIAIYTFGTCIAFFIVIGDQLDRLIAAVEDKIDGKVSNHWYTDRKFTTVITAILVILPLSIPKEIGFQKYASTLSVIGTWYVTI-VVILRYIWPDKKVTPAYIPTSSASWTAVFNAM-PTICFGFQCHVSCVPVFNSMRKKEIKPWGFVVTLSMIICLFVYTGTGVCGYLTFGSSVNQDVLMSYPSDDIAVAFARAFIVICVITSYPILHFCGRAVVEGLWLR----FQGEQVEVCVRREQRRRILQTLVWFVVTLVLALFIPDIGRVISLIGGLAACFIFVFPGLCLMQAKMSETESRSLSWHALVGFGVAMVTLGAFIFGLT 445          
BLAST of slc38a-5 vs. Ensembl Medaka
Match: slc38a8a (solute carrier family 38 member 8 [Source:NCBI gene;Acc:101174744])

HSP 1 Score: 134.035 bits (336), Expect = 2.777e-33
Identity = 131/444 (29.50%), Postives = 209/444 (47.07%), Query Frame = 3
Query:  483 SLVDENDEESNFTGGA--GWPSGILIMANVCLGMGILNFPRIFYEAGGI----TVTLISLAIFVVLIAGSLXXXXXXXXXXXXVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDRL----YSIASG---SE-----FTKHYYLMPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYILKEPGDPELFIET------KDQTRDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFYSSVVSTISHEKIKDFLENFAIARVLQTLXXXXXXXXCAVVIPNISNAISIIGAVSCHXXXXXXXXXXXXXYQKATISNRKHFIRKIGGIFYILLGTFCFGVNFTVAIQSLL 1742
            SL+  +  +     G   G    + +M    LG G+LNFP  F  AGG+    TV LISL    V +  SL I+ Y         YQ +V+  CG   G +C +   F L    +  +V+++DQL++L    Y + +G   SE     +T H + + ++ I I LP+   ++ +  KY S+ G LAA Y+T     V  I+K    P + +        K        +IP + +G+  H  +  ++S ++ Q+L +++      + I  + Y++TGV+GYLTFGR    D L++Y   +    VA L+    + T +P+L  + RSV      S             LE    +R L T++     ++ AV +P+IS  I +IG +S  F F FPGLC  F  Q   +S R   +    G   ++ G F FG + +VA+  LL
Sbjct:   10 SLLTSSTAKPPLDAGPRLGSTGAVFVMLKSALGAGLLNFPWAFERAGGVRSAVTVELISL----VFLTSSLIILGYSSSISGRCTYQAVVKEVCGPAIGQLCEICFIFNLFMISVAFLVIMNDQLEKLCGSLYEVVTGLPKSEMLYHFYTDHRFALLLLCIFIILPLSIPKEISLQKYTSILGTLAATYLT-----VAIIIKYHTLPTVRVHIPIHSTGKSSWTSMFSVIPTICFGFQCHEASIAIYSSMEDQQLSHWVAVSVVAMVICLIIYSLTGVYGYLTFGREVKADILMSYASSDVMMLVARLLFGVSIITIYPILVLLGRSVIQDSLRSWQRRQREGVASAKLERR--SRYLLTVLWIIITLLIAVFVPDISKVIGVIGGISAFFIFIFPGLCLMFCMQTEPVSCRTRVVLTAWGGVTLICGAFIFGQSTSVAVMELL 442          
BLAST of slc38a-5 vs. Ensembl Medaka
Match: slc38a8b (putative sodium-coupled neutral amino acid transporter 8 [Source:NCBI gene;Acc:101167354])

HSP 1 Score: 131.339 bits (329), Expect = 1.142e-32
Identity = 106/361 (29.36%), Postives = 176/361 (48.75%), Query Frame = 3
Query:  543 GILIMANVCLGMGILNFPRIFYEAGGITVTL-ISLAIFVVLIAGSLXXXXXXXXXXXXVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDR----LYSIASG---SEFTKHYYL-----MPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYILKEPG---DPELFIETKDQTRDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKL-HNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFYSSVVSTISHEKIKDFLENFAIARVLQTLXXXXXXXXCAVVIPNISNAISIIGAVS 1574
             + IM    LG G+LNFP  F +AGG+T  + + L   V LI+G L I+ Y         YQD+VR  CGR  G +C V   F L    +  +VV+ DQL++    LY   +G   SE   H+Y      + I+ ++I LP+   ++    KY SV G LAA Y+   V +  Y++        PE           F+ ++P + +G+  H     ++S ++ QKL H  + +V S LF   + Y +TGV+GY+TFG+    D L++Y  ++    ++ L+    + T +P++  + RSV          +        F       RV+ T+      ++ A+ +P++++ IS+IG +S
