Protocadherin-1

Overview
NameProtocadherin-1
Smed IDSMED30029094
Length (bp)3639
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin-1 (SMED30029094) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin-1 (SMED30029094) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin-1 (SMED30029094) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin-1 (SMED30029094) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029094

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30029094SMESG000008751.1 SmedASXL_015312SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30029094SMESG000008751.1 dd_Smed_v4_18397_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30029094SMESG000008751.1 dd_Smed_v6_18397_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30029094SMESG000008751.1 OX_Smed_1.0.08389ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin-1 vs. Ensembl Human
Match: PCDH11X (protocadherin 11 X-linked [Source:HGNC Symbol;Acc:HGNC:8656])

HSP 1 Score: 212.231 bits (539), Expect = 1.918e-55
Identity = 221/809 (27.32%), Postives = 358/809 (44.25%), Query Frame = 2
Query:  212 HSYNFEANVVKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFT----YKIYTTDIDSNLTKL--DFKGHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFPD---HWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSL--LYRPMFSLT--LVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSL-----GDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDK--THSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIK-QFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTIITV----KISTAEKTNYLIKNS 2557
            HS   E N   Y ++EE   N LIG++ +D     +  P ++ T    +K+     D  L ++  D         RIDRE LC  + + + C  E+ +   PD     +K+  +IEDINDN P FP     I + E+ A+ ++  L  A+D D+   GVQ+Y L  S+  F L  +  P       L+V K+LD E      + + +   DGG P +     LQ+ VTD+NDN+P+F +T+    I E+ P+G+ +   +A+DAD G   KI+F      +   +  F+LN  TG + +   L+ +      L V A D  G+ P  ++  + + V D N++ P + +        +++ + EN P    + ++  +D D + NG+VTC         L    S+       + L T    D E    + I +   D G PP     +  + V D N+  P F  S  ++ I E+      L ++ A+D D      +NY L P    +F +D   G+L  +   DRE   KY+  +   D      LT   TV++++ D NDN+PV T  +  F + EN   L     +G +   D D   N+ V   +L               N  F ID     +    S DRE+ + Y   +   D G   RS+   +T+ V D NDN P++    +  +Y++ V   TN    +  V A D D   N+ + Y+ V  +   L     F I    G I +    D+ + G + + ++A D G P     V I+ +     ++ A   N L++ S
Sbjct:   20 HSGAQEKN---YTIREEMPENVLIGDLLKDLNLSLI--PNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDRE--EKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASD-GGLMP--ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQ------FLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDN-GVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPEN---LPRHGTVGLITVTDPDYGDNSAVTLSILDE-------------NDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYEL-VLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDL-----FAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNATLINELVRKS 789          
BLAST of Protocadherin-1 vs. Ensembl Human
Match: PCDH11X (protocadherin 11 X-linked [Source:HGNC Symbol;Acc:HGNC:8656])

HSP 1 Score: 213.386 bits (542), Expect = 2.091e-55
Identity = 222/819 (27.11%), Postives = 358/819 (43.71%), Query Frame = 2
Query:  212 HSYNFEANVVKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFT----YKIYTTDIDSNLTKL--DFKGHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFPD---HWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSL--LYRPMFS--LTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSL-----GDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLV----------TTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDK--THSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIK-QFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTIITV----KISTAEKTNYLIKNS 2557
            HS   E N   Y ++EE   N LIG++ +D     +  P ++ T    +K+     D  L ++  D         RIDRE LC  + + + C  E+ +   PD     +K+  +IEDINDN P FP     I + E+ A+ ++  L  A+D D+   GVQ+Y L  S+  F L  +  P       L+V K+LD E      + + +   DGG P +     LQ+ VTD+NDN+P+F +T+    I E+ P+G+ +   +A+DAD G   KI+F      +   +  F+LN  TG + +   L+ +      L V A D  G+ P  ++  + + V D N++ P + +        +++ + EN P    + ++  +D D + NG+VTC                    EI +RL           T    D E    + I +   D G PP     +  + V D N+  P F  S  ++ I E+      L ++ A+D D      +NY L P    +F +D   G+L  +   DRE   KY+  +   D      LT   TV++++ D NDN+PV T  +  F + EN   L     +G +   D D   N+ V   +L               N  F ID     +    S DRE+ + Y   +   D G   RS+   +T+ V D NDN P++    +  +Y++ V   TN    +  V A D D   N+ + Y+ V  +   L     F I    G I +    D+ + G + + ++A D G P     V I+ +     ++ A   N L++ S
Sbjct:   20 HSGAQEKN---YTIREEMPENVLIGDLLKDLNLSLI--PNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREE--KDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASD-GGLMP--ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCF----------------TDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDN-GVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPEN---LPRHGTVGLITVTDPDYGDNSAVTLSILDE-------------NDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYEL-VLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDL-----FAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNATLINELVRKS 789          
BLAST of Protocadherin-1 vs. Ensembl Human
Match: PCDH11X (protocadherin 11 X-linked [Source:HGNC Symbol;Acc:HGNC:8656])

HSP 1 Score: 213.001 bits (541), Expect = 2.215e-55
Identity = 222/819 (27.11%), Postives = 358/819 (43.71%), Query Frame = 2
Query:  212 HSYNFEANVVKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFT----YKIYTTDIDSNLTKL--DFKGHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFPD---HWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSL--LYRPMFS--LTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSL-----GDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLV----------TTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDK--THSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIK-QFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTIITV----KISTAEKTNYLIKNS 2557
            HS   E N   Y ++EE   N LIG++ +D     +  P ++ T    +K+     D  L ++  D         RIDRE LC  + + + C  E+ +   PD     +K+  +IEDINDN P FP     I + E+ A+ ++  L  A+D D+   GVQ+Y L  S+  F L  +  P       L+V K+LD E      + + +   DGG P +     LQ+ VTD+NDN+P+F +T+    I E+ P+G+ +   +A+DAD G   KI+F      +   +  F+LN  TG + +   L+ +      L V A D  G+ P  ++  + + V D N++ P + +        +++ + EN P    + ++  +D D + NG+VTC                    EI +RL           T    D E    + I +   D G PP     +  + V D N+  P F  S  ++ I E+      L ++ A+D D      +NY L P    +F +D   G+L  +   DRE   KY+  +   D      LT   TV++++ D NDN+PV T  +  F + EN   L     +G +   D D   N+ V   +L               N  F ID     +    S DRE+ + Y   +   D G   RS+   +T+ V D NDN P++    +  +Y++ V   TN    +  V A D D   N+ + Y+ V  +   L     F I    G I +    D+ + G + + ++A D G P     V I+ +     ++ A   N L++ S
Sbjct:   20 HSGAQEKN---YTIREEMPENVLIGDLLKDLNLSLI--PNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREE--KDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASD-GGLMP--ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCF----------------TDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDN-GVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPEN---LPRHGTVGLITVTDPDYGDNSAVTLSILDE-------------NDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYEL-VLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDL-----FAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNATLINELVRKS 789          
BLAST of Protocadherin-1 vs. Ensembl Human
Match: PCDH11X (protocadherin 11 X-linked [Source:HGNC Symbol;Acc:HGNC:8656])

HSP 1 Score: 213.001 bits (541), Expect = 2.349e-55
Identity = 222/819 (27.11%), Postives = 358/819 (43.71%), Query Frame = 2
Query:  212 HSYNFEANVVKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFT----YKIYTTDIDSNLTKL--DFKGHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFPD---HWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSL--LYRPMFS--LTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSL-----GDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLV----------TTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDK--THSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIK-QFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTIITV----KISTAEKTNYLIKNS 2557
            HS   E N   Y ++EE   N LIG++ +D     +  P ++ T    +K+     D  L ++  D         RIDRE LC  + + + C  E+ +   PD     +K+  +IEDINDN P FP     I + E+ A+ ++  L  A+D D+   GVQ+Y L  S+  F L  +  P       L+V K+LD E      + + +   DGG P +     LQ+ VTD+NDN+P+F +T+    I E+ P+G+ +   +A+DAD G   KI+F      +   +  F+LN  TG + +   L+ +      L V A D  G+ P  ++  + + V D N++ P + +        +++ + EN P    + ++  +D D + NG+VTC                    EI +RL           T    D E    + I +   D G PP     +  + V D N+  P F  S  ++ I E+      L ++ A+D D      +NY L P    +F +D   G+L  +   DRE   KY+  +   D      LT   TV++++ D NDN+PV T  +  F + EN   L     +G +   D D   N+ V   +L               N  F ID     +    S DRE+ + Y   +   D G   RS+   +T+ V D NDN P++    +  +Y++ V   TN    +  V A D D   N+ + Y+ V  +   L     F I    G I +    D+ + G + + ++A D G P     V I+ +     ++ A   N L++ S
Sbjct:   20 HSGAQEKN---YTIREEMPENVLIGDLLKDLNLSLI--PNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREE--KDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASD-GGLMP--ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCF----------------TDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDN-GVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPEN---LPRHGTVGLITVTDPDYGDNSAVTLSILDE-------------NDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYEL-VLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDL-----FAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNATLINELVRKS 789          
BLAST of Protocadherin-1 vs. Ensembl Human
Match: PCDH11X (protocadherin 11 X-linked [Source:HGNC Symbol;Acc:HGNC:8656])

HSP 1 Score: 213.001 bits (541), Expect = 2.716e-55
Identity = 222/819 (27.11%), Postives = 358/819 (43.71%), Query Frame = 2
Query:  212 HSYNFEANVVKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFT----YKIYTTDIDSNLTKL--DFKGHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFPD---HWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSL--LYRPMFS--LTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSL-----GDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLV----------TTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDK--THSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIK-QFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTIITV----KISTAEKTNYLIKNS 2557
            HS   E N   Y ++EE   N LIG++ +D     +  P ++ T    +K+     D  L ++  D         RIDRE LC  + + + C  E+ +   PD     +K+  +IEDINDN P FP     I + E+ A+ ++  L  A+D D+   GVQ+Y L  S+  F L  +  P       L+V K+LD E      + + +   DGG P +     LQ+ VTD+NDN+P+F +T+    I E+ P+G+ +   +A+DAD G   KI+F      +   +  F+LN  TG + +   L+ +      L V A D  G+ P  ++  + + V D N++ P + +        +++ + EN P    + ++  +D D + NG+VTC                    EI +RL           T    D E    + I +   D G PP     +  + V D N+  P F  S  ++ I E+      L ++ A+D D      +NY L P    +F +D   G+L  +   DRE   KY+  +   D      LT   TV++++ D NDN+PV T  +  F + EN   L     +G +   D D   N+ V   +L               N  F ID     +    S DRE+ + Y   +   D G   RS+   +T+ V D NDN P++    +  +Y++ V   TN    +  V A D D   N+ + Y+ V  +   L     F I    G I +    D+ + G + + ++A D G P     V I+ +     ++ A   N L++ S
Sbjct:   20 HSGAQEKN---YTIREEMPENVLIGDLLKDLNLSLI--PNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREE--KDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASD-GGLMP--ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCF----------------TDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDN-GVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPEN---LPRHGTVGLITVTDPDYGDNSAVTLSILDE-------------NDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYEL-VLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDL-----FAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNATLINELVRKS 789          
BLAST of Protocadherin-1 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 160.229 bits (404), Expect = 4.021e-39
Identity = 203/785 (25.86%), Postives = 339/785 (43.18%), Query Frame = 2
Query:  221 NFEANVVKYR-------LKEESDINTLIGNIFEDSRSEY-----MRKPKENFTYKIYTTDIDSNLTKLDFKGHLLVNKRIDREFLCPNVDKIDDCQ-LELMIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGP-FSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDKFQI-DI-NKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTIITVKIS 2521
            N +AN V ++       L E++ I T+I ++     S       M  P+++ +  ++T D  S        G + + K +DRE L  ++ K+   + ++  I A       V + + D+ DN P F       ++ E   +G  +    A D D    G   Y+L +     +LL     S  +     LD E +S     L +IA D GTP +     ++I V D NDN P+F        I E+  I +VI    A+D D G  GK+++ +  +          ++++TGE+ L   ++AK  S     + A+D  G  P  SS   LTI V D N+HAP L +  ++ +T+ EN   GE VG V A D D   NG +          Y        + DE    + TT++ DRE    +++ ++ +D G P   +     V + DIN+  P+F    Y++ ISE++   S +I +KA+D D+   + Y ++ +  + F I DI ++G + ++    +    K  V +  TDQ               V            +K   I E+  I   G  +  L+ +D D   NA +V  + S              +  F ID    ++ V S LDRE    + + +  SD   P  +    I V+++D NDNSP    Q   ++Y   ++ +  +    + V A D D   N  + Y F+N   +S   +  F +   +G + +S   D ++     L I A D G+ P  S  + IT+ +S
Sbjct:  157 NPDANAVHFQQEKYVKELPEDTPIETIIASVKASHASSQPLYYSMVAPQDSRSQNLFTLDTMS--------GEIRLAKSMDREVLDKHILKVTAYERVDPTISAS----TTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGK-NLLAINAKSGVIQTAAPLDRETLS--LIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGG---LTIDYSTGEVTLRERIDAK-NSPITAVIRAKD--GAQPALSSTVPLTINVIDINDHAPTL-IAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGII---------KYSMEGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVNSAPYFNDHPFSVK---IPEHSPI---GYPVITLKAEDHDRGDNARIVYSIDS--------------SQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSP----QFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDY-FLNESSSSPSIQ-LFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGT-PSLSAASEITLTLS 883          

HSP 2 Score: 105.145 bits (261), Expect = 2.162e-22
Identity = 149/610 (24.43%), Postives = 253/610 (41.48%), Query Frame = 2
Query:  515 VFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLI--ACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLN--YHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISY 2332
            V I + D+NDN P F +    + + E+I +   +    A DED    G   Y++  S     L     +S   V L+    E I  +   +T +  A DG  P       L I V D ND+ P     Q    ++E+  IG  +    A D DSG  G I + +      +    F ++ ++G +     L+ +  +++ L V ARD  G    ++   + + ++D N++AP     +  ++TI E  P G  +  + A D D  ++ K+T  + + D    ++    ++ D+     V+  +  ++      + IS  D G    R   + NV + D+N   P F    +S+ I E   I   +I +KA D D+  +    Y +D S    F+ID + G +      DRE    + V V  +D     + T T    I     +++    +      I E++ + T       LQ   +D       + D       S+    I+L    F +D+    L V S LDREQ     L I   D G P  S    IT+ + D NDN+P +     Q +Y + +   + +   +  + A D D   N++IS+
Sbjct:  361 VEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTID--YSTGEVTLR----ERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSM------EGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDM-GTPSLNTSTTIAVVLKDINDNAPTFDKKEY-NVTISEEMPRGSQIITLKAVDND--EDQKITYRIEEADREVFSI---LDIGDQGAILSVSGELKRQD--HKVRVEISATDQGGLQGRC--VVNVFIDDVNS-APYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSS--QFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGT-----SFLQVSAIDADIGPNGIVDYFLNE--SSSSPSIQL----FRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFE----QLSYDLYIAENSPVGSTVGTIVARDADEGDNADISF 929          

HSP 3 Score: 90.8929 bits (224), Expect = 5.453e-18
Identity = 79/284 (27.82%), Postives = 130/284 (45.77%), Query Frame = 2
Query:  488 HAFP--DHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSY--NLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARD-------ENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIM---ENSPAGEHVGMVIASDGD 1297
            HA P  +   ++ +I++DINDN P+F +      +SE I VG      +A+D D+   G+  Y  N   S P   L      S TL V  KLD E  +     L + A D GTP      ++ + ++D NDN P F+Q     +I E++P+GS +    A DAD G    I+F++      K    F++  +  +  ++     +I+++   D EA+        +   G  SS   + I V D N++ P L    ++ + +M   +N      +G + A D D
Sbjct:  759 HASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFA--VIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAK---LFDIEEDAEQNGVV-----RILTRAEFDYEAKANKFFFELQASSGQLSSTVPVRIHVSDVNDNKPAL----KDFVILMNRFDNVQMARQIGFIPAFDPD 1028          
BLAST of Protocadherin-1 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 134.42 bits (337), Expect = 2.559e-31
Identity = 151/566 (26.68%), Postives = 250/566 (44.17%), Query Frame = 2
Query:  839 LQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGP-FSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDKFQI-DI-NKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTIITVKIS 2521
            ++I V D NDN P+F        I E+  I +VI    A+D D G  GK+++ +  +          ++++TGE+ L   ++AK  S     + A+D  G  P  SS   LTI V D N+HAP L +  ++ +T+ EN   GE VG V A D D   NG +          Y        + DE    + TT++ DRE    +++ ++ +D G P   +     V + DIN+  P+F    Y++ ISE++   S +I +KA+D D+   + Y ++ +  + F I DI ++G + ++    +    K  V +  TDQ               V            +K   I E+  I   G  +  L+ +D D   NA +V  + S              +  F ID    ++ V S LDRE    + + +  SD   P  +    I V+++D NDNSP    Q   ++Y   ++ +  +    + V A D D   N  + Y F+N   +S   +  F +   +G + +S   D ++     L I A D G+ P  S  + IT+ +S
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGG---LTIDYSTGEVTLRERIDAK-NSPITAVIRAKD--GAQPALSSTVPLTINVIDINDHAPTL-IAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGII---------KYSMEGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVNSAPYFNDHPFSVK---IPEHSPI---GYPVITLKAEDHDRGDNARIVYSIDS--------------SQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSP----QFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDY-FLNESSSSPSIQ-LFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGT-PSLSAASEITLTLS 524          

HSP 2 Score: 129.798 bits (325), Expect = 6.572e-30
Identity = 118/433 (27.25%), Postives = 206/433 (47.58%), Query Frame = 2
Query:  509 IKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVS---KFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRE-SLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKD--KTHSLNYHLDPSVNDK----FQIDINKGILKNIVHFDREVIPKYIVPVFVTDQ 1777
            + + I + DIND+ P     +K I + E++A+G ++    A+DED    G+  Y++E SE F       +   T    K LD E  +   ++L + A D GTP       + + + D NDN P FD+ +    I E  P GS I    A D D     KI +++  A    ++  F++  + G+   I S++ ++     K  +++ A D+ G+     +C + + + D+ N AP  +  D   S+ I E+SP G  V  + A D D  DN ++  V   + S +  +D S          +  +   DRE    F+++++  D+ +PP  +     V + DIN+  P F  S+Y+  ISEDI + ++ +Q+ A+D D      ++Y L+ S +      F++D   G L+     DRE     ++P+F  D+
Sbjct:  104 VPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDSGLIKTT----KLLDRETTAR--YSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQ--KITYRIEEA----DREVFSI-LDIGDQGAILSVSGELKRQDHKVRVEISATDQGGL---QGRCVVNVFI-DDVNSAPYFN--DHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARI--VYSIDSSQFFRIDPSSG-------DISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDR 508          

HSP 3 Score: 104.375 bits (259), Expect = 3.679e-22
Identity = 149/610 (24.43%), Postives = 253/610 (41.48%), Query Frame = 2
Query:  515 VFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLI--ACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLN--YHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISY 2332
            V I + D+NDN P F +    + + E+I +   +    A DED    G   Y++  S     L     +S   V L+    E I  +   +T +  A DG  P       L I V D ND+ P     Q    ++E+  IG  +    A D DSG  G I + +      +    F ++ ++G +     L+ +  +++ L V ARD  G    ++   + + ++D N++AP     +  ++TI E  P G  +  + A D D  ++ K+T  + + D    ++    ++ D+     V+  +  ++      + IS  D G    R   + NV + D+N   P F    +S+ I E   I   +I +KA D D+  +    Y +D S    F+ID + G +      DRE    + V V  +D     + T T    I     +++    +      I E++ + T       LQ   +D       + D       S+    I+L    F +D+    L V S LDREQ     L I   D G P  S    IT+ + D NDN+P +     Q +Y + +   + +   +  + A D D   N++IS+
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTID--YSTGEVTLR----ERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSM------EGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDM-GTPSLNTSTTIAVVLKDINDNAPTFDKKEY-NVTISEEMPRGSQIITLKAVDND--EDQKITYRIEEADREVFSI---LDIGDQGAILSVSGELKRQD--HKVRVEISATDQGGLQGRC--VVNVFIDDVNS-APYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSS--QFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGT-----SFLQVSAIDADIGPNGIVDYFLNE--SSSSPSIQL----FRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFE----QLSYDLYIAENSPVGSTVGTIVARDADEGDNADISF 570          

HSP 4 Score: 90.5077 bits (223), Expect = 6.066e-18
Identity = 79/284 (27.82%), Postives = 130/284 (45.77%), Query Frame = 2
Query:  488 HAFP--DHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSY--NLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARD-------ENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIM---ENSPAGEHVGMVIASDGD 1297
            HA P  +   ++ +I++DINDN P+F +      +SE I VG      +A+D D+   G+  Y  N   S P   L      S TL V  KLD E  +     L + A D GTP      ++ + ++D NDN P F+Q     +I E++P+GS +    A DAD G    I+F++      K    F++  +  +  ++     +I+++   D EA+        +   G  SS   + I V D N++ P L    ++ + +M   +N      +G + A D D
Sbjct:  400 HASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFA--VIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAK---LFDIEEDAEQNGVV-----RILTRAEFDYEAKANKFFFELQASSGQLSSTVPVRIHVSDVNDNKPAL----KDFVILMNRFDNVQMARQIGFIPAFDPD 669          
BLAST of Protocadherin-1 vs. Ensembl Celegans
Match: cdh-4 (Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI5])