Sbjct:   29 AVFIMLKSALGAGLLNFPWAFEKAGGVTTAISVELVSLVFLISG-LVILGYASSVSRQKTYQDVVREVCGRAVGQLCEVCFCFNLFMISVAFLVVVQDQLEKLCVSLYETVTGLSESEVPHHWYTDQRFALFIMCLLIILPLSIPKEIGIQKYTSVLGTLAATYLCVAVIVKYYLMDTHAAIITPEHIQGVSSWASMFS-VVPTICFGFQCHEACIAIYSSMENQKLCHWVVISVLSMLFCLLI-YTLTGVYGYMTFGQAVASDILMSYQGNDVVMIISRLLFGISIVTIYPIILLLGRSVILNLMLRAQRSRRGLVTHSFESR---CRVVLTVAWITSTLLIAMFVPDMADVISVIGGIS 383          
BLAST of slc38a-5 vs. Ensembl Medaka
Match: slc38a8b (putative sodium-coupled neutral amino acid transporter 8 [Source:NCBI gene;Acc:101167354])

HSP 1 Score: 129.028 bits (323), Expect = 1.015e-31
Identity = 123/418 (29.43%), Postives = 204/418 (48.80%), Query Frame = 3
Query:  543 GILIMANVCLGMGILNFPRIFYEAGGITVTL-ISLAIFVVLIAGSLXXXXXXXXXXXXVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDR----LYSIASG---SEFTKHYYL-----MPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYILKEPG---DPELFIETKDQTRDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKL-HNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFYSSVVSTISHEKIKDFLENFAIARVLQTLXXXXXXXXCAVVIPNISNAISIIGAVSCHXXXXXXXXXXXXXYQKATISNRKHFIRKIGGIFYILLGTFCFGVNFTVAIQSLLK 1745
             + IM    LG G+LNFP  F +AGG+T  + + L   V LI+G L I+ Y         YQD+VR  CGR  G +C V   F L    +  +VV+ DQL++    LY   +G   SE   H+Y      + I+ ++I LP+   ++    KY SV G LAA Y+   V +  Y++        PE     +        ++P + +G+  H     ++S ++ QKL H  + +V S LF   + Y +TGV+GY+TFG+    D L++Y  ++    ++ L+    + T +P++  + R V        + T S E         +  RV+ T+      ++ A+ +P++++ IS+IG +S  F F FPGLC  F  +  T          + G+  I++G F FG + T+A+  ++ 
Sbjct:   29 AVFIMLKSALGAGLLNFPWAFEKAGGVTTAISVELVSLVFLISG-LVILGYASSVSRQKTYQDVVREVCGRAVGQLCEVCFCFNLFMISVAFLVVVQDQLEKLCVSLYETVTGLSESEVPHHWYTDQRFALFIMCLLIILPLSIPKEIGIQKYTSVLGTLAATYLCVAVIVKYYLMDTHAAIITPE---HIQGSWASMFSVVPTICFGFQCHEACIAIYSSMENQKLCHWVVISVLSMLFCLLI-YTLTGVYGYMTFGQAVASDILMSYQGNDVVMIISRLLFGISIVTIYPIILLLGRYVCFICLRRGLVTHSFE---------SRCRVVLTVAWITSTLLIAMFVPDMADVISVIGGISAFFIFIFPGLCLIFTMRSLT----------VWGVMTIVVGVFIFGQSTTIAVMEIIH 422          
BLAST of slc38a-5 vs. Planmine SMEST
Match: SMESG000030873.1 (SMESG000030873.1)

HSP 1 Score: 837.025 bits (2161), Expect = 0.000e+0
Identity = 468/470 (99.57%), Postives = 468/470 (99.57%), Query Frame = 3
Query:  351 VIEDNPNNAQLTTFESTDSDIFYXXXXXXXXXXXASSGGFLQDGSLVDENDEESNFTGGAGWPSGILIMANVCLGMGILNFPRIFYEAGGITVTLISLAIFVVLIAGSLXXXXXXXXXXXXVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDRLYSIASGSEFTKHYYLMPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYILKEPGDPELFIETKDQTRDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFYSSVVSTISHEKIKDFLENFAIARVLQTLXXXXXXXXCAVVIPNISNAISIIGAVSCHXXXXXXXXXXXXXYQKATISNRKHFIRKIGGIFYILLGTFCFGVNFTVAIQSLLKSRPSI 1760
            VIEDNPNNAQLTTFESTDSDIFYNNNNNKRKRSSASSGGFLQDGSLVDENDEESN TGGAGWPSGILIMANVCLGMGILNFPRIFYEAGGITVTLISLAIFVVLIAGSLYIIAYCCRYYACVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDRLYSIASGSEFTKHYYLMPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYILKEPGDPELFIETKDQTRDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFYSSVVSTIS EKIKDFLENFAIARVLQTLIIFFFIIICAVVIPNISNAISIIGAVSCHFCFTFPGLCFFFLYQKATISNRKHFIRKIGGIFYILLGTFCFGVNFTVAIQSLLKSRPSI
Sbjct:   15 VIEDNPNNAQLTTFESTDSDIFYNNNNNKRKRSSASSGGFLQDGSLVDENDEESNLTGGAGWPSGILIMANVCLGMGILNFPRIFYEAGGITVTLISLAIFVVLIAGSLYIIAYCCRYYACVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDRLYSIASGSEFTKHYYLMPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYILKEPGDPELFIETKDQTRDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFYSSVVSTISQEKIKDFLENFAIARVLQTLIIFFFIIICAVVIPNISNAISIIGAVSCHFCFTFPGLCFFFLYQKATISNRKHFIRKIGGIFYILLGTFCFGVNFTVAIQSLLKSRPSI 484          
BLAST of slc38a-5 vs. Planmine SMEST
Match: SMESG000030873.1 (SMESG000030873.1)

HSP 1 Score: 751.895 bits (1940), Expect = 0.000e+0
Identity = 412/419 (98.33%), Postives = 415/419 (99.05%), Query Frame = 3
Query:  504 EESNFTGGAGWPSGILIMANVCLGMGILNFPRIFYEAGGITVTLISLAIFVVLIAGSLXXXXXXXXXXXXVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDRLYSIASGSEFTKHYYLMPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYILKEPGDPELFIETKDQTRDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFYSSVVSTISHEKIKDFLENFAIARVLQTLXXXXXXXXCAVVIPNISNAISIIGAVSCHXXXXXXXXXXXXXYQKATISNRKHFIRKIGGIFYILLGTFCFGVNFTVAIQSLLKSRPSI 1760
            +E ++  GAGWPSGILIMANVCLGMGILNFPRIFYEAGGITVTLISLAIFVVLIAGSLYIIAYCCRYYACVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDRLYSIASGSEFTKHYYLMPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYILKEPGDPELFIETKDQTRDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFYSSVVSTIS EKIKDFLENFAIARVLQTLIIFFFIIICAVVIPNISNAISIIGAVSCHFCFTFPGLCFFFLYQKATISNRKHFIRKIGGIFYILLGTFCFGVNFTVAIQSLLKSRPSI
Sbjct:   48 KEYDYQRGAGWPSGILIMANVCLGMGILNFPRIFYEAGGITVTLISLAIFVVLIAGSLYIIAYCCRYYACVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDRLYSIASGSEFTKHYYLMPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYILKEPGDPELFIETKDQTRDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFYSSVVSTISQEKIKDFLENFAIARVLQTLIIFFFIIICAVVIPNISNAISIIGAVSCHFCFTFPGLCFFFLYQKATISNRKHFIRKIGGIFYILLGTFCFGVNFTVAIQSLLKSRPSI 466          
BLAST of slc38a-5 vs. Planmine SMEST
Match: SMESG000023359.1 (SMESG000023359.1)

HSP 1 Score: 191.045 bits (484), Expect = 2.812e-53
Identity = 140/443 (31.60%), Postives = 234/443 (52.82%), Query Frame = 3
Query:  456 SSGGFLQDGSLVDENDEES-----NFT-----GGAGWPSGILIMANVCLGMGILNFPRIFYEAGGITVTLISLAIFVVLIAGSLXXXXXXXXXXXXVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDRLYSIASGSEFTKHYYL-----MPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYILKEPGDPELFIETKDQT-RDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVFNGFYSSVVSTISHEKIKDFLENFAIARVLQTLXXXXXXXXCAVVIPNISNAISIIGAVSCHXXXXXXXXXXXXXYQKATISNRKHFIRKIGGIFYILLGTFCFGVNFTVAIQS 1736