HSP 1 Score: 121.324 bits (303), Expect = 2.768e-27
Identity = 120/441 (27.21%), Postives = 207/441 (46.94%), Query Frame = 2
Query:  335 NFTYKIYTTDIDSNLTKLDFKGHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFPDHWIK----VFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLP--LQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTC---VLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKD 1630
            N T+K+  +D D N+  ++F+  ++  K  D+      +D   + QLE       D+       + ++IE++NDN+PK   K  ++ + E++         +   + ED ++  ++   ++D   F  L      +  + V+K LD E +   +FNLT++A DG      DK  + + V D NDN P F+++     + ES  IG  +  F AS  D      I + L P+  T    + NLN  TG L L   L+ + +S   L V A+D +GV P  ++ Q+ I V DEN++AP     ++    + ENS +GE V  V A D D E  G V+    ++ +  ++   L  + N   +++     ++  D E +  + + +  +D G PP RS  L  + V D N+  P+F   N +  + E   I   L++    D D
Sbjct: 2941 NVTFKL--SDNDGNVFVVNFRNGIVKVKESDQ------IDYEKNQQLEFHRLTIQDNSEVCKELITVVIENLNDNRPKIIEKLLKVSIDENLPTSEDARQYITRIVAEDADFDEIKFRMVDD---FGGLFQIDDINGVVTVVKPLDSEILG--FFNLTVVASDGEFE---DKATILVTVIDQNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGDQN--ETIEYYLKPSDVTS---FVNLNAQTGILTLAKPLDFETLSALKLTVVAKD-SGVPPLETEAQVEISVMDENDNAPKFE-KEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSNGDVLI----SQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTFDDCNMTALVQEGEAIGHRLLKFSVSDLD 3354          

HSP 2 Score: 100.138 bits (248), Expect = 8.756e-21
Identity = 86/284 (30.28%), Postives = 139/284 (48.94%), Query Frame = 2
Query:  515 VFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTA----MDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKL--LPARTTKNKVY-FNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDS 1345
            + + + D NDN P F      +KV ES ++G +L    A     +E +EY+   S    D   F +L  +   +  L + K LDFE +S     LT++A D G P    + +++I V D NDN P F++ +    +KE++  G  +    A D DS  FG ++++L  +   TT   V  F +N N G++++  S++ + + K+ L V A+D  G  P  S+  L I V+DEN+HAP     +  +L + E    G  +     SD D   NG    V ++ D 
Sbjct: 3099 ILVTVIDQNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGDQNETIEYYLKPS----DVTSFVNLNAQ---TGILTLAKPLDFETLS--ALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSN-GDVLISQSIDYEKIKKYNLKVIAKD-GGRPPLRSEALLEIHVEDENDHAPTFDDCNMTAL-VQEGEAIGHRLLKFSVSDLDGPKNGAPFTVEIQGDG 3370          

HSP 3 Score: 93.9745 bits (232), Expect = 5.791e-19
Identity = 86/273 (31.50%), Postives = 131/273 (47.99%), Query Frame = 2
Query:  512 KVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLE-DSEPFFSLLYRPMFSLT----LVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLED-NG 1312
            +V I + D NDN PKF  ++   KV E+   G ++    A+D D E+FG  SY LE  SE        P F++     +++ + +D+E I  + +NL +IA DGG P    +  L+I V D ND+ P FD       ++E   IG  +  F+ SD D    G      +     K+   F +N    EL+    L  +   K++L V A+D  G    ++ C LTI ++  + HAP +     +  T+    P G  +G + ASD D ED NG
Sbjct: 3201 QVEISVMDENDNAPKFEKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLP-FAINSNGDVLISQSIDYEKI--KKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTFDDCNMTALVQEGEAIGHRLLKFSVSDLDGPKNGAPFTVEIQGDGAKS---FKVNEKL-ELLTAKKLEYRKKDKYLLTVIAKDVKGK---TTDCPLTIFIRQTSRHAPTMKPMKIQINTLQNELPEG-IIGRLKASDEDEEDQNG 3462          

HSP 4 Score: 89.3521 bits (220), Expect = 1.488e-17
Identity = 115/433 (26.56%), Postives = 180/433 (41.57%), Query Frame = 2
Query:  512 KVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLED-SEPFFSLLYRPMFSLTLVV---LKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDI--NEFPPSFYHSNYSIFISEDIEINSALIQIKALD-----KDKTHSLNYHLDPSVN-DKFQIDINKGILKNIVHFDREVIPKYIVPVFVTD 1774
            K  II E  N + P F +  + ++V+E   +G  +    A DED  Y G   Y + D +     +L     S  + V   L KL  E +      L + A D GTPV+   + +++ + D N+++P FD+   Y  I E+   G  IF   A+D D G  GKI F L      +     +++  TG + L+ SL+ +        + A DE G     S   LTI V+D N++ P   +       I E+ P G  V  + A D D+  N K+   LL ++     +D         I+        D     +F + I   D+G+P   +    +V + DI  N     F        + E+ EI + +I I+A +     K K  +L Y +        F ID  KG ++     DRE    Y + V   D
Sbjct:  593 KPIIIQESENKHSPVFSSFPEIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEVLTVDEQSGEITVASDLSKLMKEKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSL--GNNQEKSSVISIDAKTGIVKLLKSLDREDQDVHTFAIIASDE-GFPMRVSVTNLTISVEDVNDNPPKCVV-QHSRARIPEDLPHGAFVSCMAAFDEDIGQNSKLK-FLLNSEKVPFRIDHHSG----CIFIHAPEYPLDYHKTPFFNLSIEVADHGDPILSTSCHLHVELVDIAHNHLAIEFDDVAKEASVYENSEIGTEVIMIEAKETGDEQKVKAENLEYRIIGGDGWPHFSID-QKGTVRTTHLLDRETKSAYWITVEARD 1015          

HSP 5 Score: 80.1073 bits (196), Expect = 1.075e-14
Identity = 87/322 (27.02%), Postives = 150/322 (46.58%), Query Frame = 2
Query:  773 RYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKF-ILDVEARD---ENGVGPFSSQCQLTIRVQDENNHAPILSLGDRES--LTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKND--SNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKD--KTHSLNYHLDPSVNDKFQIDINKGIL 1708
            R   L L+    GT +    + + I+ ++ N ++P+F        + E  PIG+V+    A+D D+G  G I + +     + ++V   ++  +GE+ + + L+  +  K  +LDV+ +    + G    SS   + +R++D NNH+P     D  S  L I EN   G+ +  V A+D D  +NGK+   L  N   S+ +++D     K  I+  L   +  DRE  D  T  I   D G P   S     +SV D+N+ PP     +    I ED+   + +  + A D+D  +   L + L+ S    F+ID + G +
Sbjct:  573 RMSALNLMFYKNGTKIPAKPKPIIIQESE-NKHSPVFSSFPEIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEV-LTVDEQSGEITVASDLSKLMKEKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQF---DEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGNNQEKSSVISID----AKTGIVKLL---KSLDREDQDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVVQHSRARIPEDLPHGAFVSCMAAFDEDIGQNSKLKFLLN-SEKVPFRIDHHSGCI 881          

HSP 6 Score: 75.8702 bits (185), Expect = 2.270e-13
Identity = 122/597 (20.44%), Postives = 239/597 (40.03%), Query Frame = 2
Query:  731 LVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADS-GLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIV----SKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLT-IMENSPAGEHVGMVIASDGDLE------DNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYH-LDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGS 2476
            + +  +LD+E    + ++L L+A   G  V  + + + + + D ND  P F ++     I +S   G  I I +A+D D+     + + KLL      ++  FN++  TGEL L   +    +    +K +L+V   D    G F++  +L + +    +  P         +   +EN+   +   + +A  G +            +      ++  +A+DR          R+  +RV +      + I +  +D      R+F    +SV DIN+ PP F    YS  ISE  +    ++ + A D D+  ++ Y  LD S +  F +   +G +      + +      + +  TD         TT      ++             F + E+  +   GN+IG +Q  + +         D +   ++         L   F +++    + VKSSLDRE+ +++K+ I     G      +  +TV + D NDN+P +         +  ++ +  +   + +  A D D   +  I ++ V  +        YF +   +G + ++   D ++   Y L  +ATD G 
Sbjct: 2238 VTITGQLDYEKT--QKYDLKLVATSSGKQVSSEAEFI-VLIEDVNDEMPEFIRSDVSAKISDSAITGQFITIMSATDMDTTNSLDEESQKLLYKIVDGDETLFNISPATGELSLARPVEQDDLVNEDTKKVLNVSVTD----GMFTAYAKLVVEILRSGSMQPPPRFEQSHYVANALENTIVNKSALLTVAVKGGVPPLQFSLAPTTSSNSSTSKEAWPVAIDRKTG-------RIHVSRVLNYHRDKRYQIPLVVEDATG--RRAFSTLTLSVIDINDKPPFFVLPFYSTSISESAKEGDTVMMVSATDDDENDTIEYSLLDGSESQFFSVHPRQGTITVAKKLEHKAGVTLSLTIKATDSANPPHHATTTVEVNIASESVKVPRFSNSHYLFSVMEDADV---GNVIGRVQQMETE--------IDEIRFTIVPGSEESDSFL--PFSVERSTGKIIVKSSLDRERKNQWKMTIRADAAG--GVHAITTVTVDIGDVNDNAPAFHGDYE----RFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSLVEEN-------PYFDLNENSGWLTVASQLDREKIDHYKLIARATDEGG 2792          

HSP 7 Score: 74.3294 bits (181), Expect = 5.452e-13
Identity = 139/635 (21.89%), Postives = 264/635 (41.57%), Query Frame = 2
Query:  761 NISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPI-----GSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLI---TSLNAKIVSKFILDV-------EARD----ENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNG--------------KVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDK----FQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKS---SLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAK---KNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGS----PPRFSDVTIITVKI 2518
            N S R +N  +IA   G   +  ++ + IE+ DSND+ P+F    + K++++ TPI     G V+   +A+D D G  GKI +K        +++   +N NTGE+ L+      N+   + + +D+        A +    +NG     ++ +  I  + EN H+P+ S    E + + E++P G  V  + A+D D   NG              +V  V  ++    +A D S  MK+++            E+LD   + +S  D G P   S +   + + D+N   P F   +Y + ISE+ +    + ++ A D D  ++         N +      ID   GI+K +   DRE    +   +  +D+     ++ T          ++    +    +  I E+   L +G  +  +   D D   N+ +   L S  V              F ID +   +F+ +    LD  +   + L+I ++D G P  S    + V + D   N     +  +  A + +V   + +   +I+++A +   +   K  N+ Y  +  D    W   +F+I  + G +  +   D +    Y++ ++A D+ +     PR  DV  + ++I
Sbjct:  452 NRSERVYNFKVIASLHGINEKLAEKDVSIEILDSNDHAPVF----SAKWMRQ-TPIVIGKPGDVLVKVDATDQDEGENGKIVYKFT------SELPLEINANTGEITLVEVPKKGNSWPATVWAIDLGLPLSRMSALNLMFYKNGT-KIPAKPKPIIIQESENKHSPVFS-SFPEIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEVLTVDEQSGEITVASDLSKLMKEKL------------EVLD-VQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGNNQEKSSVISIDAKTGIVKLLKSLDREDQDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVVQHSRARIPED---LPHGAFVSCMAAFDEDIGQNSKLKFLLNSEKV-------------PFRIDHHSGCIFIHAPEYPLDYHKTPFFNLSIEVADHGDPILSTSCHLHVELVDIAHNHLAIEF--DDVAKEASVYENSEIGTEVIMIEAKETGDEQKVKAENLEYRIIGGDG---W--PHFSI-DQKGTVRTTHLLDRETKSAYWITVEARDSKTDLYKDPRRRDVLHVFIRI 1036          

HSP 8 Score: 65.4698 bits (158), Expect = 3.370e-10
Identity = 112/433 (25.87%), Postives = 178/433 (41.11%), Query Frame = 2
Query:  527 IEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNL--EDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESL---TIMENSPAGEHVG-------MVIASDGDLEDNGKVTCVLLK-NDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSF--QLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHL-DPSVNDKFQIDINKG-ILKNIVHFDREVIPKYIVPVFVTD 1774
            I D NDN P F        V ES  V + L   TA D+D    G+ +Y++   + E  F +  +   S  + + K LD E + H    L + A D       D+  L I  ++       FD+      + +ST  G+ + + NA        G +++KL P     N  +F ++  +G + L T L  K+  +  ++  A  E+  G      ++  ++   N H+PI     R  +   TI EN P G  V        +V A D D   NG V   +L   D    ++D+           + T   FD E +  ++  +   D G PP RS    L  V+V D N+ PP F  ++  I +        ++    A D D   SL Y + D SV   F +D   G +L    +   ++   + + VFVTD
Sbjct: 1457 INDENDNSPYFVGHTAFAFVDESDTVDDVLATVTAFDKDRGENGIVTYSIVSGNEESLFKIDAK---SGEVRLAKPLDPE-LQHVESILRIRAIDSAANSLKDEMSLHIRNSNEAPETAKFDRKVYQTTLYDSTRPGTPVLVLNALH-----HGTVSYKLEP-----NCTFFEVHTLSGAVHLATWL-TKLKHRKSVECTAIVESTEGQ-QDIAKVIAKIIRTNQHSPIF----RRQVYRGTIRENMPTGSSVLSKSLLPLVVSAIDEDPGSNGLVGYRMLSPKDEQMFSVDQYSGA-------IRTQMSFDFEKMKEYSFYVQAFDMGQPPRRSLMPSLIVVTVIDENDEPPRFPSNSLDISMILPTANGVSVGGQTAQDMDSVGSLRYFIKDQSV--PFSVDSKTGDVLVKDSNGISDMTKLFDLEVFVTD 1860          

HSP 9 Score: 61.2326 bits (147), Expect = 5.517e-9
Identity = 47/159 (29.56%), Postives = 77/159 (48.43%), Query Frame = 2
Query: 2081 LDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESGTYYLKIQATDNGSPPRFSDVTIITVKISTAEKTNYLIKNS 2557
            LDRE+  +++L + I D G P+  +  I+ V V DENDNSP +     Q  +  +V   +     +  + A D D  +N+ ++YN    D         F+I   NG I  S  +    +Y L +QATD+G+P +    T + +  ++A +     KNS
Sbjct: 1114 LDREKQSEHELWVSICDGGEPQLCSNVIVIVNVLDENDNSPTF----TQAIHHYSV--RSKFAGKLCRIFAVDADEGENARLTYNITEGDAR-------FSI-DNNGNIIASEAIHGDESYALTVQATDHGTPGQQFAATRVVLTANSAGQKPRKSKNS 1258          

HSP 10 Score: 59.6918 bits (143), Expect = 1.676e-8
Identity = 81/332 (24.40%), Postives = 141/332 (42.47%), Query Frame = 2
Query:  830 KQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGS----VIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKND-SNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTH--SLNYHLD---PSVNDK----FQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVR 1783
            K+ + + + + NDN P   +      I E+ P        I    A DAD   F +I F+++          F ++   G + ++  L+++I+  F L V A D    G F  +  + + V D+N++AP        S+ +ME+   G  +    AS GD   N  +   L  +D ++++ L+    +       L   +  D E L    + +  +D G PP  +     +SV D N+  P F    Y   + E+ +    ++ +KALD D  H  +++Y L+    +  D     F I+ N  +L +    D E I KY + V   D  R
Sbjct: 2994 KELITVVIENLNDNRPKIIEKLLKVSIDENLPTSEDARQYITRIVAEDAD---FDEIKFRMVDDFGG----LFQIDDINGVVTVVKPLDSEILGFFNLTVVASD----GEFEDKATILVTVIDQNDNAPTFEKSTY-SMKVMESESIGYELAHFRASGGD--QNETIEYYLKPSDVTSFVNLNAQTGI-------LTLAKPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSNGDVLIS-QSIDYEKIKKYNLKVIAKDGGR 3303          

HSP 11 Score: 52.7582 bits (125), Expect = 1.950e-6
Identity = 39/154 (25.32%), Postives = 67/154 (43.51%), Query Frame = 2
Query: 2063 LFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNF-----VNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTI 2503
            L +   LD E +   KL ++  D G+P       + + V DENDN+P +  +     Y   V   +     ++ V+A D+D++    +SY          D   L +      +  NG + +S+  D ++   Y LK+ A D G PP  S+  +
Sbjct: 3168 LTLAKPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKFEKEK----YVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPF-----AINSNGDVLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALL 3312          

HSP 12 Score: 52.7582 bits (125), Expect = 2.121e-6
Identity = 111/511 (21.72%), Postives = 212/511 (41.49%), Query Frame = 2
Query:  257 EESDINTLIGNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLDFKGHLLVNKRIDREFLCPNVDKID--DCQLELMIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQS----YNLEDSEP--FFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTI-------RVQDENNHAPILSLGDRES--LTIMENSPAGEHVGMVIASDGDLED------NGKVTCVL-LKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKD-KTHSLNYHL----DPSVNDKFQIDINKG 1702
            E S+I T +  I      +  +   EN  Y+I   D   + + +D KG +     +DRE        ++  D + +L         + VFI I D ND++P          V+E+ +  N + ++    +  +     +    + +E  +P  FF +     + +T   +++LD E  S     +++  CDGG P  C    + + V D NDN+P F Q  ++  ++ S   G +  IF A DAD G   ++ + +     T+    F+++ N G ++   +++      + L V+A D    G   +  ++ +       + +   N  P +S G +    + I +    G  VG + ASD D ++      +G    V  ++ D+  L L +   +      RL    V D +  D+ T++I           S Q+            P F  S+Y   +SE + + + +  +KA  +   T  L ++L    D ++ DK +++ + G
Sbjct:  945 ENSEIGTEVIMIEAKETGDEQKVKAENLEYRIIGGDGWPHFS-IDQKGTVRTTHLLDRETKSAYWITVEARDSKTDLYKDPRRRDVLHVFIRILDRNDHRPVAKKPMYIASVAEN-SPANVVIVKVEATDADDVDNDAAAPLMFKIERGDPQSFFRIDLTSGY-ITTSGIRRLDREKQSEHELWVSI--CDGGEPQLCSNVIVIVNVLDENDNSPTFTQAIHHYSVR-SKFAGKLCRIF-AVDADEGENARLTYNI-----TEGDARFSID-NNGNIIASEAIHGD--ESYALTVQATDHGTPGQQFAATRVVLTANSAGQKPRKSKNSPPEIS-GKKSDYVIPISDADQVGLTVGKLEASDADGDELWWSISSGDPDSVFDVRQDTGQLLLAKKVELLKRGELRL-NISVTDGQAWDHSTVIIQV---------SRQISQR---------PKFSASHYQTDVSERVAVGTQIYTLKASGESLGTKPLVFNLFSVDDVAMEDKIRVEPSSG 1420          

HSP 13 Score: 52.373 bits (124), Expect = 2.753e-6
Identity = 42/127 (33.07%), Postives = 61/127 (48.03%), Query Frame = 2
Query:  515 VFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQ 895
            V + I D+NDN P F    +R  +SE  AVG  + + +AMD D    G   ++L +  P+F L     +   L V  +LD E I H  + L   A D G     D     I V+D ND+ P F++ +
Sbjct: 2698 VTVDIGDVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSLVEENPYFDLNENSGW---LTVASQLDREKIDH--YKLIARATDEGG-FNTD-LPFTIVVSDVNDSPPQFEKEE 2817          