            S+    +  S+++ N+E S     NF+      G  W S +LIMAN  +GMG+LNFP     AGG  V + +  + +  I  SL ++ Y  +YY  V++Q ++  H G+    +C + +F    G+LIV ++V+ DQ + +       E   H+ L     +PI++IV   P+C +++F  FKY S  GV+AALYI+FG+    Y   +      F+E K+    +   +IPL+ + Y  H+E P + + +KKQ +  + K ++ Y+ +S++ Y+  GVFGYLTFG  T  D L  Y   + +  VA+++++ K+ T++P++F+ +R V   +    +S        D L  +++  VL     F   ++ A+ + NIS  I++IG +S  F F FPG+CF  LY  +    +   I  I G  YI LG F   V+   +I+ 
Sbjct:   60 STEPIFRRSSVIEINNESSETSVINFSELYSYTGTSWFSAVLIMANCTIGMGLLNFPFAIMNAGGNLVGMFTQMVIIAFIVVSLNMMCYLSQYYGDVSFQGVIGSHLGKVSKEICRILIFLNNFGALIVSLIVIGDQFEHISRAIWAHEEALHWLLDRRVMVPIISIVFIFPLCLLKNFDIFKYTSFLGVIAALYISFGLIFKSYFTLKGSK---FVEVKESNLSNLVKIIPLICFTYECHIEIPPMIACLKKQNICYYEKMIFGYVILSSIVYSFAGVFGYLTFGAATPDDILTAYDPKDPYVIVAMVLITLKIVTTYPIVFYCLRIVVEDYVKVFISKFQQRSRCDSLIKYSLTIVL-----FSSTVLIAIFVQNISTVINLIGGISAVFIFIFPGMCFLKLYSSSPRKWKWSLI--ILGSLYIALGVFISAVSTAHSIEE 492          
BLAST of slc38a-5 vs. Planmine SMEST
Match: SMESG000029171.1 (SMESG000029171.1)

HSP 1 Score: 51.2174 bits (121), Expect = 1.992e-6
Identity = 71/303 (23.43%), Postives = 124/303 (40.92%), Query Frame = 3
Query:  561 NVCLGMGILNFPRIFYEAGGITVTLISLAIFVVLIAGSLXXXXXXXXXXXXVNYQDMVRVHCGRYFGLVCSVSLFFELTGSLIVKMVVLSDQLDRLYS----IASGSEFTKHYYLMPIVAIVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYILKEPGDPELFIETKDQTRDFNLLIP----LLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYLFISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFTSFPVLFFVVRSVF-NGFY--SSVVSTISH 1436
            N  +G GI+  P       GI + LI L    ++   SL ++          NYQD+VR   GR   L+ +V        ++I   V++ D + RL      ++  S FT    ++ I  +    P+   R       +SV      + I   +++        G   + I +++     N  IP    ++ + +     + L +  +KK+    +   V+  +  S +   + G+ GY TF   T  D L NY   +   NV+ L+ +  +  ++PV  FV R V  N F+  S  VS + H
Sbjct:   67 NSIIGSGIIGMPYAL-RGAGIGMGLILLVTVSIVTDYSLNLLILGGFMSNTNNYQDLVRNVYGRVGFLILTVMQGTYPFIAMISYNVIIGDTVTRLAKRIGDLSDDSIFTDRKLIVFICTLFFTFPLSLYRQIASLTKISVASTTIIILIIGTMAI-------RGPSYIIIYSRNDWNFINYRIPQAIAIMAFAFMCQHNSFLCYQSLKKKSTDRWGVVVHIAVSFSFMASGLFGIIGYSTFTGYTQGDVLENYCFKDDLINVSRLLFAITIIFTYPVECFVAREVIENSFFYKSKPVSKMLH 361          
The following BLAST results are available for this feature:
BLAST of slc38a-5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC38A75.182e-3729.21solute carrier family 38 member 7 [Source:HGNC Sym... [more]
SLC38A75.182e-3729.21solute carrier family 38 member 7 [Source:HGNC Sym... [more]
SLC38A81.267e-3327.67solute carrier family 38 member 8 [Source:HGNC Sym... [more]
SLC38A71.541e-2827.27solute carrier family 38 member 7 [Source:HGNC Sym... [more]
SLC38A76.810e-1927.08solute carrier family 38 member 7 [Source:HGNC Sym... [more]
back to top
BLAST of slc38a-5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc38a-5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG133843.125e-624.59gene:FBgn0032036 transcript:FBtr0303469[more]