HSP 14 Score: 51.6026 bits (122), Expect = 4.562e-6
Identity = 107/498 (21.49%), Postives = 198/498 (39.76%), Query Frame = 2
Query:  344 YKIYTTDIDSNLTKLDFKGHLLVNKRID---REFLCPNVDKIDDCQLELMIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDL-------EYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQ------IEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVS-KFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRE--SLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQ-------IKALDKDKTHS--LNYH-LDPSVNDKFQIDINKGILKNIVHFDREVIPKY 1750
            + I + D DS        G LL+ K+++   R  L  N+   D         A+ DH   +  +   I+  +PKF     +  VSE +AVG Q+    A  E L         F V    +ED      +   P  S  ++V++ LD+E  + R              VQ  +  ++      + + D NDN+P F     + F+ ES  +  V+    A D D G  G + + ++   +   +  F ++  +GE+ L   L+ ++   + IL + A D +       +  L IR    +N AP  +  DR+    T+ +++  G  V ++ A       +G V+  L  N + +      H +   +      T++  R+ ++   I+ S +       +        +   N+  P F    Y   I E++   S+++        + A+D+D   +  + Y  L P     F +D   G ++  + FD E + +Y
Sbjct: 1298 WSISSGDPDSVFDVRQDTGQLLLAKKVELLKRGELRLNISVTDG-------QAW-DHSTVIIQVSRQIS-QRPKFSASHYQTDVSERVAVGTQIYTLKASGESLGTKPLVFNLFSVDDVAMEDK-----IRVEPS-SGNVIVMEPLDYE--AARRIRAV---------VQVQQANMKSFATFSVNINDENDNSPYFVGHTAFAFVDESDTVDDVLATVTAFDKDRGENGIVTYSIV---SGNEESLFKIDAKSGEVRLAKPLDPELQHVESILRIRAID-SAANSLKDEMSLHIR---NSNEAPETAKFDRKVYQTTLYDSTRPGTPVLVLNAL-----HHGTVSYKLEPNCTFF----EVHTLSGAVHLATWLTKLKHRKSVECTAIVESTEG-----QQDIAKVIAKIIRTNQHSPIFRRQVYRGTIRENMPTGSSVLSKSLLPLVVSAIDEDPGSNGLVGYRMLSPKDEQMFSVDQYSGAIRTQMSFDFEKMKEY 1748          
BLAST of Protocadherin-1 vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 110.538 bits (275), Expect = 5.601e-24
Identity = 163/686 (23.76%), Postives = 283/686 (41.25%), Query Frame = 2
Query:  524 IIEDINDNKPKFPTKEK---RIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMK-DEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHS--LNYHLDPS-VNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQ-----TQDLDNSYNATVVCDLLS--VHVLSNHMSWIRLLNHS--FEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESGTYY--LKIQATDNGSPPRFSDVTIITVKISTA 2527
            ++ D+ D + K P  EK   ++++ E   +G  L    A +          Y+L++ +   ++      S T+ + K  DFE    + +  T+IA +  +  +     + I + D NDN PIF   + +  ++E       + + +ASD DSG FG++++ +L   ++     F++N  TGE+     L      +F L V A+D  G    +S   + I V D++   P  S    E  T  +  P     G+ I S G +           K   +  + D+ HN   DE   ++  TR  D ++ D  T++++ Q        +     + + D N+ PP F  S   I I ED++++     ++A DKDK  +  + Y +  S      +ID   G L      D E    Y + V  TD                        P  + +  F     + +L   +   E +      + L+NS   T+V  +++     L N     R+ N S  F ID+   N++ K S+DRE I    ++I+  D G+P RS+     + V D NDN P     +  +   + V A + L+  I  + A D D   N ++ Y            +    ++  NG +++ R L  S   +  L +  +D G  PR S V  + V+IS  
Sbjct:  526 VVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDEHLTV---DTMSGTVCIQKTFDFEK--QKSYQTTVIATNANS--ETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSS-----FSINPVTGEVFAQKPLAR---GRFHLVVSAKDGGGQSSENS-ANIHITVIDKDTKTPQFSRSKYEIRTTEDILP-----GIAIGSVGAMS----------KVKYSIYSGDQDHNFSIDEDTGKIYVTRYLDADVHD--TVLLNIQATLPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATD--------------------LGIPPRSSNMTLF-----IHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPP-----SCLSITPIVVPAGSPLSTAIGTIVAMDPDKGLNGSVLYR--------AQLQSSLFVVKSNGDVYLRRQLNASDERHQRLSVIVSDQGV-PRKSVVCHVPVRISKG 1139          

HSP 2 Score: 110.153 bits (274), Expect = 7.218e-24
Identity = 170/709 (23.98%), Postives = 299/709 (42.17%), Query Frame = 2
Query:  518 FIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELL--DYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESGTYYLKIQ--ATDNGSPPRFSDVTIITVKISTAEKTNYLIKNSQISFTLIVVTSLASFSICVALMVGI 2632
             + I DINDN P++ + +  I ++ +      L   TA D DL   G   Y++ D+E    L+     +  + V   +D    S   F +   A DGG+P      ++  ++ D+    P F++      I E TPIG+ +    A+++  G   +I + L          +  ++  +G + +  + + +    +   V A + N     +S   ++IR++D N++ PI    +   LT+ E     E + +V ASD D    G+V+  +L   S++                 VT  VF ++ L    F +++S +D G     +    +++V D +   P F  S Y I  +EDI    A+  + A+ K K +S+ Y  D   N  F ID + G +    + D +V    ++ +  T  +       T  V       ++     + + +  IRE++++     ++   Q  D D   N  V   ++S H  S           S EID++   L   S LD E    YKL +  +DLGIP RS+   + + V D NDN+P +     ++ Y + V   +     +  V A D D+ +N  I Y   N         +YF I  + G ++  R +      ++ I   A D G PPR S     + +IS  +  +     S +S T IVV + +  S  +  +V +
Sbjct:  428 LLTIGDINDNAPQWHSSQIHISLNRTQGGSRTL---TAKDPDLGQNGWIRYSVLDTE----LVSIDKETGRIFVPNTIDCNIGSEIKFRVR--AEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSL-----QNQDEHLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNANSE---TSTSLISIRLKDVNDNWPIF-YPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSSFS-------------INPVTGEVFAQKPLARGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAMSKVK-YSI-YSGDQDHN--FSIDEDTGKIYVTRYLDADVHDTVLLNIQAT--LPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVV---QASDKDKKKNGEVRYSIISSHPGS-----------SIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFE----KSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNG-------SEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTA---SARISVLDVNDN--PPSCLSITPIVVPAGSPLSTAIGTIVAM 1069          

HSP 3 Score: 93.5893 bits (231), Expect = 7.588e-19
Identity = 98/378 (25.93%), Postives = 167/378 (44.18%), Query Frame = 2
Query:  515 VFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLE--YFGVQSYNL---EDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDK 1633
            + I + D +   P+F   +  I+ +E I  G  +    AM +     Y G Q +N    ED+   +             V + LD +       N+      G    + ++ ++ I + D NDN P F  +     I+E   +    ++  ASD D    G++ + ++ +    +     ++  TG+L   + L+ +    + L V+A D  G+ P SS   L I V D N++AP        ++ ++ENSP    VG V+A D D  +NG++    + N S Y  +D       E +  + T R  DRE++ +  I I  +D G PP  S     +SV D+N+ PPS   S   I +     +++A+  I A+D DK
Sbjct:  727 IHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAMSKVKYSIYSGDQDHNFSIDEDTGKIY-------------VTRYLDADVHDTVLLNIQATLPSG----ESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSS---IEIDQFTGQLSTGSLLDYEATRNYKLRVKATDL-GIPPRSSNMTLFIHVLDVNDNAPEFE-KSWYTMEVLENSPPKTIVGKVVARDKDSLENGQI-VYRITNGSEYFGID-------EKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCL-SITPIVVPAGSPLSTAIGTIVAMDPDK 1073          

HSP 4 Score: 93.5893 bits (231), Expect = 8.050e-19
Identity = 132/552 (23.91%), Postives = 237/552 (42.93%), Query Frame = 2
Query:  515 VFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQ----NYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKD--KTHSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRS 2152
            + I ++D+NDN P F   E  + V E       L + +A D D   FG  SY++        L     FS+  V  +    + ++   F+L + A DGG     +   + I V D +   P F +++      + I     IGSV           G   K+ + +       N   F+++ +TG++ +   L+A +    +L+++A   +G    S+Q Q+ I ++D N++ P  S    E ++I E+    E   +V ASD D + NG+V   ++ +         S    D+   +L T  + D E    + + +   D G PP  S     + V D+N+  P F  S Y++ + E+    + + ++ A DKD  +   + Y +  + ++ F ID   G +      DREVI    + +   D+      + T +  I+V DVNDN P    I   V+     + T    IG +   D D   N +V+              +   L  S  + K   +++++  L+       +L++I+SD G+P++S
Sbjct:  627 ISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHI--------LSESSSFSINPVTGEVFAQKPLARGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSV-----------GAMSKVKYSIYSGDQDHN---FSIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSGE---SNQTQVVIFIEDHNDNPPQFSSSLVE-ISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPG------SSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRIT-NGSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDK-GVPPRSSTASARISVLDVNDNPPSCLSITPIVVPAGSPLST---AIGTIVAMDPDKGLNGSVL--------------YRAQLQSSLFVVKSNGDVYLRRQLNASDERHQRLSVIVSDQGVPRKS 1127          

HSP 5 Score: 92.4337 bits (228), Expect = 1.970e-18
Identity = 102/397 (25.69%), Postives = 172/397 (43.32%), Query Frame = 2
Query:  242 KYRLKEESDI--NTLIGNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLDFKGHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAP-ILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKV-------TCVLLKNDSNYLALDRSHNMKDEIIYRL 1402
            KY ++   DI     IG++   S+            Y IY+ D D N +  +  G + V + +D      +V       ++  + +   +  +V I IED NDN P+F +    I + E + +     +  A D+D +  G   Y++  S P  S+     F+  L     LD+E  + R + L + A D G P +     L I V D NDN P F+++     + E++P  +++    A D DS   G+I +     R T    YF ++   G +    S++ +++S   + + A D+ GV P SS     I V D N++ P  LS+     + +   SP    +G ++A D D   NG V       + + +   +  + L R  N  DE   RL
Sbjct:  745 KYEIRTTEDILPGIAIGSVGAMSK----------VKYSIYSGDQDHNFSIDEDTGKIYVTRYLDA-----DVHDTVLLNIQATLPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEID-QFTGQLSTGSLLDYE--ATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVY-----RITNGSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDK-GVPPRSSTASARISVLDVNDNPPSCLSI---TPIVVPAGSPLSTAIGTIVAMDPDKGLNGSVLYRAQLQSSLFVVKSNGDVYLRRQLNASDERHQRL 1114          

HSP 6 Score: 89.7373 bits (221), Expect = 1.102e-17
Identity = 127/522 (24.33%), Postives = 229/522 (43.87%), Query Frame = 2
Query: 1010 RTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGV-------GPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPP---HRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAET-NLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESGTYYL-KIQATDNGSPPRFSDVTIITVKISTAEKTN 2539
            R   N   F++N  TG            +S   LD EA  E+ +       G  +  C + + V D+N++ P L       L I E+S  G+ +    ASD D+  NGK +  LL++ S   +LD      D ++ RL +        L  + I +   D+G P     ++ ++ N +     + P  F    Y   I E +     + +++      T+S+   ++ +++  F +D ++G+++  +  DRE++ +Y + V  T   +       T V + V ++NDN P     K   + EN+++ +Y   +G    +D+DN         L  +       S  +   H F ID++   + + + LD E + ++ L I  +D      +N+   T+ V D NDN+P +    ++  YQ  V+  T +   P   ++A D+DA+    ++Y+              F +   +G +FM + L  +G  YL  + ATDNG  P FS    ++V I  AE T+
Sbjct: 1665 RFQGNAPKFSINSTTGS-----------ISVLPLDREASQEHLLIIILTDGGSRNDSCTVRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMDIGQNGKFSFELLEDSSG--SLDLVPETGDLVLRRLSS--------LQSWKIKLRVVDHGVPGLYVEKNLEISNRNPQTEAKAPLEFLKQTYLSTIDEGLPRGQFIAKLQPELAGLTYSI---VEGNIDSAFSVD-SEGVIRTNLELDREILERYSLKVIGTGSGQ----QIGTRVDVRVNNLNDNVPSFPMSKPRRVPENLRVGSYVATVG---AKDVDN---------LAPLRYFLVSDSSGQTPTH-FNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDGSFDTFTNL---TIFVSDINDNAPTF----SKPLYQTTVSPATFSPGQPFAKIEAHDLDAR--GALTYSLGQGS------SSIFRVAPESGALFM-KVLPPAGERYLVTVTATDNGV-PSFSTSVPVSVIIGEAEPTD 2127          

HSP 7 Score: 84.7297 bits (208), Expect = 4.047e-16
Identity = 109/461 (23.64%), Postives = 188/461 (40.78%), Query Frame = 2
Query:  236 VVKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLDFK-------GHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNL--EDSEPFFSLLYRPM---FSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAP---ILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLA--LDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSI 1567
            + K+ + E + I T IG I    + E    PK    + ++  +  S   K+D +        HL   KR   + +   V++  +              I + + ++D NDN P F  +  ++++SE   +G    L T  D D   F V  + +   +    F L  R +       LVV  +LD E      + L + A DGG P +  + +  IE+ D+NDN P+F +++    +  +  IGS +    A+DAD G   +I++ +      K     N NF   +  +IT+  + + +     +    ++G    SS   +TI V      +P   I+ L +  S  +MENS  G  V  V      +    + T + L   S       D++H      +Y L+   + DRE      +    +  G       QL   ++GDIN+  P ++ S   I
Sbjct:   26 LTKFTVPESAQIGTRIGWI--SGKREESAAPK---YFVVFPDEQTSKFLKVDERSGEISTIAHLDYEKRSKFDIVAVKVEESGET-------------IDILVEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQGNVNNVFKLASRKVNEQLQADLVVNGQLDRE--FRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDI-----KKTSAPSNSNFAISQSGVITTTASLLPASTHDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARV-----SIAQQYRDTKLRLIGSSALCPQQTDQAH------VYLLLLCGILDRETASEHHLKFLLEKDGQIIIEHPQLL--TIGDINDNAPQWHSSQIHI 448          

HSP 8 Score: 70.0922 bits (170), Expect = 1.105e-11
Identity = 48/158 (30.38%), Postives = 84/158 (53.16%), Query Frame = 2
Query: 2045 DKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESGTYYLKIQATDNGSPPRFSDVTIITVKI 2518
            ++ + +L V   LDRE  DKY+L I   D G P +      ++ + D NDN+P++    +++ Y  +V+A  ++   +I VQATD D  +NS ISY+       S      F I +++G I  +  L  + T+ + + A+D+GS P  S   ++T+ +
Sbjct:  179 EQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVF----SRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPS---NSNFAI-SQSGVITTTASLLPASTHDVIVVASDHGS-PSLSSSAVVTITV 327          

HSP 9 Score: 69.707 bits (169), Expect = 1.656e-11
Identity = 66/253 (26.09%), Postives = 109/253 (43.08%), Query Frame = 2
Query:  875 PIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRE-SLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKD 1630
            P F Q      + ES  IG+ I   +    +S       F + P   T    +  ++  +GE+  I  L+ +  SKF +     +E+G         + + V DEN++AP  S  D+   L I E +  G    +   +DGD         V+L+ + N +    S  + +++   LV     DRE  D + ++I  QD G P        ++ + D N+  P F  S Y+  +S +I I S LI ++A D D
Sbjct:   20 PTFCQCLTKFTVPESAQIGTRIGWISGKREESA--APKYFVVFPDEQTSK--FLKVDERSGEISTIAHLDYEKRSKFDIVAVKVEESG-----ETIDILVEVDDENDNAP--SFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDAD 261          

HSP 10 Score: 68.5514 bits (166), Expect = 3.090e-11
Identity = 95/368 (25.82%), Postives = 159/368 (43.21%), Query Frame = 2
Query:  713 PMFSL--TLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKF-IKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVL--ITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTI--RVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDK-------FQIDINKGILKNIVHFDREVIPKYIVPVFVTD 1774
            P FS+  T   +  L  +  + +   L +I  DGG+  + D   +++ V D NDN P  D +   +  I ES+ +G V+  F ASD D G  GK +F+LL   +       +L   TG+LVL  ++SL +  +   ++D      +GV     +  L I  R       AP+  L      TI E  P G+ +  +       E  G    ++  N      +D + ++  E + R  T    DRE+L+ +++ +     G    +     +V V ++N+  PSF  S     + E++ + S +  + A D D    L Y L   V+D        F ID   G +      D EV+P++ + +  TD
Sbjct: 1671 PKFSINSTTGSISVLPLDREASQEHLLIIILTDGGS--RNDSCTVRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMDIGQNGKFSFELLEDSSGS----LDLVPETGDLVLRRLSSLQSWKIKLRVVD------HGVPGLYVEKNLEISNRNPQTEAKAPLEFLKQTYLSTIDEGLPRGQFIAKL-----QPELAGLTYSIVEGN------IDSAFSVDSEGVIR--TNLELDREILERYSLKVIGTGSG---QQIGTRVDVRVNNLNDNVPSFPMSKPR-RVPENLRVGSYVATVGAKDVDNLAPLRYFL---VSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATD 2006          

HSP 11 Score: 60.8474 bits (146), Expect = 6.636e-9
Identity = 89/369 (24.12%), Postives = 154/369 (41.73%), Query Frame = 2
Query:  221 NFEANVVKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLDFKGHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFPDHWI--KVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRP-MFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDS--NDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNG 1312
             FE    ++ + E S I   IGN+  +   E+  + ++    KI++         +D  G L V   IDRE    +     + Q+E+         +  K  +I+ D NDN P F +    + + +S+A G ++    A D+D    G  SY +        +   P   S+ L        +   +  + + + A D G P +    K+Q+ +  S  + + P F        + E T +G+V+    AS+      G  N  LL +   +++    ++  TGEL L T L+ +      + +   D NG    S+   L I V+  +  AP+ +     +L I  ++PAGE VG + A D   ED G
Sbjct: 2130 GFEKAEFRFEVMENSKIGLQIGNLSGEESREFHYRIQDPEASKIFS---------IDKFGRLFVAGPIDREQRATH-----EFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSVGTVLQKIRASNR----LGMRNDGLLYS-LKEHQGKLGIDVKTGELTLKTHLDWESEPIISMYLSVSDGNG---RSAVVPLKIVVEPVDEFAPVFTKSSY-TLQIPISTPAGESVGQMQAID---EDGG 2472          

HSP 12 Score: 58.5362 bits (140), Expect = 4.203e-8
Identity = 95/384 (24.74%), Postives = 166/384 (43.23%), Query Frame = 2
Query:  521 IIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSL----TLVVLKKLDFENISHRYFNLTLI-ACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIV----SKFILDVEARDENGVGPFS-SQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMK---DEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQL-FNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKD 1630
            II E    +KP F   E R +V E+  +G Q+    + +E  E+     Y ++D E         +FS+     L V   +D E  +   F + +         VQC   K  + V D NDN P+F     Y  +K+S   G  I    ASD DSG  G++++++L            LN +TG + L    +A++     + + + VEARD       +  + Q+++++   +  AP   L   E + ++E++  G  +  + AS+           + ++ND    +L + H  K   D     L      D E     ++ +S  D GN   RS  +   + V  ++EF P F  S+Y++ I        ++ Q++A+D+D
Sbjct: 2119 IIGEAEPTDKPGFEKAEFRFEVMENSKIGLQIG-NLSGEESREFH----YRIQDPE------ASKIFSIDKFGRLFVAGPIDREQRATHEFQVEIDNEMMTSQKVQC---KCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLN---IVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYE-VHVLEDTSVGTVLQKIRASN----------RLGMRNDGLLYSL-KEHQGKLGIDVKTGELTLKTHLDWESEPIISMYLSVSD-GN--GRSAVVPLKIVVEPVDEFAPVFTKSSYTLQIPISTPAGESVGQMQAIDED 2470          

HSP 13 Score: 52.7582 bits (125), Expect = 2.243e-6
Identity = 82/319 (25.71%), Postives = 133/319 (41.69%), Query Frame = 2
Query:  335 NFTYKIYTTDIDSNLTKLDFKGHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDED----LEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKEST-PIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRV-QDENNHAPILSLGDRESLTIMENSPAGEHVG 1273
              TY I   +IDS  + +D +G +  N  +DRE L     K+        I        +V + + ++NDN P FP  + R +V E++ VG+ +    A D D    L YF V   + +    F        F+ T+ +   LDFE +      LT+ A DG      +   L I V+D NDN P F +      +  +T   G       A D D+   G + + L    ++     F +   +G L +     A    ++++ V A D NGV  FS+   +++ + + E    P     +     +MENS  G  +G
Sbjct: 1860 GLTYSIVEGNIDSAFS-VDSEGVIRTNLELDREILERYSLKVIGTGSGQQIGT------RVDVRVNNLNDNVPSFPMSKPR-RVPENLRVGSYVATVGAKDVDNLAPLRYFLVSDSSGQTPTHF----NIDQFTGTIHLTAPLDFEVLPEH--TLTIKATDGSFDTFTN---LTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLDA--RGALTYSLGQGSSS----IFRVAPESGALFMKVLPPAG--ERYLVTVTATD-NGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFR-FEVMENSKIGLQIG 2151          
BLAST of Protocadherin-1 vs. Ensembl Celegans
Match: cdh-3 (Cadherin-3 [Source:UniProtKB/Swiss-Prot;Acc:P34616])