CG133843.125e-624.59gene:FBgn0032036 transcript:FBtr0079657[more]
CG133843.331e-624.59gene:FBgn0032036 transcript:FBtr0079653[more]
CG133843.331e-624.59gene:FBgn0032036 transcript:FBtr0303470[more]
CG133843.331e-624.59gene:FBgn0032036 transcript:FBtr0303471[more]
back to top
BLAST of slc38a-5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc38a71.068e-3726.79solute carrier family 38 member 7 [Source:NCBI gen... [more]
slc38a71.068e-3726.79solute carrier family 38 member 7 [Source:NCBI gen... [more]
slc38a71.068e-3726.79solute carrier family 38 member 7 [Source:NCBI gen... [more]
slc38a8b1.746e-3628.84solute carrier family 38 member 8b [Source:ZFIN;Ac... [more]
slc38a8b4.951e-3227.27solute carrier family 38 member 8b [Source:ZFIN;Ac... [more]
back to top
BLAST of slc38a-5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnh62.897e-3127.78potassium channel, voltage gated eag related subfa... [more]
slc38a89.838e-3025.88solute carrier family 38 member 8 [Source:NCBI gen... [more]
slc38a85.042e-2926.54solute carrier family 38 member 8 [Source:NCBI gen... [more]
kcnh69.168e-2829.00potassium channel, voltage gated eag related subfa... [more]
SLC36A45.977e-725.23solute carrier family 36 (proton/amino acid sympor... [more]
back to top
BLAST of slc38a-5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc38a87.074e-3729.54solute carrier family 38, member 8 [Source:MGI Sym... [more]
Slc38a74.347e-3628.76solute carrier family 38, member 7 [Source:MGI Sym... [more]
Slc38a71.424e-3528.76solute carrier family 38, member 7 [Source:MGI Sym... [more]
Slc38a71.424e-3528.76solute carrier family 38, member 7 [Source:MGI Sym... [more]
Slc38a81.963e-1529.78solute carrier family 38, member 8 [Source:MGI Sym... [more]
back to top
BLAST of slc38a-5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6DEL1|S38A7_DANRE5.642e-3727.01Putative sodium-coupled neutral amino acid transpo... [more]
sp|Q5R9F5|S38A7_PONAB1.036e-3629.36Putative sodium-coupled neutral amino acid transpo... [more]
sp|Q9NVC3|S38A7_HUMAN2.488e-3629.21Putative sodium-coupled neutral amino acid transpo... [more]
sp|Q5HZH7|S38A8_MOUSE4.948e-3629.54Putative sodium-coupled neutral amino acid transpo... [more]
sp|Q6JWR2|S38A7_RAT1.211e-3528.76Putative sodium-coupled neutral amino acid transpo... [more]
back to top
BLAST of slc38a-5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJJ80.000e+0100.00Slc38a-5 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YFA83.095e-4931.38Slc38a-1 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
T1INZ54.338e-4330.27Aa_trans domain-containing protein OS=Strigamia ma... [more]
K1R8B61.541e-4129.75Putative sodium-coupled neutral amino acid transpo... [more]
A0A2R5L9I71.136e-3929.49Putative amino acid transporter protein (Fragment)... [more]
back to top