HSP 1 Score: 90.1225 bits (222), Expect = 1.032e-17
Identity = 90/348 (25.86%), Postives = 161/348 (46.26%), Query Frame = 2
Query:  203 LWMHSYNFEANVVKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLDFKGHLL---VNKRIDREFLCPNVDKIDDCQLELMIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFG-VQSYNLEDS-------EPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIF---DQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAP 1204
            L+  ++ F    +K+ + E++ +NT+IG++          + +  +TY++   +     +K+ F    L   V+  +DRE          +  ++++I   P   I + I + D+NDN P FP   +R+++ E+  +G ++ +  A D D    G +  Y L DS        P F ++    F L L V  KLD E  +   +++ L A D G P       L I + D NDN P F     T N+  +  +      +F  NA+D DS     + +++LP+  T     F++   + E +L+T  N + + +    VEARD +GV P S+   + + ++  N H P
Sbjct:   20 LFNFTHQFSEETIKFSVSEDAKLNTIIGHL----------EAEIGYTYRLSRGN-----SKIKFDEQTLELSVSSPLDRE---------SENAIDMLIITSPPSIIHILIDVLDVNDNSPIFPIDVQRVEIPETAPIGWRVQISGATDPDEGKNGTIGKYELVDSLATVDTMSP-FGIVQSDGF-LFLEVTGKLDRE--TRDLYSMRLTAIDQGVPELSSSCHLNILILDINDNPPNFGIRSLTLNWNGLPNTK-----LFSLNATDLDSNENSLLTYRILPSGPTSE--MFSI---SDENILVTQNNTECLQRCEFVVEARD-SGVPPLSTTLNIVVNMEYGNEHEP 328          

HSP 2 Score: 79.337 bits (194), Expect = 1.668e-14
Identity = 65/212 (30.66%), Postives = 103/212 (48.58%), Query Frame = 2
Query: 1154 SQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEH---VGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPS--VNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTD 1774
            S  Q+ I V DEN+ AP    GD  +L ++E      +   +G  IA D D   NG VT  +L  +++  A++ +          +++    DRE      ++I  +D G P   +     + VGDIN+  P F  S+Y I ISE+ +I S +I+I A DKDK   L Y L+ +  +   F+I++  G +      +RE   ++   V VTD
Sbjct: 1630 STSQVIIHVTDENDEAPRFITGDVVNLKVLEELDTVSYPLIIGSSIAEDLDEGQNGLVTYSILSGNTSLFAVNSTTG-------DILSLIPLDREESSLHELLIEAKDAGIPSLSATSKILIHVGDINDNTPEFELSSYFIKISENSKIGSKIIRILATDKDKDAELQYSLESNDEITIPFRINVATGWITVAGKVNREENEEFRFFVKVTD 1834          

HSP 3 Score: 65.855 bits (159), Expect = 2.063e-10
Identity = 173/740 (23.38%), Postives = 298/740 (40.27%), Query Frame = 2
Query:  512 KVFIIIEDINDNKPKFPTKEK-RIKVSESI-AVGNQLPLQTAMDEDLEYF--GVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRES-LTIMENSPAGEHVGMVIASDGDLED---------------NGKVTC-----------VLLKNDSNYLA----LDRSHNMKDEIIY----RLVTTRVFDRELLDYF---------TIMISCQDY----------------------------------GNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALI-QIKALDKDKTHSLNYHL-DPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESGTYYLKIQATDNGSP 2479
            +V I + D ND  P+F T +   +KV E +  V   L + +++ EDL+    G+ +Y++       SL      +  ++ L  LD E  S     L + A D G P      K+ I V D NDN P F+ +  +  I E++ IGS I    A+D D     ++ + L      +  + F +N  TG + +   +N +   +F   V+  D    G  SS+  + I V+D N++ P+++  DR S + + + + + E + ++   D D  D               NG++T            V + +D+ ++A    L   H+ K   ++      V+ R  D + L  F         +I+  C D+                                   N P  +     + + DIN+  P F    Y   ++E+      LI  + A D D++  + Y +     N +F +    G ++++   DRE   +Y + V   D  +     G TTV +TV D +DN P  + I    + E+V+I   G  + +L   D D   N     D     +              F +D+    +FV  SLD E+   Y++ + ++D      +++    V V+D NDN+PI+         + N +AE    H      A+D+D++ N  I Y+  +          YF I    G +   R         LK+ ATD+G P
Sbjct: 1633 QVIIHVTDENDEAPRFITGDVVNLKVLEELDTVSYPLIIGSSIAEDLDEGQNGLVTYSILSGNT--SLFAVNSTTGDILSLIPLDREESS--LHELLIEAKDAGIPSLSATSKILIHVGDINDNTPEFELSSYFIKISENSKIGSKIIRILATDKDKD--AELQYSL--ESNDEITIPFRINVATGWITVAGKVNREENEEFRFFVKVTD----GEKSSKVIVEIHVEDFNDNHPMIN--DRNSDIFVPDPTRSVEIIHVINVHDLDKSDHLKFSLNNSNLNLSENGEITLKSPLQTAVPVRVTVSDDAGHVAFMEYLFHPHSRKHFPVFVEKLDTVSVREHDEQELAVFKANGDSIRYSIVSRCSDHLEMEKSTGILKTKSSLDAEEYSECLVFIIATTYFDNKPLSTITKATIKIVDINDNSPRFDQQLYRFNVTEN--SGPKLIGHVIARDIDRSSRVFYEIVGGDANHEFMV-TESGQIESVRDLDRETKSEYHLIVEAIDDGK-PRRRGNTTVIVTVLDEDDNAPRFSRIFHVEVPEDVRI---GEPVIQLSASDADEHSNHRFELDGGGEGI-------------PFRVDENTGMVFVNDSLDFEKKQSYRIKVKLTDGAWLIETSL---FVNVKDVNDNAPIFEKPEYLFISEEN-SAEIGQFH------ASDMDSENNGKIRYSVTS---------PYFKIEPSTGVLSRFRQQLPQPLMSLKVTATDHGVP 2319          

HSP 4 Score: 56.6102 bits (135), Expect = 1.460e-7
Identity = 86/328 (26.22%), Postives = 134/328 (40.85%), Query Frame = 2
Query:  719 FSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIF--DQTQNYKFIKE----STP--IGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGD--------LEDNGKVTCVLLKN-DSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNY 1651
            F  T+     LDFENI    FN+T     G +  Q     + I VTD ND  P F      N K ++E    S P  IGS I    A D D G  G + + +L   T+     F +N  TG+++ +  L+ +  S   L +EA+D  G+   S+  ++ I V D N++ P   L     + I ENS  G  +  ++A+D D        LE N ++T     N  + ++ +    N ++   +R    +V D E                    S  +  + V D N+  P     N  IF+ +       +  I   D DK+  L +
Sbjct: 1603 FDGTIFTNSPLDFENIKTYRFNITA----GKSTSQ-----VIIHVTDENDEAPRFITGDVVNLKVLEELDTVSYPLIIGSSI----AEDLDEGQNGLVTYSILSGNTS----LFAVNSTTGDILSLIPLDREESSLHELLIEAKDA-GIPSLSATSKILIHVGDINDNTPEFELSSY-FIKISENSKIGSKIIRILATDKDKDAELQYSLESNDEITIPFRINVATGWITVAGKVNREENEEFRFFV-KVTDGE------------------KSSKVIVEIHVEDFNDNHPMINDRNSDIFVPDPTRSVEIIHVINVHDLDKSDHLKF 1892          

HSP 5 Score: 55.0694 bits (131), Expect = 4.080e-7
Identity = 48/171 (28.07%), Postives = 87/171 (50.88%), Query Frame = 2
Query:  863 NDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVY---FNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDR 1366
            N ++PI   T+ +  + E+ PIG++     A D DSGL G +++K+L    TK+  Y   F+L+  +G L  + + +A+    +  + EA+D  G    ++ C  TI ++D N++ P    G R   T   +  + E V +V A+D D++   +     L N  ++  LD+
Sbjct:  627 NQHSPICQITEIH--VLENAPIGTIFGRIQARDEDSGLSGVVSYKIL----TKSDDYDGIFHLDSTSGSLRSLKAFDAEKKRSYTFEYEAKDL-GTPSKTTNCPATIFIEDVNDNVP--KFGSR-YYTATISGKSNETVAIVQANDNDVDVKNQKLQYHLLNYHDFFQLDK 787          

HSP 6 Score: 52.7582 bits (125), Expect = 2.199e-6
Identity = 50/188 (26.60%), Postives = 82/188 (43.62%), Query Frame = 2
Query: 1166 LTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNY---LALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKD-KTHSLNYHLDPSVNDKFQIDINKGILKNI 1717
            +T+ V+  N H+PI  + +   + ++EN+P G   G + A D D   +G V+  +L    +Y     LD +          L + + FD E    +T     +D G P   +     + + D+N+  P F    Y+  IS       A++Q    D D K   L YHL  + +D FQ+D   G +  I
Sbjct:  619 ITLIVKPLNQHSPICQITE---IHVLENAPIGTIFGRIQARDEDSGLSGVVSYKILTKSDDYDGIFHLDSTSG-------SLRSLKAFDAEKKRSYTFEYEAKDLGTPSKTTNCPATIFIEDVNDNVPKFGSRYYTATISGKSNETVAIVQANDNDVDVKNQKLQYHL-LNYHDFFQLDKETGKVTTI 795          
BLAST of Protocadherin-1 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0078045)

HSP 1 Score: 182.57 bits (462), Expect = 7.260e-46
Identity = 198/770 (25.71%), Postives = 337/770 (43.77%), Query Frame = 2
Query:  224 FEANVVKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLDFKGHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNL--EDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPA---------RTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIF-ISEDIEINSALIQIKALDKDK------THSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGEL----QTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVE--DENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESGTYYLKIQA 2461
            FE     Y +KE+    T++G++   S     R P     Y IY+ D D   +     G++ + K +D E     +  I     E  ++       +V I +ED+NDN P+F     RI V ES  +G  L    A D+D    G  +Y+L  E  +  F++  R   S  L++ + LD+E+ S R+  L + A DGG P       + ++V D NDN P+F++ +    + ES  I + I   NASD D+G   +I ++++ A          ++    +F +  N+G + L   L+ +   ++ L V A D NG     ++ ++ +RV D N++ P       E   I EN   G  VG+V ASD DL +N  +   LL  +S++    + H +  EI  R       DREL + + +++  +D G P   +     + V D+N+  P        +  + E+    + +++++A+D+D       T+S+    D   +  F ID   G+++  V  D E    Y + V  +D       T        +   ++     +    F +RE+  +   G+++G +    +  D+  +       DL   + L N ++   L+  +F+ID++  NL V   LDRE   +++L I   D           ITV +E  D NDN+P W     Q    + V+  T +   I    ATD D   N ++ Y  +          +YF  L  +    MS    +S T  L +QA
Sbjct:  827 FEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSP---VRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGH----TQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDAR---SGHLILSQHLDYES-SQRH-TLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATD-NGTPAAHAKTRVIVRVLDANDNDPKFQKSKYE-FRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSF----QVHPVTGEISTR----EPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAAL---GHVVGSISPIERPADVVRNSVEESFEDLRVTYTL-NPLTK-DLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEW----PQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLI----------RYFPQLNESQEQAMSLFRMDSLTGALSLQA 1555          

HSP 2 Score: 166.777 bits (421), Expect = 5.581e-41
Identity = 190/701 (27.10%), Postives = 301/701 (42.94%), Query Frame = 2
Query:  533 DINDNKPKFPTKEKRIKVSESIAVGNQL----PLQTAMD-------EDLEYFGVQSYNLEDSEPFFSLLYRPMF-----SLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKL------LPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQ--DENNHAPIL-----SLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNP-PHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQI--KALDKDKTHSLNYHLDPSV-NDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILT-----------YG---------NLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPK-RSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESGTYYLKIQATDNG 2473
            D+NDN+P F +     +V E  A+G+ +    P++   D       E  E   V +Y L    P    L    F     S  LVV + LD E  S     +  +        Q     ++IEV D NDN P + Q      + E+TP+G++I  F A+DAD+G  G + ++L      L     +    F ++  TG L L   L+ + V +++L V+A D++       Q  +T+R++  D N+HAP       S G   SL I + +  GE V  ++A D D  DNG++T  +   +        S     E++  L      D E    F ++I  +D+G P P +S    ++ V   +  PP F  + Y   I E++   S ++Q+  K+L   +  +L+Y +   V ND F +D  +GI+     FDRE    Y++PV+V D  R + L+ +       +D   +T          I   V  +            YG          +I  +   DLD   NA ++  +   + L N  S          ID     L  +  LDREQ  +Y L I  SD G PK R     IT+ VED+NDN+P ++     + Y  +V  +  L   ++ + A D D   N+ + Y+  N        +    ++T  G   + R+LQ S  Y   + ATD G
Sbjct: 1357 DLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRV-TYTLN---PLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPA-TEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVVASDLDEGPNADLIYSITGGN-LGNKFS----------IDSSSGELSAR-PLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKL----SKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGK--LDRELQAS--YNFMVLATDGG 2032          

HSP 3 Score: 158.688 bits (400), Expect = 1.381e-38
Identity = 170/675 (25.19%), Postives = 295/675 (43.70%), Query Frame = 2
Query:  509 IKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDS---EPFFSLLYRP---MFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAP---ILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPP-HRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKT--HSLNYHL--DPSVNDK-FQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNH-PIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR----DLQESGTYYLKIQATDNG 2473
            I+V + ++D NDN P FP     I+  E+     +  L  A D DLE +  Q YN+      + F    +R    +  L L +   LD E      ++L + A DGGTP       + I + D NDN PIF+Q++ +  + E+  +G+ +    ASD D+   G + + +   ++ K ++ F ++  TG + +  +L+ +      L V A+D +G  P  +   ++IRV D N++ P   ++ L D  S  I E++  GE V  +   D D +       V L     + AL      +D  IY ++     DRE++  +T+ +   D G PP H S  +F + + D+N+ PP F    Y   + E  +  ++++Q+ A D+D+    +L Y L   P  + + FQID   G++    H D E  P   + V   D     + +  T +       ++            + EN  +   G  I ++   D D   NA V     ++     H++        FE+      + +   LD E+   Y+  ++ +D G    S   +I + + D NDN P++  +  + + + +  A +  +  PI+ V ATD D      +SY  V  +   +     F I    G IF+ R     ++    + L I ATD G
Sbjct:  158 IRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPG--YSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQM-FRIDPRTGAIYINKALDFETKELHELVVVAKD-HGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFAL----TTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIF-LRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPV---GRCILKVSASDPDCGVNAMVN---YTIGEGFKHLT-------EFEVRSASGEICIAGELDFERRSSYEFPVLATDRG--GLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGI-----FRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGG 803          

HSP 4 Score: 154.451 bits (389), Expect = 3.080e-37
Identity = 167/682 (24.49%), Postives = 290/682 (42.52%), Query Frame = 2
Query:  527 IEDINDNKPKFPTKEKRIKVSESIAVGNQL---PLQTAMDEDLEY--FGVQSYNL-EDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYL-ALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKA--LDKDKTHSLNYHL-------------DPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSP-IWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFV---NNDVNSLWYEKYFTILTRNGGIFMSR---DLQESGTYYLKIQATDNGSPPR 2485
            + D+NDN+P F  +E ++ + ES    +Q    P+   +  D +Y  FG  SY +   +E     + R    + +V    L          N++  A DGG         + + + D+    PIF++ +   ++KE  P G+V+    A+  D      + + +    +     YF++  N+G + +   L+ +  S+ +L+++A    G  P     Q+ I V+D N++AP         +++ E++  G  +    A D D   +G+VT  L+K     L A+D            L+ ++  D E     T++++  D G P   +     V V D+N+ PP F    YS+ +SE   IN+ +IQ+ A  LD      + Y +                V+  F I  N G +      DRE   +Y + V  TD         T  +   +   +++        +F I EN   L  G+++G +   DLD   NA +   LL +             N SF++      +  +  LDRE  + Y L +   D G P RS    + + V D NDN+P I   Q +     V+V  E      ++ V+A D D  +N++I+Y+ V   ++D + L+       +    G+  +R   D +E   Y L + A+D G+PPR
Sbjct:  705 LTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNIS--ATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIY---SGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQA--TLGEPPVYGHTQVNIEVEDVNDNAPEFE-ASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSG-------HLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEEN---LRRGSVVGVVTASDLDLGENAAIRYSLLPI-------------NSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQED----VVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFS------IDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPR 1345          

HSP 5 Score: 152.14 bits (383), Expect = 1.405e-36
Identity = 172/726 (23.69%), Postives = 303/726 (41.74%), Query Frame = 2
Query:  497 PDHWIK-VFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYR--PMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEH------VGMVIASDGDLEDNGKVTC-VLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLN-----YHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIV---------PVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVN-------NDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTIITVKISTAEKTNYLIKNSQISFTL 2575
            P H  K +F+ I D+NDN P+F        V E    G  +    A D D       +Y+L ++    +  ++  P   L +     +D E  +     LT++A DGG P       + + + D NDN PIFDQ+     + E+ P+G  I   +ASD D G+   +N+ +      K+   F +   +GE+ +   L+ +  S +   V A D  G    S+   + +++ D N++ P+     RE    +  SP          +  V+A+D D  + G+V+  ++  N++    +DRS      +   +++ R     +L+     IS  D GN    +  +  +S+ D  + PP F  + Y+ ++ EDI   + +  + A   D  H        Y  DP  +  F I+ N G ++     D E   + ++         PV+   QV   +                       + +  + E+ ++   G  +      D D+  +  V   L+         S   L    F ID    +L +   LD E   ++ L +  +D G+P  S    I V V+D NDN P++     +  Y VNV+   ++N  II V A+D+D   N+ I+Y  V+       N ++S    ++F I   +G I++    D +    Y L + ATDNG+P   +   +I V++  A   +   + S+  F +
Sbjct:  483 PLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGL-ITTRSHIDCE--TEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTI--GEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGG---LSTTAMIKMQLTDVNDNRPVFY--PREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLN-----ISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDP--DGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFE----------ASMVRISVPESAEL---GAPLYAAHAHDKDSGSSGQVTYSLVK-------ESGKGL----FAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFE----KDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVI-VRVLDANDNDPKFQKSKYEFRI 1162          

HSP 6 Score: 133.65 bits (335), Expect = 6.883e-31
Identity = 181/690 (26.23%), Postives = 307/690 (44.49%), Query Frame = 2
Query:  515 VFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKES---------TPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITS--LNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSN-YLALD-RSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHS--LNYHL-DPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFV-IRE----NVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHV--LSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPII--LVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFT--ILTRNGGIFMSRDLQESGTYYLKIQATDNGSPPRFSDVTI 2503
            V + I D+NDN+P F      + V+E+  VG  +   +A D D     + +Y + +     +       S  + +  +LDFE  S   +   ++A D G        K+Q+  TD NDN P+F   +    ++ES         TPI +V+    A+D D G FG+++++++          F ++ +TGE+ ++    L+ +     +L++ A D  G    ++   + + + D     PI     R +  + E+ P G  VG VIA+ GD+     V   +   D + Y +++  S N++          +  D E      + I     G PP       N+ V D+N+  P F  S   I + E  E+ + L    A DKD   S  + Y L   S    F ID   G L    H D E   ++ + V  TD      L+   T+ + V DVNDN PV    +  V + E    N QI+       ++   DLD   NA +   ++   V  ++N +S   +  H F I      +++++ LDRE  D+Y+L ++ +D G P       + V V D NDN P  ++Q ++  +++    E NL    +  +V A+D+D  +N+ I Y+ +   +NS +     T  I TR     + R+L+E   Y L ++A D G+P R + V +
Sbjct:  597 VLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSS--YEFPVLATDRGGLSTTAMIKMQL--TDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVV----ATDPDYGNFGQVSYRIVAGNEAG---IFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATD-GGNLRSNADAVVFLSIIDAMQRPPIFEKA-RYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIR--------IAKPLDHEAKSQVLLNIQAT-LGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDG-GVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQII-------QVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQH-FGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDP--KFQKSKYEFRI----EENLRRGSVVGVVTASDLDLGENAAIRYSLL--PINSSFQVHPVTGEISTREP---LDRELRE--LYDLVVEARDQGTPVRSARVPV 1242          

HSP 7 Score: 126.331 bits (316), Expect = 1.092e-28
Identity = 216/854 (25.29%), Postives = 349/854 (40.87%), Query Frame = 2
Query:  224 FEANVVKYRLKEESDINTLIGNI---------FEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLD-FKGHLLVNKRIDREFLCPNVDKIDDCQLELMIHAF--------PDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNL--------EDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVT------DSNDNNPIFDQTQNYK------FIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSL-----NAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVL---LKNDSNYLALDRSHNMKDEIIYRLVTTRV-FDRELLDYFTIMI-----------------------SCQDYGNPPHRSFQLFNVSVGDINEFPPSFY-HSNYSIFISEDIEINSALIQIKA-LDKDKTHSLNYHL-DPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIK-QFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLG-IPKRSNMEIITVMVEDENDNSPIW-RYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDL-QESGT-YYLKIQATDNGSPPRFSDVTIITVKISTAEKTNYLIK 2551
            F ++ + +R++E++ +  ++G+I           +S  E     +  +T    T D+      +D   G+L+V + +DRE            +  L I A             I V I + D+NDN P++P     ++VSE+  VG  +   TA D D    G   Y L        E  E   SL      +  L +   LDFE +    + L + A D  + V    ++LQ  VT      D+ND+ P F    +        FI ++T IG V+    A D DSG  G++ +++        +  F +N  TG + L+ SL     + +   +F L + A+D     P  S   L + VQ  +N+ P   L      TI+EN P+G  V  V A      +N  ++  +   + ND  ++   R           ++TTR  FDRE    + + +                       S  D  N  H       ++VGD+N+  P F   S Y + + E+ E       + + LD+     L Y +   ++ +KF ID + G L +    DRE   +Y + +  +D+ +     G   + I V D NDN P     K    ++E+  +   G  + ++   D D   NA +      V+ L+N   W       F ID     +     LDRE    Y   ++ +D G    RS    + + V D NDN PI+ RY      Y   V A       ++ VQA D D   N+ I Y+   N  NS    K F I    G +  S+ L  ESG   +L++ A D G+PP+ S + +I + I  A +   +++
Sbjct: 1365 FTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREV---------QSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQE--YLLIVQALDQSSNV---TERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGG---NGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRF-LQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRG----------IITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGEL-SARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPL---GTSVVQISAVDADLGVNARL------VYSLANETQW------QFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERY-----PYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSL--NAENSAVSAK-FRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQ-SSLGLIELLIGEAPQGTPVLR 2165          

HSP 8 Score: 123.635 bits (309), Expect = 8.096e-28
Identity = 181/744 (24.33%), Postives = 305/744 (40.99%), Query Frame = 2
Query:  515 VFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPF-FSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGT-PVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPI---GSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIM--ENSPAGEHVGMVIASDGDLEDNGKVTCVLLK----NDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDY---FTIMISCQDYGNPPH-------------------------RSFQLFN---------------------------VSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHS--LNYHL-DPSVNDKFQIDIN-KGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIR-----ENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHM---SWIRLLNHS-FEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQV-----NVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNG--GIFMSR---DLQESGTYYLKIQATDNGSP 2479
            + I +ED NDN P+F   +    V E   +G  +   +A+D DL       Y+L +   + F++  +   S  +  + KLD E      +N  ++A DGG   V+     +QI V D NDN PIF++   Y +I +   +   G  +    A DAD G   +I + L  A  +     F +N +TG L    SL ++      L+V ARD+ G  P SS   + + + +     P+L   + E+  +M  ENSP+G  +  V+A    L  +G+   V       N+   L+LD   ++  EI       RV    LLDY    T  +S    G   H                          SF L N                           + + D N+  P F    +   +SE     + + Q+ A D D   +  L YH+ D + ++ F I+    GI++  +  DRE+   Y + +  TD+                       P MTG     ++     +N       NL+   +  +L     +    D+ +   L+  +   S + + N S F +D+Y   L +K  LD E   +Y+L++I SD     R+   ++TV V DENDN+P++  Q     + +      ++   +++  ++ V ATD D++ N++     +         ++ F++   NG   + MSR    +  SG Y+++I A D G P
Sbjct: 1938 ITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQ---SGLITTVGKLDRE--LQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFER---YPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSL-NAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDK-GNPPQSSLGLIELLIGEAPQGTPVLRFQN-ETYRVMLKENSPSGTRLLQVVA----LRSDGRRQKVQFSFGAGNEDGILSLD---SLSGEI-------RVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDE---------------------GVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEART---VLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIE------PAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKP 2626          

HSP 9 Score: 96.2857 bits (238), Expect = 1.560e-19
Identity = 104/389 (26.74%), Postives = 169/389 (43.44%), Query Frame = 2
Query:  506 WIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTT--KNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPI-LSLGDRESLTIMENSPAGEHVG----------MVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIK--ALDK 1627
            + ++ I +ED NDN PKF  K+    VSE    G  +    A D D        Y++ D     + +  P FS  +     LD E      + L +IA D G P       +++++ D NDN P F    N   + E+T +G+VI   +A+D D+  +  + ++L    T   +N   F L+  +G+LVL   L+ ++  ++ LDV A D        ++  LT+RV DEN++AP+ L+        I+   PA   +            V A+D D E N      +++      ++  S+ +    + RL           DYF + I  +D G P  +S  L  V   D       F  + Y   ISE   + S ++Q+   ALD+
Sbjct: 2305 YAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDRE--IRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTF-PPNNLVTVSEATELGAVITSISANDVDT--YPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASD----AAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAIL---PAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSG---DYF-VRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQ 2677          

HSP 10 Score: 86.6557 bits (213), Expect = 1.509e-16
Identity = 169/699 (24.18%), Postives = 276/699 (39.48%), Query Frame = 2
Query:  506 WIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNL----EDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNP----IFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLIT------------SLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKND---SNYLALDRSHNMKDEIIYRLVTTRV-FDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKD--KTHSLNYHLDPSVN--DKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFV-IRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFV--KSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTI 2503
            ++ V I I+D+NDN+P F        V E+  VG  +    A D D +  G+  Y +     D E  F +  R   +  + + K LDFE  +     L ++A D G         + I VTD NDN P    IF        I ES   G  +   +  D DS             +T    V   LN   G   L T             L+ +IVS + L V A D+ G  P  +   + +R+ D N++ P     D     +ME +  G  V  V+A D D   N  +T  L +     + +  +D            L+TTR   D E      + +  +D G PP  S     V++ D+N+  P F  S Y++ ++E+  +   ++++ A D D      +NY +        +F++    G +      D E    Y  PV  TD+     L+ T  + + +TDVNDN PV    +  V +RE+ +  +  +    +     D  Y        +S  +++ + + I      F ID+    +FV     L       + LNI  +D G  + +   ++ + + D     PI+     +  Y   V  +      +  V A   D    S + Y+  + D +      YF+I T +G I +++  D +      L IQAT  G PP +    +
Sbjct:  269 FMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPR---TGAIYINKALDFE--TKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDS-------------KTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDK-GTPPLHASKSIFLRITDVNDNPPEFEQ-DLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTG--------LITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDR---GGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGN---FGQVSYRIVAGNEAGI------FRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFE----KARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDG-----YFSIETNSGNIRIAKPLDHEAKSQVLLNIQAT-LGEPPVYGHTQV 917          

HSP 11 Score: 83.5741 bits (205), Expect = 1.086e-15
Identity = 81/298 (27.18%), Postives = 137/298 (45.97%), Query Frame = 2
Query:  515 VFIIIEDINDNKPKFPTKEK-RIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLY---RPMFSLTLV-----VLKKLDFENISHRYFNLTLIACDG--GTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSS-----QCQLTIRVQDENNHAPILSLGDRESLTIMENS---PAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNY 1351
            V I I D NDN P F    K   ++SE   +   +    A+D D E       N  +SE  + +       MF++ LV     V  +LD+++ +  Y  L + ACD     P+ C  Q  ++E+ D NDN P F  T+   F+ E+ P+GS +F  +ASD D G FG++N+ + PA + +         ++ ++  + S +  + S F+ D E R    +   +S     +  + +RV+ E+         +R    ++  +   P G  VG V A+D D   +G+V   L    S++
Sbjct: 2738 VIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQE-------NTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSY-ELIIRACDSHHQRPL-CSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDE---------SSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPHSHF 3017          

HSP 12 Score: 75.0998 bits (183), Expect = 4.426e-13
Identity = 92/387 (23.77%), Postives = 162/387 (41.86%), Query Frame = 2
Query:  515 VFIIIEDINDNKPKF-PTKEKRIKVSESIAVGNQLPLQTAMDEDLE-------YFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQ-KLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPA----GEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPP--SFYHSNYSIFISEDIEINSALIQIKALDKD 1630
            ++I + D+NDN P+F P     + V E+   G    + T +  DL+        + +   NL +    FS+      S   +  + LD E   H  + L + A D G P        + I V D NDN P F  ++    ++E  P+G+ +   +A DAD G    +N +L+ +   + +  F ++  +G +  +  L+ ++ + +   V A D       S+   + I V D N++ PI      E    +   PA    G+ +  V A D DL  N ++   L   +S   A  R +         L  ++    E      + +  +D GNPP  S  L  + +G+  +  P   F +  Y + + E+    + L+Q+ AL  D
Sbjct: 1833 IYITVGDVNDNSPEFRPGSCYGLSVPENSEPGV---IHTVVASDLDEGPNADLIYSITGGNLGNK---FSI----DSSSGELSARPLDREQ--HSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLG----VNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIF-----ERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGA----LSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSD 2194          

HSP 13 Score: 74.3294 bits (181), Expect = 7.036e-13
Identity = 137/613 (22.35%), Postives = 240/613 (39.15%), Query Frame = 2
Query:  785 LTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARD---------ENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDN-----GKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIF---------ISEDIEINSALIQIKALDKDK---THSLNYHLDPSVNDKFQIDINKGILK-NIVHFDREVIPK--YIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATV--------VCDLLSVHVLSNHMSWIRLLNHS-FEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNME--------IITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAK--KNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQ-ESG--TYYLKIQATDN 2470
            + L+A     P      +L IE+ D NDN+P F Q Q    + E    G+ +   +A D+D+G   ++ + ++               +    V+  + +  + +  +LD E RD         + GV   +    + +++ D N++ P     +   +T+ E +  G  +  + A+D D         G  + V ++N S + ALDR          +LV  R  D EL   + + +   D     H +  +  V V D N+  P F       +         ISE + ++  L+ + A D D       + Y ++P+  + F +  + G++  N+      V     Y V +   D  +                               ++ +  +    N  G  ++Q L N Y A +        V   L    L   ++ I     S FE+ + K  + VK  LDRE+ D YKL +++S    P   +          IIT++  D NDN PI+   +    Y+  ++    L + I  +QA D D +   NS + Y     D+ S   E  FTI    G +F++  L  +SG  +Y L I+A D+
Sbjct: 2290 VVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGN------------HDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL--VTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIF-ALDRYSG-------KLVLKRRLDYELQQEYELDVIASDAA---HEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPA-QEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKP-----------------------------ALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNEESAFELLQSKAIVLVKP-LDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITIL--DANDNFPIF---DRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVY-----DITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDS 2836          

HSP 14 Score: 67.3958 bits (163), Expect = 1.024e-10
Identity = 62/227 (27.31%), Postives = 111/227 (48.90%), Query Frame = 2
Query: 1064 VLITSLNAKIVSKFILDVEARDENGVG--PFSSQ-CQLTIRVQDENNHAPILSLGDRESLTIM--ENSPAGEHVGMVIASDGDLED-NGKVTCVLLKNDSNYLALDRSHNMKDEIIY-RLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHS--LNYHLDPSVNDK---FQIDINKGIL 1708
            + I     +I +K  LD E R    +   P S +  ++ + V+DEN++AP      + S+ I   EN+P      ++ A D DLE  N +   ++  N ++   L  SH  +D ++Y  L  +   DRE    ++++I   D G PP R F   N+++ D+N+  P F  S Y   + E+  + ++++Q+ A D D   +  + Y ++   +DK   F+ID   G +
Sbjct:  123 LAIDRATGEIRTKVKLDRETRASYSLVAIPLSGRNIRVLVTVKDENDNAPTFP---QTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLS-SHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAI 345          

HSP 15 Score: 60.077 bits (144), Expect = 1.487e-8
Identity = 158/683 (23.13%), Postives = 280/683 (41.00%), Query Frame = 2
Query:  509 IKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDED----LEY-FGVQS-YNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKF---------IKESTPIGSVIFIFNASDADS-GLFGKINFKLLPARTTKNKVYFNLNFNTGEL-VLITSLNAKIVSK--FILDVEARDENGVGPFSSQCQLTIRVQ-DENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFN------VSVGDINEFPPSFYHS-NYSIFISEDIEINSALIQIKALDKDKTHSLNYHLD---PSVNDK--FQIDINKGIL--KNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIG----ELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIIL--VQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESG 2437
            I+V I+  D+NDN+P FP     + VSE+  +G  +   +A D D    L Y  G +S  ++E+     S+     +S  LV+ ++LD+E    + + L +IA D        +  L + V D NDN P+F   Q   +         I ES  +   +   NA+DADS G   K+ + + PA+       F+++ + G + V ++ L   + S   + + + A+D    G  + +    +RVQ ++N       L ++    I E +P G    +V+    D  D  +   ++  N+ +   L +S          +V  +  DRE  D + + +       PP  S    +      +++ D N+  P F  S  Y   ISE   +  ++ Q++A+D D+ ++ N  +     S ND+  F ID+  G+L   N + +D      Y + +   D      L       + + D NDN P      +F + E V  L     +G         DLD      +   +      S+  SW       F +D     +      D EQ  +Y + ++ SD+G  K S    + V +E  ++ +P    Q  +  Y+  + A   L    ++  V ATD D+  +  + Y              +F +   +G + + R L+  G
Sbjct: 2414 IRVQIV--DVNDNQPTFPPN-NLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIEN----MSIFALDRYSGKLVLKRRLDYE--LQQEYELDVIASDA---AHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEG-----FSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKD---AGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGS---VVLQLGQDALD--QSLAIIAGNEESAFELLQSK--------AIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGA-KSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEP------KFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAP--SDESSW-----KMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKKASVA--VRVEIESRDEFTP----QFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLS-------APHSHFKVNRSSGAVLIKRKLKLDG 3036          

HSP 16 Score: 56.6102 bits (135), Expect = 1.924e-7
Identity = 43/170 (25.29%), Postives = 74/170 (43.53%), Query Frame = 2
Query: 2018 RLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTIITVKIS 2521
            RL +H         +L +   LDRE    Y L I   D G P       + + ++D NDN PI+    NQ+ Y   V     +   ++ V A+D DA +N  + Y       +    E+ F I  R G I++++  D +    + L + A D+G  P       ++++++
Sbjct:  223 RLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIF----NQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDK---EQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQP-LETTAFVSIRVT 384          

HSP 17 Score: 53.1434 bits (126), Expect = 2.288e-6
Identity = 49/169 (28.99%), Postives = 77/169 (45.56%), Query Frame = 2
Query: 2036 FEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESG--------TYYLKIQATDNGSPPRFSDVTI-ITVK 2515
              ID+    +  K  LDRE    Y L      + IP       + V V+DENDN+P +     QT+  +     T       L+ A D+D +  +   YN V+ +VN  +  +  +   R+G +++  DLQ SG         Y L I+A D G+PP    +T+ IT++
Sbjct:  123 LAIDRATGEIRTKVKLDRETRASYSL------VAIPLSGRNIRVLVTVKDENDNAPTF----PQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAF--RLSSHRERDGVLYL--DLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQ 277          

HSP 18 Score: 51.6026 bits (122), Expect = 6.284e-6
Identity = 39/152 (25.66%), Postives = 67/152 (44.08%), Query Frame = 2
Query: 2063 LFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNN-DVNSLWYEKYFTILTRNGGIFMSR---DLQESGTYYLKIQATDNGSPPRFSDVTII 2506
            + V   LDRE +  Y L+++ +D G P     + I + + D NDN P +     Q  Y  NV    +    ++ V A D D   NS ++Y+     + ++ W++     +    G+  +R   D +      L + A D G PP  S  T++
Sbjct:  456 VIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFE----QDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQ-----IDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVL 598          
BLAST of Protocadherin-1 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0343249)

HSP 1 Score: 182.57 bits (462), Expect = 7.260e-46
Identity = 198/770 (25.71%), Postives = 337/770 (43.77%), Query Frame = 2
Query:  224 FEANVVKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLDFKGHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNL--EDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPA---------RTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIF-ISEDIEINSALIQIKALDKDK------THSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGEL----QTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVE--DENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESGTYYLKIQA 2461
            FE     Y +KE+    T++G++   S     R P     Y IY+ D D   +     G++ + K +D E     +  I     E  ++       +V I +ED+NDN P+F     RI V ES  +G  L    A D+D    G  +Y+L  E  +  F++  R   S  L++ + LD+E+ S R+  L + A DGG P       + ++V D NDN P+F++ +    + ES  I + I   NASD D+G   +I ++++ A          ++    +F +  N+G + L   L+ +   ++ L V A D NG     ++ ++ +RV D N++ P       E   I EN   G  VG+V ASD DL +N  +   LL  +S++    + H +  EI  R       DREL + + +++  +D G P   +     + V D+N+  P        +  + E+    + +++++A+D+D       T+S+    D   +  F ID   G+++  V  D E    Y + V  +D       T        +   ++     +    F +RE+  +   G+++G +    +  D+  +       DL   + L N ++   L+  +F+ID++  NL V   LDRE   +++L I   D           ITV +E  D NDN+P W     Q    + V+  T +   I    ATD D   N ++ Y  +          +YF  L  +    MS    +S T  L +QA
Sbjct:  827 FEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSP---VRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGH----TQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDAR---SGHLILSQHLDYES-SQRH-TLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATD-NGTPAAHAKTRVIVRVLDANDNDPKFQKSKYE-FRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSF----QVHPVTGEISTR----EPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAAL---GHVVGSISPIERPADVVRNSVEESFEDLRVTYTL-NPLTK-DLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEW----PQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLI----------RYFPQLNESQEQAMSLFRMDSLTGALSLQA 1555          

HSP 2 Score: 166.777 bits (421), Expect = 5.581e-41
Identity = 190/701 (27.10%), Postives = 301/701 (42.94%), Query Frame = 2
Query:  533 DINDNKPKFPTKEKRIKVSESIAVGNQL----PLQTAMD-------EDLEYFGVQSYNLEDSEPFFSLLYRPMF-----SLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKL------LPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQ--DENNHAPIL-----SLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNP-PHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQI--KALDKDKTHSLNYHLDPSV-NDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILT-----------YG---------NLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPK-RSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESGTYYLKIQATDNG 2473
            D+NDN+P F +     +V E  A+G+ +    P++   D       E  E   V +Y L    P    L    F     S  LVV + LD E  S     +  +        Q     ++IEV D NDN P + Q      + E+TP+G++I  F A+DAD+G  G + ++L      L     +    F ++  TG L L   L+ + V +++L V+A D++       Q  +T+R++  D N+HAP       S G   SL I + +  GE V  ++A D D  DNG++T  +   +        S     E++  L      D E    F ++I  +D+G P P +S    ++ V   +  PP F  + Y   I E++   S ++Q+  K+L   +  +L+Y +   V ND F +D  +GI+     FDRE    Y++PV+V D  R + L+ +       +D   +T          I   V  +            YG          +I  +   DLD   NA ++  +   + L N  S          ID     L  +  LDREQ  +Y L I  SD G PK R     IT+ VED+NDN+P ++     + Y  +V  +  L   ++ + A D D   N+ + Y+  N        +    ++T  G   + R+LQ S  Y   + ATD G
Sbjct: 1357 DLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRV-TYTLN---PLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPA-TEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVVASDLDEGPNADLIYSITGGN-LGNKFS----------IDSSSGELSAR-PLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKL----SKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGK--LDRELQAS--YNFMVLATDGG 2032          

HSP 3 Score: 158.688 bits (400), Expect = 1.381e-38
Identity = 170/675 (25.19%), Postives = 295/675 (43.70%), Query Frame = 2
Query:  509 IKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDS---EPFFSLLYRP---MFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAP---ILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPP-HRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKT--HSLNYHL--DPSVNDK-FQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNH-PIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR----DLQESGTYYLKIQATDNG 2473
            I+V + ++D NDN P FP     I+  E+     +  L  A D DLE +  Q YN+      + F    +R    +  L L +   LD E      ++L + A DGGTP       + I + D NDN PIF+Q++ +  + E+  +G+ +    ASD D+   G + + +   ++ K ++ F ++  TG + +  +L+ +      L V A+D +G  P  +   ++IRV D N++ P   ++ L D  S  I E++  GE V  +   D D +       V L     + AL      +D  IY ++     DRE++  +T+ +   D G PP H S  +F + + D+N+ PP F    Y   + E  +  ++++Q+ A D+D+    +L Y L   P  + + FQID   G++    H D E  P   + V   D     + +  T +       ++            + EN  +   G  I ++   D D   NA V     ++     H++        FE+      + +   LD E+   Y+  ++ +D G    S   +I + + D NDN P++  +  + + + +  A +  +  PI+ V ATD D      +SY  V  +   +     F I    G IF+ R     ++    + L I ATD G
Sbjct:  158 IRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPG--YSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQM-FRIDPRTGAIYINKALDFETKELHELVVVAKD-HGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFAL----TTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIF-LRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPV---GRCILKVSASDPDCGVNAMVN---YTIGEGFKHLT-------EFEVRSASGEICIAGELDFERRSSYEFPVLATDRG--GLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGI-----FRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGG 803          