BLAST of slc38a-5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc38a72.093e-3827.13solute carrier family 38 member 7 [Source:NCBI gen... [more]
slc38a8a2.250e-3528.43solute carrier family 38 member 8 [Source:NCBI gen... [more]
slc38a8b8.069e-3030.79solute carrier family 38 member 8b [Source:ZFIN;Ac... [more]
slc38a8b4.750e-2829.36solute carrier family 38 member 8b [Source:ZFIN;Ac... [more]
slc38a8a1.176e-2726.89solute carrier family 38 member 8 [Source:NCBI gen... [more]
back to top
BLAST of slc38a-5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
slc38a111.484e-820.54solute carrier family 38 member 11 [Source:NCBI ge... [more]
back to top
BLAST of slc38a-5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
AVT76.473e-1024.18Putative transporter; member of a family of seven ... [more]
AVT61.770e-622.71Vacuolar aspartate and glutamate exporter; member ... [more]
back to top
BLAST of slc38a-5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO325302.883e-3429.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO288613.139e-1228.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428783.694e-823.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438032.237e-724.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc38a-5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
slc38a72.095e-3929.49solute carrier family 38 member 7 [Source:NCBI gen... [more]
slc38a8a2.777e-3329.50solute carrier family 38 member 8 [Source:NCBI gen... [more]
slc38a8b1.142e-3229.36putative sodium-coupled neutral amino acid transpo... [more]
slc38a8b1.015e-3129.43putative sodium-coupled neutral amino acid transpo... [more]
back to top
BLAST of slc38a-5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000030873.10.000e+099.57SMESG000030873.1[more]
SMESG000030873.10.000e+098.33SMESG000030873.1[more]
SMESG000023359.12.812e-5331.60SMESG000023359.1[more]
SMESG000029171.11.992e-623.43SMESG000029171.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30029096
GenBankAKN21664.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029096 ID=SMED30029096|Name=slc38a-5|organism=Schmidtea mediterranea sexual|type=transcript|length=1981bp
GCACATAGTTTGCGTACCTTTGATGTTAGTAATTGTCAATAACAAAATCA
AATCTATTTTATGAACTTCCAGTAATTATAACGCCCATTTGTGGAATTTC
ACATTGTTTTGTCAGATCAATTTTTCAAATCCTCCAAGATATTAAACGCC
ATTCCACAATAAGCGGCATACAGATCCAAGCTATATTCCAATAATAGAAT
GATATAAGGTGAGTTTCAGATAACGGCTAAATAATCCGAATTTTTCGAGG
TTAAAGGCTGCACTTTGACACGATCTATCGATTTTTTTCACTTGTTTATC
TGGTAATCATGGCGAATAAAAACAATGAAAACTTATCAAGCTCCGGCAAT
GTTATTGAGGACAATCCAAACAATGCACAATTGACAACATTTGAAAGCAC
CGATAGCGACATTTTCTACAACAATAATAATAATAAACGAAAGAGGTCCA
GCGCTTCAAGTGGAGGATTTCTTCAAGATGGGTCTTTGGTAGATGAAAAT
GATGAAGAATCCAATTTTACAGGAGGAGCCGGCTGGCCCAGTGGAATTTT
AATCATGGCCAATGTTTGTCTTGGGATGGGGATTTTGAATTTCCCGAGGA
TCTTTTATGAAGCCGGAGGAATCACGGTGACGTTAATATCGTTGGCAATT
TTTGTAGTGCTTATCGCCGGGTCGCTTTATATCATTGCGTATTGCTGTAG
GTACTATGCTTGCGTCAACTATCAGGACATGGTCAGAGTGCATTGCGGCC