HSP 4 Score: 154.451 bits (389), Expect = 3.080e-37
Identity = 167/682 (24.49%), Postives = 290/682 (42.52%), Query Frame = 2
Query:  527 IEDINDNKPKFPTKEKRIKVSESIAVGNQL---PLQTAMDEDLEY--FGVQSYNL-EDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYL-ALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKA--LDKDKTHSLNYHL-------------DPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSP-IWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFV---NNDVNSLWYEKYFTILTRNGGIFMSR---DLQESGTYYLKIQATDNGSPPR 2485
            + D+NDN+P F  +E ++ + ES    +Q    P+   +  D +Y  FG  SY +   +E     + R    + +V    L          N++  A DGG         + + + D+    PIF++ +   ++KE  P G+V+    A+  D      + + +    +     YF++  N+G + +   L+ +  S+ +L+++A    G  P     Q+ I V+D N++AP         +++ E++  G  +    A D D   +G+VT  L+K     L A+D            L+ ++  D E     T++++  D G P   +     V V D+N+ PP F    YS+ +SE   IN+ +IQ+ A  LD      + Y +                V+  F I  N G +      DRE   +Y + V  TD         T  +   +   +++        +F I EN   L  G+++G +   DLD   NA +   LL +             N SF++      +  +  LDRE  + Y L +   D G P RS    + + V D NDN+P I   Q +     V+V  E      ++ V+A D D  +N++I+Y+ V   ++D + L+       +    G+  +R   D +E   Y L + A+D G+PPR
Sbjct:  705 LTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNIS--ATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIY---SGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQA--TLGEPPVYGHTQVNIEVEDVNDNAPEFE-ASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSG-------HLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEEN---LRRGSVVGVVTASDLDLGENAAIRYSLLPI-------------NSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQED----VVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFS------IDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPR 1345          

HSP 5 Score: 152.14 bits (383), Expect = 1.405e-36
Identity = 172/726 (23.69%), Postives = 303/726 (41.74%), Query Frame = 2
Query:  497 PDHWIK-VFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYR--PMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEH------VGMVIASDGDLEDNGKVTC-VLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLN-----YHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIV---------PVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVN-------NDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTIITVKISTAEKTNYLIKNSQISFTL 2575
            P H  K +F+ I D+NDN P+F        V E    G  +    A D D       +Y+L ++    +  ++  P   L +     +D E  +     LT++A DGG P       + + + D NDN PIFDQ+     + E+ P+G  I   +ASD D G+   +N+ +      K+   F +   +GE+ +   L+ +  S +   V A D  G    S+   + +++ D N++ P+     RE    +  SP          +  V+A+D D  + G+V+  ++  N++    +DRS      +   +++ R     +L+     IS  D GN    +  +  +S+ D  + PP F  + Y+ ++ EDI   + +  + A   D  H        Y  DP  +  F I+ N G ++     D E   + ++         PV+   QV   +                       + +  + E+ ++   G  +      D D+  +  V   L+         S   L    F ID    +L +   LD E   ++ L +  +D G+P  S    I V V+D NDN P++     +  Y VNV+   ++N  II V A+D+D   N+ I+Y  V+       N ++S    ++F I   +G I++    D +    Y L + ATDNG+P   +   +I V++  A   +   + S+  F +
Sbjct:  483 PLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGL-ITTRSHIDCE--TEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTI--GEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGG---LSTTAMIKMQLTDVNDNRPVFY--PREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLN-----ISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDP--DGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFE----------ASMVRISVPESAEL---GAPLYAAHAHDKDSGSSGQVTYSLVK-------ESGKGL----FAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFE----KDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVI-VRVLDANDNDPKFQKSKYEFRI 1162          

HSP 6 Score: 133.65 bits (335), Expect = 6.883e-31
Identity = 181/690 (26.23%), Postives = 307/690 (44.49%), Query Frame = 2
Query:  515 VFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKES---------TPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITS--LNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSN-YLALD-RSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHS--LNYHL-DPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFV-IRE----NVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHV--LSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPII--LVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFT--ILTRNGGIFMSRDLQESGTYYLKIQATDNGSPPRFSDVTI 2503
            V + I D+NDN+P F      + V+E+  VG  +   +A D D     + +Y + +     +       S  + +  +LDFE  S   +   ++A D G        K+Q+  TD NDN P+F   +    ++ES         TPI +V+    A+D D G FG+++++++          F ++ +TGE+ ++    L+ +     +L++ A D  G    ++   + + + D     PI     R +  + E+ P G  VG VIA+ GD+     V   +   D + Y +++  S N++          +  D E      + I     G PP       N+ V D+N+  P F  S   I + E  E+ + L    A DKD   S  + Y L   S    F ID   G L    H D E   ++ + V  TD      L+   T+ + V DVNDN PV    +  V + E    N QI+       ++   DLD   NA +   ++   V  ++N +S   +  H F I      +++++ LDRE  D+Y+L ++ +D G P       + V V D NDN P  ++Q ++  +++    E NL    +  +V A+D+D  +N+ I Y+ +   +NS +     T  I TR     + R+L+E   Y L ++A D G+P R + V +
Sbjct:  597 VLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSS--YEFPVLATDRGGLSTTAMIKMQL--TDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVV----ATDPDYGNFGQVSYRIVAGNEAG---IFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATD-GGNLRSNADAVVFLSIIDAMQRPPIFEKA-RYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIR--------IAKPLDHEAKSQVLLNIQAT-LGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDG-GVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQII-------QVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQH-FGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDP--KFQKSKYEFRI----EENLRRGSVVGVVTASDLDLGENAAIRYSLL--PINSSFQVHPVTGEISTREP---LDRELRE--LYDLVVEARDQGTPVRSARVPV 1242          

HSP 7 Score: 126.331 bits (316), Expect = 1.092e-28
Identity = 216/854 (25.29%), Postives = 349/854 (40.87%), Query Frame = 2
Query:  224 FEANVVKYRLKEESDINTLIGNI---------FEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLD-FKGHLLVNKRIDREFLCPNVDKIDDCQLELMIHAF--------PDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNL--------EDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVT------DSNDNNPIFDQTQNYK------FIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSL-----NAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVL---LKNDSNYLALDRSHNMKDEIIYRLVTTRV-FDRELLDYFTIMI-----------------------SCQDYGNPPHRSFQLFNVSVGDINEFPPSFY-HSNYSIFISEDIEINSALIQIKA-LDKDKTHSLNYHL-DPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIK-QFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLG-IPKRSNMEIITVMVEDENDNSPIW-RYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDL-QESGT-YYLKIQATDNGSPPRFSDVTIITVKISTAEKTNYLIK 2551
            F ++ + +R++E++ +  ++G+I           +S  E     +  +T    T D+      +D   G+L+V + +DRE            +  L I A             I V I + D+NDN P++P     ++VSE+  VG  +   TA D D    G   Y L        E  E   SL      +  L +   LDFE +    + L + A D  + V    ++LQ  VT      D+ND+ P F    +        FI ++T IG V+    A D DSG  G++ +++        +  F +N  TG + L+ SL     + +   +F L + A+D     P  S   L + VQ  +N+ P   L      TI+EN P+G  V  V A      +N  ++  +   + ND  ++   R           ++TTR  FDRE    + + +                       S  D  N  H       ++VGD+N+  P F   S Y + + E+ E       + + LD+     L Y +   ++ +KF ID + G L +    DRE   +Y + +  +D+ +     G   + I V D NDN P     K    ++E+  +   G  + ++   D D   NA +      V+ L+N   W       F ID     +     LDRE    Y   ++ +D G    RS    + + V D NDN PI+ RY      Y   V A       ++ VQA D D   N+ I Y+   N  NS    K F I    G +  S+ L  ESG   +L++ A D G+PP+ S + +I + I  A +   +++
Sbjct: 1365 FTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREV---------QSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQE--YLLIVQALDQSSNV---TERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGG---NGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRF-LQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRG----------IITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGEL-SARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPL---GTSVVQISAVDADLGVNARL------VYSLANETQW------QFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERY-----PYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSL--NAENSAVSAK-FRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQ-SSLGLIELLIGEAPQGTPVLR 2165          

HSP 8 Score: 123.635 bits (309), Expect = 8.096e-28
Identity = 181/744 (24.33%), Postives = 305/744 (40.99%), Query Frame = 2
Query:  515 VFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPF-FSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGT-PVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPI---GSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIM--ENSPAGEHVGMVIASDGDLEDNGKVTCVLLK----NDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDY---FTIMISCQDYGNPPH-------------------------RSFQLFN---------------------------VSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHS--LNYHL-DPSVNDKFQIDIN-KGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIR-----ENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHM---SWIRLLNHS-FEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQV-----NVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNG--GIFMSR---DLQESGTYYLKIQATDNGSP 2479
            + I +ED NDN P+F   +    V E   +G  +   +A+D DL       Y+L +   + F++  +   S  +  + KLD E      +N  ++A DGG   V+     +QI V D NDN PIF++   Y +I +   +   G  +    A DAD G   +I + L  A  +     F +N +TG L    SL ++      L+V ARD+ G  P SS   + + + +     P+L   + E+  +M  ENSP+G  +  V+A    L  +G+   V       N+   L+LD   ++  EI       RV    LLDY    T  +S    G   H                          SF L N                           + + D N+  P F    +   +SE     + + Q+ A D D   +  L YH+ D + ++ F I+    GI++  +  DRE+   Y + +  TD+                       P MTG     ++     +N       NL+   +  +L     +    D+ +   L+  +   S + + N S F +D+Y   L +K  LD E   +Y+L++I SD     R+   ++TV V DENDN+P++  Q     + +      ++   +++  ++ V ATD D++ N++     +         ++ F++   NG   + MSR    +  SG Y+++I A D G P
Sbjct: 1938 ITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQ---SGLITTVGKLDRE--LQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFER---YPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSL-NAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDK-GNPPQSSLGLIELLIGEAPQGTPVLRFQN-ETYRVMLKENSPSGTRLLQVVA----LRSDGRRQKVQFSFGAGNEDGILSLD---SLSGEI-------RVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDE---------------------GVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEART---VLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIE------PAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKP 2626          

HSP 9 Score: 96.2857 bits (238), Expect = 1.560e-19
Identity = 104/389 (26.74%), Postives = 169/389 (43.44%), Query Frame = 2
Query:  506 WIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTT--KNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPI-LSLGDRESLTIMENSPAGEHVG----------MVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIK--ALDK 1627
            + ++ I +ED NDN PKF  K+    VSE    G  +    A D D        Y++ D     + +  P FS  +     LD E      + L +IA D G P       +++++ D NDN P F    N   + E+T +G+VI   +A+D D+  +  + ++L    T   +N   F L+  +G+LVL   L+ ++  ++ LDV A D        ++  LT+RV DEN++AP+ L+        I+   PA   +            V A+D D E N      +++      ++  S+ +    + RL           DYF + I  +D G P  +S  L  V   D       F  + Y   ISE   + S ++Q+   ALD+
Sbjct: 2305 YAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDRE--IRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTF-PPNNLVTVSEATELGAVITSISANDVDT--YPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASD----AAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAIL---PAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSG---DYF-VRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQ 2677          

HSP 10 Score: 86.6557 bits (213), Expect = 1.509e-16
Identity = 169/699 (24.18%), Postives = 276/699 (39.48%), Query Frame = 2
Query:  506 WIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNL----EDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNP----IFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLIT------------SLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKND---SNYLALDRSHNMKDEIIYRLVTTRV-FDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKD--KTHSLNYHLDPSVN--DKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFV-IRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFV--KSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTI 2503
            ++ V I I+D+NDN+P F        V E+  VG  +    A D D +  G+  Y +     D E  F +  R   +  + + K LDFE  +     L ++A D G         + I VTD NDN P    IF        I ES   G  +   +  D DS             +T    V   LN   G   L T             L+ +IVS + L V A D+ G  P  +   + +R+ D N++ P     D     +ME +  G  V  V+A D D   N  +T  L +     + +  +D            L+TTR   D E      + +  +D G PP  S     V++ D+N+  P F  S Y++ ++E+  +   ++++ A D D      +NY +        +F++    G +      D E    Y  PV  TD+     L+ T  + + +TDVNDN PV    +  V +RE+ +  +  +    +     D  Y        +S  +++ + + I      F ID+    +FV     L       + LNI  +D G  + +   ++ + + D     PI+     +  Y   V  +      +  V A   D    S + Y+  + D +      YF+I T +G I +++  D +      L IQAT  G PP +    +
Sbjct:  269 FMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPR---TGAIYINKALDFE--TKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDS-------------KTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDK-GTPPLHASKSIFLRITDVNDNPPEFEQ-DLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTG--------LITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDR---GGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGN---FGQVSYRIVAGNEAGI------FRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFE----KARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDG-----YFSIETNSGNIRIAKPLDHEAKSQVLLNIQAT-LGEPPVYGHTQV 917          

HSP 11 Score: 83.5741 bits (205), Expect = 1.086e-15
Identity = 81/298 (27.18%), Postives = 137/298 (45.97%), Query Frame = 2
Query:  515 VFIIIEDINDNKPKFPTKEK-RIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLY---RPMFSLTLV-----VLKKLDFENISHRYFNLTLIACDG--GTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSS-----QCQLTIRVQDENNHAPILSLGDRESLTIMENS---PAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNY 1351
            V I I D NDN P F    K   ++SE   +   +    A+D D E       N  +SE  + +       MF++ LV     V  +LD+++ +  Y  L + ACD     P+ C  Q  ++E+ D NDN P F  T+   F+ E+ P+GS +F  +ASD D G FG++N+ + PA + +         ++ ++  + S +  + S F+ D E R    +   +S     +  + +RV+ E+         +R    ++  +   P G  VG V A+D D   +G+V   L    S++
Sbjct: 2738 VIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQE-------NTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSY-ELIIRACDSHHQRPL-CSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDE---------SSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPHSHF 3017          

HSP 12 Score: 75.0998 bits (183), Expect = 4.426e-13
Identity = 92/387 (23.77%), Postives = 162/387 (41.86%), Query Frame = 2
Query:  515 VFIIIEDINDNKPKF-PTKEKRIKVSESIAVGNQLPLQTAMDEDLE-------YFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQ-KLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPA----GEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPP--SFYHSNYSIFISEDIEINSALIQIKALDKD 1630
            ++I + D+NDN P+F P     + V E+   G    + T +  DL+        + +   NL +    FS+      S   +  + LD E   H  + L + A D G P        + I V D NDN P F  ++    ++E  P+G+ +   +A DAD G    +N +L+ +   + +  F ++  +G +  +  L+ ++ + +   V A D       S+   + I V D N++ PI      E    +   PA    G+ +  V A D DL  N ++   L   +S   A  R +         L  ++    E      + +  +D GNPP  S  L  + +G+  +  P   F +  Y + + E+    + L+Q+ AL  D
Sbjct: 1833 IYITVGDVNDNSPEFRPGSCYGLSVPENSEPGV---IHTVVASDLDEGPNADLIYSITGGNLGNK---FSI----DSSSGELSARPLDREQ--HSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLG----VNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIF-----ERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGA----LSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSD 2194          

HSP 13 Score: 74.3294 bits (181), Expect = 7.036e-13
Identity = 137/613 (22.35%), Postives = 240/613 (39.15%), Query Frame = 2
Query:  785 LTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARD---------ENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDN-----GKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIF---------ISEDIEINSALIQIKALDKDK---THSLNYHLDPSVNDKFQIDINKGILK-NIVHFDREVIPK--YIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATV--------VCDLLSVHVLSNHMSWIRLLNHS-FEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNME--------IITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAK--KNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQ-ESG--TYYLKIQATDN 2470
            + L+A     P      +L IE+ D NDN+P F Q Q    + E    G+ +   +A D+D+G   ++ + ++               +    V+  + +  + +  +LD E RD         + GV   +    + +++ D N++ P     +   +T+ E +  G  +  + A+D D         G  + V ++N S + ALDR          +LV  R  D EL   + + +   D     H +  +  V V D N+  P F       +         ISE + ++  L+ + A D D       + Y ++P+  + F +  + G++  N+      V     Y V +   D  +                               ++ +  +    N  G  ++Q L N Y A +        V   L    L   ++ I     S FE+ + K  + VK  LDRE+ D YKL +++S    P   +          IIT++  D NDN PI+   +    Y+  ++    L + I  +QA D D +   NS + Y     D+ S   E  FTI    G +F++  L  +SG  +Y L I+A D+
Sbjct: 2290 VVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGN------------HDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL--VTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIF-ALDRYSG-------KLVLKRRLDYELQQEYELDVIASDAA---HEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPA-QEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKP-----------------------------ALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNEESAFELLQSKAIVLVKP-LDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITIL--DANDNFPIF---DRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVY-----DITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDS 2836          

HSP 14 Score: 67.3958 bits (163), Expect = 1.024e-10
Identity = 62/227 (27.31%), Postives = 111/227 (48.90%), Query Frame = 2
Query: 1064 VLITSLNAKIVSKFILDVEARDENGVG--PFSSQ-CQLTIRVQDENNHAPILSLGDRESLTIM--ENSPAGEHVGMVIASDGDLED-NGKVTCVLLKNDSNYLALDRSHNMKDEIIY-RLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHS--LNYHLDPSVNDK---FQIDINKGIL 1708
            + I     +I +K  LD E R    +   P S +  ++ + V+DEN++AP      + S+ I   EN+P      ++ A D DLE  N +   ++  N ++   L  SH  +D ++Y  L  +   DRE    ++++I   D G PP R F   N+++ D+N+  P F  S Y   + E+  + ++++Q+ A D D   +  + Y ++   +DK   F+ID   G +
Sbjct:  123 LAIDRATGEIRTKVKLDRETRASYSLVAIPLSGRNIRVLVTVKDENDNAPTFP---QTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLS-SHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAI 345          

HSP 15 Score: 60.077 bits (144), Expect = 1.487e-8
Identity = 158/683 (23.13%), Postives = 280/683 (41.00%), Query Frame = 2
Query:  509 IKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDED----LEY-FGVQS-YNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKF---------IKESTPIGSVIFIFNASDADS-GLFGKINFKLLPARTTKNKVYFNLNFNTGEL-VLITSLNAKIVSK--FILDVEARDENGVGPFSSQCQLTIRVQ-DENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFN------VSVGDINEFPPSFYHS-NYSIFISEDIEINSALIQIKALDKDKTHSLNYHLD---PSVNDK--FQIDINKGIL--KNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIG----ELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIIL--VQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESG 2437
            I+V I+  D+NDN+P FP     + VSE+  +G  +   +A D D    L Y  G +S  ++E+     S+     +S  LV+ ++LD+E    + + L +IA D        +  L + V D NDN P+F   Q   +         I ES  +   +   NA+DADS G   K+ + + PA+       F+++ + G + V ++ L   + S   + + + A+D    G  + +    +RVQ ++N       L ++    I E +P G    +V+    D  D  +   ++  N+ +   L +S          +V  +  DRE  D + + +       PP  S    +      +++ D N+  P F  S  Y   ISE   +  ++ Q++A+D D+ ++ N  +     S ND+  F ID+  G+L   N + +D      Y + +   D      L       + + D NDN P      +F + E V  L     +G         DLD      +   +      S+  SW       F +D     +      D EQ  +Y + ++ SD+G  K S    + V +E  ++ +P    Q  +  Y+  + A   L    ++  V ATD D+  +  + Y              +F +   +G + + R L+  G
Sbjct: 2414 IRVQIV--DVNDNQPTFPPN-NLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIEN----MSIFALDRYSGKLVLKRRLDYE--LQQEYELDVIASDA---AHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEG-----FSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKD---AGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGS---VVLQLGQDALD--QSLAIIAGNEESAFELLQSK--------AIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGA-KSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEP------KFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAP--SDESSW-----KMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKKASVA--VRVEIESRDEFTP----QFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLS-------APHSHFKVNRSSGAVLIKRKLKLDG 3036          

HSP 16 Score: 56.6102 bits (135), Expect = 1.924e-7
Identity = 43/170 (25.29%), Postives = 74/170 (43.53%), Query Frame = 2
Query: 2018 RLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTIITVKIS 2521
            RL +H         +L +   LDRE    Y L I   D G P       + + ++D NDN PI+    NQ+ Y   V     +   ++ V A+D DA +N  + Y       +    E+ F I  R G I++++  D +    + L + A D+G  P       ++++++
Sbjct:  223 RLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIF----NQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDK---EQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQP-LETTAFVSIRVT 384          

HSP 17 Score: 53.1434 bits (126), Expect = 2.288e-6
Identity = 49/169 (28.99%), Postives = 77/169 (45.56%), Query Frame = 2
Query: 2036 FEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESG--------TYYLKIQATDNGSPPRFSDVTI-ITVK 2515
              ID+    +  K  LDRE    Y L      + IP       + V V+DENDN+P +     QT+  +     T       L+ A D+D +  +   YN V+ +VN  +  +  +   R+G +++  DLQ SG         Y L I+A D G+PP    +T+ IT++
Sbjct:  123 LAIDRATGEIRTKVKLDRETRASYSL------VAIPLSGRNIRVLVTVKDENDNAPTF----PQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAF--RLSSHRERDGVLYL--DLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQ 277          

HSP 18 Score: 51.6026 bits (122), Expect = 6.284e-6
Identity = 39/152 (25.66%), Postives = 67/152 (44.08%), Query Frame = 2
Query: 2063 LFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNN-DVNSLWYEKYFTILTRNGGIFMSR---DLQESGTYYLKIQATDNGSPPRFSDVTII 2506
            + V   LDRE +  Y L+++ +D G P     + I + + D NDN P +     Q  Y  NV    +    ++ V A D D   NS ++Y+     + ++ W++     +    G+  +R   D +      L + A D G PP  S  T++
Sbjct:  456 VIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFE----QDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQ-----IDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVL 598          
BLAST of Protocadherin-1 vs. Ensembl Fly
Match: ft (gene:FBgn0001075 transcript:FBtr0077478)

HSP 1 Score: 156.377 bits (394), Expect = 7.891e-38
Identity = 170/700 (24.29%), Postives = 300/700 (42.86%), Query Frame = 2
Query:  488 HAFPDHWIKVFIIIE--DINDNKPK-----FPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKK-LDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMK---DEIIYRLVTTRVFDRELLDYFTIMISCQDYGNP-PHRSFQLFNVSVGDINEFPPSFYHSNY---------SIFISEDIEINSALIQIKALDKDKTHS--LNYHLDPSVNDKFQIDINKGI--LKNIVHFDREVIPKYIVPVFVTD--QVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIREN--VQILTYGNL-IGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNME------IITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQ-ESGTY-YLKIQATDNG 2473
            H  P    + ++ +   D ND+ P      FP   K   V E+   G  +      D D    G  S  +                L +V +   LD E I    +NLT++A D GTP +     L I+V D ND+ P+F++++    + E  P GS +    A+D D+G+  ++++ +L     K   +F+++  TG +V    L+ +I     L + ARD  G  P  +  QL + + DEN+ AP  S  + +++T+ E++P    V ++ A+D D   NG VT  L        +++R + ++   D +  +L T R  DRE +  + I +  +D G P P  +     ++V D+N+  P FY  +Y          I + +++E    L+ + A DKD   +  + Y L+      FQ+D   G   L+          P Y + V   D  Q R         V  +  ++ +      G  +F + E+   Q  +  N  +G +Q +  +   N+ +  D++      N           F ID     +     LDRE+   Y+L I+ S       +         I+ + + D NDN+P++   + ++   +++     +   I L +  D DA  NS ISY+  NN        + F I    G +++ R ++ E G+  ++++ ATD G
Sbjct:  357 HGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEEAADLHIVRVNGVLDREEIGK--YNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNELK---WFSMDPLTGLIVTTGPLDREIRDTVELSISARD-GGPNPKFAYTQLKVIILDENDEAPQFSQRE-QNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAP------SVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGGEGLFQLDARSGAISLRGDAPASMHWKPHYKLLVSARDAGQRRSQQDAIVEIVLKSKLEMLECGQAQAGGYEFQMVEDHEQQRNSQPNREVGIVQVKSTNGKANSHIEYDIIQGDRAQN-----------FRIDTRSGRITTARPLDREEQANYRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFAL-DRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLTNNP------NQQFRIGPVTGVLYLQRPIRAEPGSLIHVELMATDAG 1025          

HSP 2 Score: 144.05 bits (362), Expect = 4.770e-34
Identity = 180/685 (26.28%), Postives = 298/685 (43.50%), Query Frame = 2
Query:  455 KIDDCQLELMIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQT--AMDEDLEYFGVQ-SYNLEDSEPFFSLLYR-PMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDY-FTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDK--THSLNYHLDPSV-NDKFQIDINKGILK-NIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQIL---TYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESGTYYLKIQATDNG 2473
            + +DC LE       +  I +     DINDN+P F       +V E+    N   + T  A D D      Q  Y L++ +   S L+R    S  + +LK LD E  S   + LTL+A D G+P       +++EV D NDN+P+F+    +  ++E+ P G+ +    A+D D GL  K+ F LL     +    F+++  TGE+   T+L+ +  S + L + A+D +   P +S   LTI V D N++ P        ++ + E    GE V    A D D  +N  V   +   D +Y  +    N K  ++   +  +   +   D  +TI+IS  D G     S     V +     FP   Y +N    +SED+     + ++ A    K     + Y +   +  D  ++D N G+L       D E+   Y + +   D      L   T + + VTD NDN PVM   +Q +   N ++L   +   LI  ++  D D+  N  V      ++ L N        + +FEI +    ++ +  LDRE+I  Y   +   D G+P  +    + + + D+NDN P +        + +NVT    +   +I V ++D+D   N+N SY+F  N       E     +T  G +    D ++   Y LK+ A+D  
Sbjct: 2354 RAEDCALENPAGDTAELTINIL----DINDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGD---SDLFRINASSGDIALLKPLDREQQSE--YTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGEHMHR----FHIDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFD-STTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTISGRDQHYFDI----NTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTVILRPPELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDSLRVDPNSGLLSVGQDGLDYELTHLYEIWIEAADG-DTPSLRSVTLITLNVTDANDNAPVM---EQLIY--NAEVLEEESPPQLIAVVKASDRDSGDNGNV------IYRLQND------FDGTFEITE-SGEIYTRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKF-----TRLFSLNVTENAEIGSFVIRVTSSDLDLGANANASYSFSENPGEKFRIEPQSGNITVAGHL----DREQQDEYILKVVASDGA 2992          

HSP 3 Score: 143.28 bits (360), Expect = 7.926e-34
Identity = 185/687 (26.93%), Postives = 288/687 (41.92%), Query Frame = 2
Query:  515 VFIIIEDINDNKPKFP---TKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELL----------------------DYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLN---YHLDPSVND--KFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESG--TYYLKIQATDNGSP 2479
            V I I D+NDN P F      E  I + E+ AVG ++ L    D D       SY+L ++ P       P+  + L + + +  E  S    ++ L+A D G+P    K  L + + D ND+ P+FD T     + E+T + +  F   A+D D G  G+I+++++   T +    F + F  G L +   L+ +    + L V  RD  G    SS   + I V DEN++AP  +     + +I EN+PA   VG + A D D+  N +++  L     ++    R+  +K        T R FDRE L                      +Y  +  +  D G P  +      V V D+N+  P F  + Y + ISE     + +  +   D D+   LN   Y+     N+  +F +D   G L      DRE    + + V   D      L+   ++ I V D NDN P  T     V    ++    G  +   +  D D   N+ VV  + + +              +F ID    +L++   LD E I  Y LNI  SD G P  S   +  V+V D+NDN PI+      TA    +     L  PI+ V A D D+  N  +SY  ++     L   ++F I T  G I   R++      T+ L + ATD   P
Sbjct:  928 VNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLTNN-PNQQFRIGPVTGV-LYLQRPIRAEPGS--LIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTER---MFGV-FPDGYLFVRAPLDREERDYYALTVSCRDA-GQPSRSSVVPVVIHVIDENDNAPQFT-NSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQTQDFTIDTRNGFIK--------TLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADE--GLNGDVYYSLAKGNEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEV--SVLETSPTGTELMRFRASDADQGVNSQVVFSISAGN-----------RRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIF----PSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSY-AISKQEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQP 1576          

HSP 4 Score: 142.895 bits (359), Expect = 1.180e-33
Identity = 185/736 (25.14%), Postives = 295/736 (40.08%), Query Frame = 2
Query:  398 GHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQ------SYNLEDSEPFFSLLYRPMFS-----LTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLN---------AKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSL-----GDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDK---FQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYG------NLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPK-RSNMEIITVMVEDENDNSPI-----WRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQES----GTYYLKIQATDNG 2473
            G +  N  +DRE +  + D +       ++ + P + I+V I + D+NDN P+FP     I  SES   G +L L  A D D+   GV       + N+++    F L+     S     L L     LD E  S   + L + A DGG+P +    ++ + + D NDN PIFD +     + E+   G+ +    ASD D G   KI + L      + +  F +N  TG +     +N         +      +  V ARD +G      +  +T+ + D N+H PI+S      G + + T+ EN+  G  V  V   D D   NG+ +  ++    N L   R     D  I R+    V DRE +  + + +   D G P   +     + V D+N+  P F  S YS  +SE     S +  I A D+D   +   H D    ++   F +D   G++      DRE+     + +   D         T    I + + ++         QF  RE  Q +T G       ++  +   D D   N +V   L          S  RL    F +D     L  +  LDRE++ +Y++++I  D G P  +S    + + V D NDN P      + Y        + +  E      ++ V A+D D   N+ I Y   +        E  F +  R+G I +  D   S      Y L + A D G
Sbjct:  110 GEVKTNVVLDREGMRDHYDLV-------VLSSQPTYPIEVRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDNK---FRLVTTANPSGDTSYLHLETTGNLDRE--SRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYL-----AETEHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARD-HGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVA-TVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSG--NELGHFRLEEAADLHIVRV--NGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNELKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNPKFAYTQLKVIILDENDEA-------PQFSQRE--QNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAP--------SVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGG------EGLFQLDARSGAISLRGDAPASMHWKPHYKLLVSARDAG 799          

HSP 5 Score: 137.117 bits (344), Expect = 6.132e-32
Identity = 162/682 (23.75%), Postives = 292/682 (42.82%), Query Frame = 2
Query:  515 VFIIIEDINDNKPKFPTKEKRI---KVSESIAVGNQLPLQTAMDEDLEYF-GVQSYNLEDSEPFFSL--LYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKD--KTHSLNYHLDPSVNDK--FQIDINKGILKNIVHFDREVIPKYIVPVFVTD---QVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSP---IWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAK-KNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTI 2503
            + I I+D NDN P+F          ++ +SIA+  Q+    A D D +    V SY+L+   P FS+      +FS   V  K   +       + LT++A D G P    +  + I + D+++N P F+Q +    + +    G  I   +A+D       ++++ L+   T      F++  + G + L+  +     +++ L V A D  GV P S + ++ I V  EN   P  S+   + + + EN P G  +  V A+D D   NG +   +   +      +R     DE    +V  +  D +L+  + + I+ QD G  P  S  +  + + D+N+ PP F H  Y  +I E+  + + + Q  A DKD  K   ++Y   PS  D+  F ++ + G + + V FD E    Y + +   +    +          + +         PV      F + E   +   G  +G +Q  D D+  +  V   L+     SN        +  F ID     ++V   LDRE  ++  L ++  + G  + ++ +   V++  ++ N P   I  Y      Y   ++    +   +  V+A D D + +N+  SY+ +N ++     ++ F I  + G I  +   D +E+ TY L I A D G PP+    T+
Sbjct: 2999 ITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQI---IATDRDKQGPNSVISYSLQQPSPMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLM---TFNLSSIFSVGRHDGWITLVKPIQVPPNTRYELVVRATDR-GVPPQSDETRVVIVVTGENMDTPRFSVNSYQ-VIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGN------ERQDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKNPDSSMESYANLYVHVLGVNEFYPQFLQPVF----HFDVSETSAV---GTRVGAVQATDKDSGEDGRVYYLLVGS---SN--------DKGFRIDTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGNDPPEFIKHY------YTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNL-----KQSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPPQTGSATV 3637          

HSP 6 Score: 132.88 bits (333), Expect = 1.265e-30
Identity = 174/734 (23.71%), Postives = 298/734 (40.60%), Query Frame = 2
Query:  398 GHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFPDHWIK--------VFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEY-----FGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTT-KNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEA--RDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGM--VIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNV-----SVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKA------LDKDKTHSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIP-KYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTI 2503
            G L + +R+DRE            ++  +I    D  +K        + I++ D NDN P+F      + V E+   G +L    A D D        F + + N  D+       +    + +L + K LD+E+I+    N+T  A D GTP         + V D NDN PIF  T   + IKE  P+ + I    A D DSGL GK+++ +           +F +N  TG +  +  ++ + +  F L V A  R +      S++  +T+ V+D N++AP+    +   L    ++  G    +  V A D D   NG VT  ++        L R+       I        F +E+  Y   + S  +      RS +++       S G  +  P     S  S  + E+  I ++++ + A      ++   T+         V+  F ID   GIL      DRE  P +Y V V+          + T      +   +     +     + + E++QI   G+ I  L+  D D   + T +  L+  H            +  F ++     L +  +LDRE   KY+L I +SD G+  +      T+ V D NDN P++      T Y  ++       + +  + A D D  +N+ +SY  V++     W    F++  + G + ++   D +E   Y L +QA DNG P   + +T+
Sbjct: 1333 GQLSLGRRLDRE----------SQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDT------FHIDSITGSLYLHKPLDYEDITSYTLNIT--ASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVSGPQELFKLQRNTG-----IITFTPGPQFKQEVR-YQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVYENEPIGTSILTVTAHLASAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQI---GHTISTLRAHDPDTLGSVTFL--LMDGH------------DGKFLLEPSTGKLILNDTLDRETKSKYELRIRVSD-GV--QYTEAYATIQVSDTNDNPPLFE----DTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSD-----WANDVFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITV 2013          

HSP 7 Score: 129.028 bits (323), Expect = 1.753e-29
Identity = 118/433 (27.25%), Postives = 198/433 (45.73%), Query Frame = 2
Query:  509 IKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPM-FSLT-----LVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENS--PAGEHVGMVIASDGDLED-NGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKT--HSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTD 1774
            +KV I+I+D+ND  P F        + E++A+   +    A+D D    G   Y ++++         P+ FSL      L V+  LD E  S    N+T  A D G P Q  + +L I + D NDN+P+FD  Q    + E+  IG+++   +A+D D G  G+I + ++      +   F+++ +TG + +  +LN + +S++ L V A D     P     +LTI + D N++ P   L       +MEN+  P G +V  V A D D    N +V   L + DS+   ++ S          +   +  DRE    +T+ +   D G+PP     +  V V DIN+  P F   +Y   + E++   + ++  +A DKD+     L ++L      +F ID   G +      DRE    Y + +   D
Sbjct: 2151 VKVTILIKDVNDEVPVF-ISANETAIMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNIT--ARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQNHD---FSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRPTF-LDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDSDLFRINASSG-------DIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGEHMHRFHIDSETGEISTATTLDREETSVYHLTLMAQD 2569          

HSP 8 Score: 127.102 bits (318), Expect = 6.950e-29
Identity = 142/581 (24.44%), Postives = 241/581 (41.48%), Query Frame = 2
Query:  779 FNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKN--DSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNP--PHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHS--LNYHLDPSVNDK-FQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRL---LNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSN-ISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR---DLQESGTYYLKIQATDNGSP 2479
            + L + A D G P Q D+ ++ I VT  N + P F        + E+ P+GS I    A+D D+G  G + + +      ++   F+++  TG +V+   L+  ++ ++ L++  +D  G  P SS   LTI + D N++ P+ +  +     I EN P G  V    A+D D   N  +    L +  D ++  +++S+      +        FD E    +T+ I  +   NP     S+    V V  +NEF P F    +   +SE   + + +  ++A DKD      + Y L  S NDK F+ID N G++    H DRE   + ++ V   +              I      ++ P    IK +      +    G  +  ++  D D             V   +N  S+  +   L  SF+ID     +   S LDRE+   Y L I   D G+P ++    + + +ED NDN P +  +        N  A T+    I+ + A+D D  +N    +Y  +     S W       + RN G+  S    D + +      I+  D+G P
Sbjct: 3195 YELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNERQD---FSVDERTGGIVIQQQLDYDLIQEYHLNITVQDL-GYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCY-IPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNGTISSAVS-------FDYEERRIYTLQIKAK---NPDSSMESYANLYVHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKGFRIDTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGNDPPEF--IKHYYTSTISEAAPVGTKVTTVKAIDKD-------------VRTQNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTFTPEGLNGYISENEPAGTS----IMTLIASDPDLPRNGGPFTYQLIGGKHKS-WLS-----VDRNSGVVRSTTSFDREMTPILEAIIEVEDSGKP 3735          

HSP 9 Score: 125.561 bits (314), Expect = 1.836e-28
Identity = 181/669 (27.06%), Postives = 285/669 (42.60%), Query Frame = 2
Query:  521 IIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSL-----TLVVLKKLDFENISHRYFNLTLIACDGGTPV--QCDKQKL-QIEVTDSNDNNPIFDQTQNYKFI--KESTPIGS--VIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPF-SSQCQLTIRVQDEN---NHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDREL-LDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMT-GIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDL--QESGTYYLKIQATD 2467
            +++ D NDN P FP+     ++ E I +   +   TA D D    G  SY +   EP   L     F +      +  L+++D E+I    F LT++A D   P   Q   +KL  + V D NDN P+F  + N   +  K ST  GS   +   +A DADS   G + ++++    +  +  F L  NTG +        K   ++ L +++ DE       SS+  +TI         +  P      + S ++ EN P G  +  V A     E    VT V          +DR  ++ D  +  L T    DRE   + + + +     G  P  S     V+V D N+ PP F  + +   +SED++I   +  ++A D D   S+ + L    + KF ++ + G L      DRE   KY + + V+D V+           I V+D NDN P+    +  F I EN Q    G  +G++  +D D   NA      LS  V+S+   W    N  F ++     L + + LD E++  Y L +   D G P  S    +   V D NDN+PI+    +  +Y   V     +   ++ V A DID+  N  I Y+    DV+S +       +  NG I   R+L  +   TY L + A D
Sbjct: 1477 VLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEP--QLPQGRHFGINTETGVIHTLREIDRESID--TFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVF-VSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIV----SGPQELFKLQRNTGIITFTPGPQFKQEVRYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVYENEPIGTSILTVTAHLASAEIEYFVTNVTATGSRG--QVDRLFDI-DAKLGILSTAAELDREAGPEEYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPDTLGSVTFLLMDGHDGKFLLEPSTGKLILNDTLDRETKSKYELRIRVSDGVQ----YTEAYATIQVSDTNDNPPLFEDTVYSFDIPENAQ---RGYQVGQIVARDADLGQNAQ-----LSYGVVSD---WA---NDVFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIF----DPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGDVDSEFG------IDSNGTIRTRRNLDREHRSTYTLTVTARD 2105          

HSP 10 Score: 118.242 bits (295), Expect = 3.452e-26
Identity = 120/451 (26.61%), Postives = 185/451 (41.02%), Query Frame = 2
Query:  509 IKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHR-----------------YFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDK---------FQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVR 1783
            + V I + D NDN P+F        + E+      +   TA+D D+      S+ L      F++  R  F  TL    +     +S                   Y  L     D G P   DK K+++ VTD NDN P F +   +  I E    G+ I      DAD GL G + + L           FNL+  TG+L L   L+ +      L V A+D     P SS   +TI V DEN++AP  +    E ++++E SP G  +    ASD D   N +V   +   +       R     D I   L   +  D E +  +T+ I+  D G P   +  L+NV V D N+ PP F  +     I E I + + ++ + A D D    LN  +  +++ +         F I+   G++  +   DRE I  + + V  TD+ +
Sbjct: 1137 VPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQ---FNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSE-VSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNR------RDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDS--GLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQ 1575          

HSP 11 Score: 114.39 bits (285), Expect = 4.809e-25
Identity = 149/579 (25.73%), Postives = 259/579 (44.73%), Query Frame = 2
Query:  512 KVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPF--FSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLL--KNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNV--SVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKD---KTHSLNYH-LDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMT--GIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWR 2212
            +V I++   N + P+F     ++ V E+  VG+ +    A D+D    G+  Y++        FS+  R   +  +V+ ++LD++ I   + N+T+   D G         L I +TD NDN P+F+  + + +I E+ P+G+ +F  +A+D DS     I++  LP  +  ++ +F +N + G +    S + +    + L ++A++ +      S   L + V   N   P   L       + E S  G  VG V A+D D  ++G+V  +L+   ND  +       +    +IY     R  DRE  +   + +  ++YG+          V  S+ D N+ PP F    Y+  ISE   + + +  +KA+DKD   + +  +Y  ++ ++   F+ID+  G +      DRE    Y + +   D       TG+ TV+I + DVNDN P  T  G+  + I EN      G  I  L   D D   N       L   +   H SW+        +D+    +   +S DRE     +  I + D G PK+ +  ++T+ V D+NDN    R
Sbjct: 3214 RVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNERQDFSVDER---TGGIVIQQQLDYDLIQEYHLNITV--QDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLP--SGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKNPDSS--MESYANLYVHVLGVNEFYPQF-LQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKGFRI-----DTNTGLIY---VARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGND-PPEFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREETSTYNLVIGAID-TGLPPQTGSATVHIELEDVNDNGPTFTPEGLNGY-ISENEPA---GTSIMTLIASDPDLPRNGGPFTYQL---IGGKHKSWL-------SVDRNSGVVRSTTSFDREMTPILEAIIEVEDSGKPKQKSQHLLTITVLDQNDNPSTTR 3758          