GATATTTCGGATTGGTTTGTTCAGTGTCACTATTTTTTGAGTTGACAGGG
TCACTGATTGTAAAAATGGTCGTCCTGTCGGATCAATTGGATAGATTGTA
CTCAATAGCATCAGGAAGCGAATTTACGAAGCATTATTATCTTATGCCTA
TTGTTGCAATTGTAATATTTCTCCCAATGTGTTTTATTAGAGATTTTACA
TGTTTCAAATATGTGAGTGTCGGAGGAGTTTTAGCTGCTCTCTATATAAC
ATTCGGTGTATCTATGGTAGGGTACATTTTAAAGGAACCTGGAGACCCAG
AATTATTTATAGAAACCAAAGATCAGACCAGAGATTTTAATTTGCTAATC
CCTTTACTGGTGTACGGTTATCATGGACATGTTGAAGCGCCTCTGGTCTT
TTCTGGTATTAAGAAACAGAAACTTCACAATTTTATGAAAACAGTCTACA
GCTATTTGTTTATATCTACAGTTTGCTATGCGGTTACGGGCGTTTTCGGA
TATTTAACATTTGGTAGAACAACTGATGTTGATTTTCTACTCAATTATCC
CAAAGATAATTGGTTTGCCAATGTCGCCATTTTAATTGTCAGTTTCAAGC
TTTTTACGAGTTTTCCGGTTTTATTTTTCGTTGTTCGATCCGTATTTAAC
GGCTTCTATTCGAGCGTAGTCAGCACAATTTCACATGAAAAGATCAAAGA
TTTTTTAGAAAACTTTGCAATTGCTAGAGTTTTGCAAACTTTAATTATAT
TTTTCTTTATCATAATATGCGCAGTTGTCATTCCGAATATTAGCAATGCC
ATTTCAATAATTGGAGCAGTTTCGTGTCATTTCTGTTTCACTTTTCCAGG
TCTCTGTTTCTTTTTCTTGTATCAAAAAGCAACAATTTCTAATCGAAAAC
ACTTCATAAGAAAAATTGGTGGAATATTTTATATATTGCTTGGAACATTT
TGCTTCGGAGTGAACTTTACAGTGGCCATACAAAGCCTGTTAAAGTCGAG
ACCTTCGATTTAGTTCAAATTGTAAACATACATTTTTTTTGGAAATCCTG
GGCTTATTTACACAGTTCTCGTTCCCAGAAAAGCTTTTTATGTGGTTGAT
TAATGTTGCAATTGTTATCAAATTTTATTTTATTTTTTATAGATTCAAAC
GTTTCACAACGCATGTGATATAAAATTATAAATTTCACTTTTTCATTTGT
TTTTTTTAACTAAACTTTCATTTATTTATTC
back to top

protein sequence of SMED30029096-orf-1

>SMED30029096-orf-1 ID=SMED30029096-orf-1|Name=SMED30029096-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=485bp
MANKNNENLSSSGNVIEDNPNNAQLTTFESTDSDIFYNNNNNKRKRSSAS
SGGFLQDGSLVDENDEESNFTGGAGWPSGILIMANVCLGMGILNFPRIFY
EAGGITVTLISLAIFVVLIAGSLYIIAYCCRYYACVNYQDMVRVHCGRYF
GLVCSVSLFFELTGSLIVKMVVLSDQLDRLYSIASGSEFTKHYYLMPIVA
IVIFLPMCFIRDFTCFKYVSVGGVLAALYITFGVSMVGYILKEPGDPELF
IETKDQTRDFNLLIPLLVYGYHGHVEAPLVFSGIKKQKLHNFMKTVYSYL
FISTVCYAVTGVFGYLTFGRTTDVDFLLNYPKDNWFANVAILIVSFKLFT
SFPVLFFVVRSVFNGFYSSVVSTISHEKIKDFLENFAIARVLQTLIIFFF
IIICAVVIPNISNAISIIGAVSCHFCFTFPGLCFFFLYQKATISNRKHFI
RKIGGIFYILLGTFCFGVNFTVAIQSLLKSRPSI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR013057AA_transpt_TM
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013057Amino acid transporter, transmembrane domainPFAMPF01490Aa_transcoord: 74..474
e-value: 6.0E-42
score: 143.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..22
NoneNo IPR availablePANTHERPTHR22950AMINO ACID TRANSPORTERcoord: 40..475
NoneNo IPR availablePANTHERPTHR22950:SF562coord: 40..475
NoneNo IPR availableTMHMMTMhelixcoord: 218..240
NoneNo IPR availableTMHMMTMhelixcoord: 387..409
NoneNo IPR availableTMHMMTMhelixcoord: 150..172
NoneNo IPR availableTMHMMTMhelixcoord: 295..317
NoneNo IPR availableTMHMMTMhelixcoord: 414..436
NoneNo IPR availableTMHMMTMhelixcoord: 107..129
NoneNo IPR availableTMHMMTMhelixcoord: 260..282
NoneNo IPR availableTMHMMTMhelixcoord: 337..359
NoneNo IPR availableTMHMMTMhelixcoord: 70..92
NoneNo IPR availableTMHMMTMhelixcoord: 456..478
NoneNo IPR availableTMHMMTMhelixcoord: 192..211