HSP 12 Score: 111.309 bits (277), Expect = 4.502e-24
Identity = 177/695 (25.47%), Postives = 282/695 (40.58%), Query Frame = 2
Query:  515 VFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQL--PLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSL-------TLVVLKKLDFENISHRYFNLTLIACDGG-TPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSK------FILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKN-DSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLN--YHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQ---ATDIDAKK-NSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQ---------ESGTYYLKIQATDNGSPPRFSDVTI 2503
            V + ++DINDN P F  +     V E++  G  +  P  T  DE L           +++  F+LL   M           +     LD E  S   ++LTL+A D   T  +     L I V+D NDN P FD T     + E    G  +F   A D D G    +++ +    + +++ YF++N  TG  V+ T L  K  +K      + + + A D+ G    SS+ +LT+ ++      P  +        + E+   G+ +  V A+       GK+   +      + L +D +  +        V     D EL   + I I   D   P  RS  L  ++V D N+  P      Y+  + E+      +  +KA D+D   + N  Y L    +  F+I    G +   +  DRE I  Y   V   DQ     +TGT +V + + D NDN P  T +    + EN +I   G+ +  + + DLD   NA                S+       F I+    N+ V   LDREQ D+Y L ++ SD      +    IT+ ++D+NDN+P + +     ++         L   I LV    ATD D +  NS ISY+              F+I    G +F  + ++             Y L + ATDNG PP +S+  +
Sbjct: 2477 VRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGL-----------NAKLRFNLLGEHMHRFHIDSETGEISTATTLDREETS--VYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTI----SGRDQHYFDINTKTG--VVSTKLELKTKTKSHDDLTYTIVISAMDQ-GEQSLSSKAELTVILRPPELF-PTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDSLRVDPNSGLLS------VGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRLQNDFDGTFEI-TESGEIYTRMRLDREEIGDYAFVVEAVDQ-GVPHMTGTASVLLHLLDKNDNPPKFTRLFSLNVTENAEI---GSFVIRVTSSDLDLGANANA------------SYSFSENPGEKFRIEPQSGNITVAGHLDREQQDEYILKVVASDGAWRAETP---ITITIQDQNDNAPEFEHSFYSFSF-------PELQQSIALVGQIIATDRDKQGPNSVISYSLQQP-------SPMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLV 3110          

HSP 13 Score: 109.383 bits (272), Expect = 1.543e-23
Identity = 183/724 (25.28%), Postives = 311/724 (42.96%), Query Frame = 2
Query:  512 KVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKF-IKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKND-SNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQD-------------------YGNP-----------PHRSFQLFNVSV------GDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHS--LNYHLDPSVND--------KFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQF--VIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGI--PKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKK-NSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTIITVKI 2518
            KV + + D ND+ P+F        VSE + +G+ +    A D D    G  ++ L D       L  P     L++   LD E  S   + L +   DG   VQ  +    I+V+D+NDN P+F+ T  Y F I E+   G  +    A DAD G   ++++ ++      N V F+LN  TG L L   L+ + V  +IL V+A+D NG    S+   +   V D N++API       S  + EN P    V  V A D D  +NG +   +   D  +   +D +  ++        T R  DRE    +T+ ++ +D                   Y +P            H+  Q  + +V       D+N+  P F  +N +  I E++ IN+ +I +KA+D D+  +  ++Y +  + ++         F ++   G L+ +   DRE+   Y++ +   D+      +  + + I + D NDN+PV    KQ+   + EN  I   G ++ ++   D+D   N  +   +    VL +        NH F I +    + V  +L+ E++ +Y L +   D  +  P     E +T+ + D NDN P +   +   A  +  T   N  + ++ V A D D    NS + Y     D +       F I   +G I + +  D ++   Y L + A D GSPP  +   I+ V++
Sbjct: 1808 KVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPDT--LGSVTFLLMDGHD-GKFLLEPSTG-KLILNDTLDRETKSK--YELRIRVSDG---VQYTEAYATIQVSDTNDNPPLFEDTV-YSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVV--SDWANDV-FSLNPQTGMLTLTARLDYEEVQHYILIVQAQD-NGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSS-EVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGDVDSEFGIDSNGTIR--------TRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFISANETA-IMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNITARDRGE-PPQSTESQLLIRILDENDNSPVFD-PKQYSASVAENASI---GAMVLQVSATDVDEGANGRIRYSI----VLGDQ-------NHDFSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAE-LTINILDINDNRPTF-LDSPYLARVMENTVPPNGGY-VLTVNAYDADTPPLNSQVRYFLKEGDSD------LFRINASSGDIALLKPLDREQQSEYTLTLVAMDTGSPP-LTGTGIVRVEV 2481          

HSP 14 Score: 102.064 bits (253), Expect = 2.958e-21
Identity = 160/683 (23.43%), Postives = 277/683 (40.56%), Query Frame = 2
Query:  557 FPT----KEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQ-TQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFN---TGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALD-RSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDK-------THSLN-----YHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXX-----XXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDL-----QESGTYYLKIQATDNGSPPRFSDVTIITV 2512
            FPT          +SE +  G  +   +A        G   Y +       SL   P   L  V    LD+E ++H Y  + + A DG TP       + + VTD+NDN P+ +Q   N + ++E +P   +I +  ASD DSG  G + ++L      +N   F+  F    +GE+     L+ + +  +   VEA D+ GV   +    + + + D+N++ P  +     SL + EN+  G  V  V +SD DL  N   +    +N      ++ +S N        +      DRE  D + + +   D      R+     +++ D N+  P F HS YS    E  +  + + QI A D+DK       ++SL      + +DP+  + F     K +      + R     Y + V  TD  +  + +                  +    +  + Q  +R    +  + N   +L T ++D S    +  +L S+  +  H  WI L+                  +      +Y+L +  +D G+P +S+   + ++V  EN ++P  R+  N  +YQV V     +   I+ V ATD D   N  + Y+    +       + F++  R GGI + + L     QE   Y+L I   D G  P  S V ++T+
Sbjct: 2700 FPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDSLRVDPNSGLLSVGQDGLDYE-LTHLY-EIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPP-QLIAVVKASDRDSGDNGNVIYRL------QND--FDGTFEITESGEIYTRMRLDREEIGDYAFVVEAVDQ-GVPHMTGTASVLLHLLDKNDNPPKFTR--LFSLNVTENAEIGSFVIRVTSSDLDLGANANASYSFSENPGEKFRIEPQSGN--------ITVAGHLDREQQDEYILKVVASDGA---WRAETPITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSLQQPSPMFSIDPATGEVFS---KKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTNEMDYSL---MTFNLSSIFSVGRHDGWITLVK----------------PIQVPPNTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTP--RFSVN--SYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGN-----ERQDFSVDERTGGIVIQQQLDYDLIQE---YHLNITVQDLGYHP-LSSVAMLTI 3322          

HSP 15 Score: 95.9005 bits (237), Expect = 2.145e-19
Identity = 144/621 (23.19%), Postives = 262/621 (42.19%), Query Frame = 2
Query: 1016 TKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEA-RDENGVGPFSSQ----CQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTC--VLLKNDSNYLALDRSHNMKDEIIY-RLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKD--KTHSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKY------------IVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMT------GIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQES--GTYYLKIQATDNGSPPRFSDVTIITV---------KISTAEKTNYLIKNSQISFTLIVVTSL-----ASFSICVALMVGIILMWRKSYPIQLNSDRTTGN------WDDPKTLQWEIS 2728
            TK K  +  N    E  L   +  ++ +  +LD E  RD   +   SSQ     ++ I+V D N+++P        +++  E++ +G  + +  A+D D+ +NG      ++  N  N   L  + N   +  Y  L TT   DRE    + + IS +D G+PP   +   NV++ D+N+ PP F HS+Y++ ++E     + ++ + A D D      + Y+L      +F ++   G++      +R   P+             +  VF  D        G T V + + D ND+ P+++      G K   + EN      G ++  +  +D D+  N      ++S     N +   R L  + ++   + N      LDRE+I KY L ++  D G P R+    + + V D ND+ P++     ++ Y   ++        +  + ATD D   N+ + Y+ ++   N L   K+F++    G I  +  L      T  L I A D G  P+F+   +  +         + S  E+   L +++     + ++T+       + S+  AL   +     + YP+Q   D  TG        D  K  Q+EIS
Sbjct:   88 TKPKFSYRFNEPPREFTL-DPVTGEVKTNVVLDREGMRDHYDLVVLSSQPTYPIEVRIKVLDVNDNSPEFPE-PSIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYL-AETEHQFTVNPETGVISTT---ERVNCPQQTNVKSSASQKSCVFTVFARDH-GSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENA---VNGTVVAAVAVKDSDSGLNGRTSVRIVS----GNELGHFR-LEEAADLHIVRVN----GVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFE----KSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSG--NEL---KWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNPKFAYTQLKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSV----ERLYPLQFALDALTGQLTTRRPLDREKMSQYEIS 676          

HSP 16 Score: 80.1073 bits (196), Expect = 1.371e-14
Identity = 102/399 (25.56%), Postives = 175/399 (43.86%), Query Frame = 2
Query:  500 DHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLL-------YRPMFSLTLV-VLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQ--IEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGL------FGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLT--IMENSPAGEHVGMVIASDGDLEDNGKVTCVLL--KNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSF--YHSNYSIFISEDIEINSALIQIKALDKD 1630
            + +  +++ +  +N+  P+F        VSE+ AVG ++    A D+D         + ED   ++ L+       +R   +  L+ V + LD E  +     LT++A + G+    D  + Q  I + D ND  P F +      I E+ P+G+ +    A D D         +  IN  L        K  F ++  TGE+   + L+ +  S + L + A D  G+ P +    + I ++D N++ P  +    E L   I EN PAG  +  +IASD DL  NG      L      ++L++DR+  +       + +T  FDRE+      +I  +D G P  +S  L  ++V D N+ P +    H   S+F + D+  N  L  ++  D D
Sbjct: 3420 ESYANLYVHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKD---------SGEDGRVYYLLVGSSNDKGFRIDTNTGLIYVARHLDRE--TQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGNDP-PEFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNL--------KQSFKIDVQTGEISTASRLDREETSTYNLVIGAID-TGLPPQTGSATVHIELEDVNDNGPTFT---PEGLNGYISENEPAGTSIMTLIASDPDLPRNGGPFTYQLIGGKHKSWLSVDRNSGV-------VRSTTSFDREMTPILEAIIEVEDSGKPKQKSQHLLTITVLDQNDNPSTTRSLHIAVSLF-NGDLPSNVKLADVRPNDID 3786          

HSP 17 Score: 63.1586 bits (152), Expect = 2.017e-9
Identity = 46/165 (27.88%), Postives = 82/165 (49.70%), Query Frame = 2
Query: 2036 FEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNG-SPPRFSDVTIITVKIS 2521
            F I+    ++ +   LDREQ  +Y L ++  D G P  +   I+ V V+D NDN P++  Q+     + N+ + T++  P    +ATD D   N+ + +N +   ++       F I +  G I  +   D +E+  Y+L + A D+  + PR S V  +T+ +S
Sbjct: 2434 FRINASSGDIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTP----RATDKDEGLNAKLRFNLLGEHMHR------FHIDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVN-LTISVS 2587          

HSP 18 Score: 57.7658 bits (138), Expect = 9.768e-8
Identity = 53/179 (29.61%), Postives = 85/179 (47.49%), Query Frame = 2
Query: 2063 LFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQV--NVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGI------------FMSRDLQESG----------TYYLKIQAT--DNGSPPRFSDVTIITVKIS 2521
            LFV++ LDRE+ D Y L +   D G P RS++  + + V DENDN+P  ++ N+   + +  N  A+T +      + A D D  +N+ +S+   +   +       FTI TRNG I             +SR+ + SG            Y+ ++AT  DNG  PR  D   + V ++
Sbjct: 1105 LFVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAP--QFTNSTFTFSIPENAPADTFVGK----LTAVDRDIGRNAELSFTLSSQTQD-------FTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGI-PRLQDKVKVKVIVT 1269          

HSP 19 Score: 53.5286 bits (127), Expect = 1.597e-6
Identity = 94/428 (21.96%), Postives = 162/428 (37.85%), Query Frame = 2
Query: 1154 SQCQLTIRVQDENNHAPILSLGDRES---LTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKD--KTHSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKS--SLDREQIDKYK----------------------LNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNND 2350
             QC + I + D N++AP+ +L DRES   +++ EN+  G+ + +    D D   N +++  L  N +    +         +   L   R    E      + +   D G+PP  S    +V + D+N+  P F H++Y   + E  ++N+    + A D D      ++Y +     ++       G L      DRE    Y + V   D  + +  +    V   + + ++          F I EN    T+   +G+L   D D   NA +   L S                 F ID    N F+K+    DRE + K                        L   +SD GIP+  +   + V+V D NDN+P +     +  Y V ++   +    I  V   D D   N ++ Y+    +
Sbjct:  924 GQCIVNIAIIDLNDNAPVFAL-DRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLTNNPNQQFRI-------GPVTGVLYLQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERMFGVFPDGYLFVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTF---VGKLTAVDRDIGRNAELSFTLSS-------------QTQDFTIDTR--NGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFL----RAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGN 1321          

HSP 20 Score: 51.6026 bits (122), Expect = 6.189e-6
Identity = 41/162 (25.31%), Postives = 76/162 (46.91%), Query Frame = 2
Query: 2027 NHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTII 2506
            N  F I      L+++  +  E      + ++ +D G P  S+   ++V++ D ND++P++    + T+Y+ ++   T +N     + ATDID   N  ISY  +  +      E+ F +   +G +F+    D +E   Y L +   D G P R S V ++
Sbjct:  989 NQQFRIGPVTGVLYLQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVF----DHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNT-----ERMFGVFP-DGYLFVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVV 1140          
BLAST of Protocadherin-1 vs. Ensembl Fly
Match: kug (gene:FBgn0261574 transcript:FBtr0346077)

HSP 1 Score: 144.05 bits (362), Expect = 4.397e-34
Identity = 160/587 (27.26%), Postives = 266/587 (45.32%), Query Frame = 2
Query:  731 LVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFV-IRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFM--SRDLQESGTYYLKIQATDNGSPP 2482
            L++ + LD E       NL ++A     PV      + I+V D NDN P FD T     + E++     +   +A+DAD+G  G I +  L + T   +  F+++  +G + L+TSL+ ++ S++   V A D NG     ++  +TI++ D N++AP+  L   E L++ EN+  G  +  ++  D D+E       ++  +      + +S          L   +  DRE L ++ + I   D       + +   + V DIN+  P      Y I  +E I I + L+++KA+D D    L ++L     D F I    GILK     DRE  PKY +   V D  +       + + ITV D+NDN P+ +  +  V + E+ Q+ T   LI ++   D D   N  +   L+      NH          F+I K    + +  SLDRE I  + L +   D G+PK  ++  + V + D NDN P +  +        N T  T     +  V AT ID   N++I Y  ++ +      +  F + +  G + +  + D + S  Y+L IQA D G+PP
Sbjct: 2812 LILQQTLDREQ--QESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRY-YLESDTENIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAAD-NGHPKHDAKVPVTIKIVDYNDNAPVFKL-PIEGLSVFENALPGTVLINLLLIDPDIEKQEMDFFIVSGDKQAQFQIGKSG--------ELFIAKPLDREQLMFYNLSIIATDGKFTAKANVE---IDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFDFQSKLRFYLSGKGADDFSIGKESGILKVASALDRETTPKYKLVAHVQDG-KDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNT---LITKVHAMDKDFGVNRQIKYSLMG----ENH--------DYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTE----VCKVYATSIDIGVNADIHYFIMSGN-----EQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPP 3357          

HSP 2 Score: 135.191 bits (339), Expect = 2.342e-31
Identity = 165/672 (24.55%), Postives = 289/672 (43.01%), Query Frame = 2
Query:  539 NDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSL-----TLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRL--VTTRVFDRELLDY-----FTIMISCQDYGNPPHRSFQLFNVSVGDINE--FPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDKFQIDI----NKGILKNIVHFDREVIPKYIVPVFVTD----QVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEID-KYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESGTYYLKIQATDNGSPPR 2485
            N ++P+F    + + ++ES+ +G  +    A D DL Y G   + + D +      Y  +F +      L ++  LD E  +    N+T+   D G P +   + L I + D NDN P+  +T     + ES  IG+V+   +A+DADSG+  ++ + L    +      F +N  TG L L   L+ +    + L + A+D  G    SS+  + + V D N++AP+  + +     + E+ P G  + ++ A D D+  N ++   L                +DE ++R+   T  +  +  LDY       +++S  D G+P   S     + + D+NE  F P F    Y   + E+    + ++ + A D D T  LN  +  S+     + I    ++G + ++   D E    Y + +   D     +   +                + PV          ENV+I+T       L+  D D     T+  +++S +++             FEID K       +  LDRE   ++ L + ISD G P  S+   I V V D NDNSP +    +Q  Y+V V +   +N  I  V A D D+ +N  I+Y+     + S   +  F I ++ G I +++ L     + + I+A DNG P +
Sbjct:  766 NVHRPEFVNFPQELSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDGD------YDSVFRIDPDRGELQIIGYLDRERQNEYVLNITVY--DLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYALSVECSD-----FTVNATTGCLRLNKPLDREKQDNYALHITAKD-GGSPVLSSEALVYVLVDDVNDNAPVFGVQEY-IFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSL------------KEETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMD-TVDLNSKITYSITGGDGLGIFAVNDQGSITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIIT-------LKAFDPDIDPTQTITYNIVSGNLVG-----------YFEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEF----DQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYS-----IKSGKGKNKFRIDSQRGHIHIAKPLDSDNEFEIHIKAEDNGIPKK 1382          

HSP 3 Score: 126.331 bits (316), Expect = 1.075e-28
Identity = 169/691 (24.46%), Postives = 295/691 (42.69%), Query Frame = 2
Query:  488 HAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLE-----YFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQC--QLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYH---LDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMS----RDLQESGTYYLKIQATDNGSPPRFSDVTIITVKI 2518
            H   D  + V I I D NDN P F    + + V E+   G  L     +D D+E     +F V      D +  F +      S  L + K LD E +   ++NL++IA DG       K  ++I+V D NDN P   + + +    ES  IG+ +    A D D     K+ F L    + K    F++   +G L + ++L+ +   K+ L    +D      F+ +C  ++ I V D N++ PI S+  +  +++ E++     +  V A D D   N ++   L+  + +Y  + +S       I RL   +  DRE +  F + +  +D G P   S     V++ DIN+ PP F    YS  I E+    + + ++ A   D   + + H   +  +   KF++D   G L      D E+   Y + +   D     +          +   +++   +  + +  + E++ +   G+ I +++  D D+  N  V  ++     +             F ID     + V   LDRE I  Y L I   D G P+R N   I + + D NDN+PI+   N    Y V +     L +  +  + +D D   N+   Y F   D+ S      F  L ++G +  +     +LQ+   + ++++  DNG+PP +SD  ++ VKI
Sbjct: 2944 HPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDIEKQEMDFFIVSG----DKQAQFQIGK----SGELFIAKPLDREQL--MFYNLSIIATDGKFTA---KANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFD--FQSKLRFYL----SGKGADDFSIGKESGILKVASALDRETTPKYKLVAHVQDGKD---FTQECFSEIIITVNDINDNMPIFSMA-QYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYFKISKSTG-----IIRL--HKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQNLYRINVNEDIFV---GSKILDVKATDEDSDVNGLVTYNIERGDNIGQ-----------FSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAPIFSSSN----YSVVLQENRLLGYVFLTFKISDADETPNTT-PYTF---DIRSGNEGGLFR-LEQDGSLRTASRFNHNLQDE--FVIQVRVFDNGTPPLYSDAWVV-VKI 3578          

HSP 4 Score: 119.013 bits (297), Expect = 2.164e-26
Identity = 164/685 (23.94%), Postives = 295/685 (43.07%), Query Frame = 2
Query:  503 HWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQ----LTIRVQDENNHAPILSLGDRESLT-IMENSPAGEHVGMVIASDGDLE------DNGKVTCVLLKNDSN--YLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHL----DPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVN-SLWYEKYFTILTRNGGIFMSRDLQESGTYYLKIQATDNGSPPRFSDVTI 2503
            + ++V+I +E+ NDN P        + V+E+     ++    A D D++     +YN+                +     +KLD EN +     + +   D G+PV     ++ + V D NDN+P FDQ      +  S  +   IF  +A D+DSG  G+I + +   ++ K K  F ++   G + +   L++   ++F + ++A D NG+ P  SQ      + + V   + +AP++     E++  + EN   G  V  ++A D D +       NG        ND N  Y+  D  +         ++ ++  D E    + + IS  D       +F    V V DIN+ PP F    Y + ISE+IE  S ++Q+ A D+D+   L YHL    DPS    F+ID   G +      D E   ++I+ VFV DQ           +       + +      I Q  + E+  I   G+ + E++  D D+ +NA +   +++ +V S            FEID     + +  +L+  +I +Y L +   DLG P  S+   + ++V    ++ P  ++  N      N+  E   N PI     T + A+ +S+I +N ++ ++N S        ++  NG I    D +    + L ++ T+  +     ++ I
Sbjct: 1175 NCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAI--SDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSI---KSGKGKNKFRIDSQRGHIHIAKPLDSD--NEFEIHIKAED-NGI-PKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVDDDNDQLWYNISNG--------NDDNTFYIGQDNGN---------ILLSKYLDYETQQSYNLTISVTD---GTFTAFTNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATDRDEDKKLFYHLHATQDPSSLALFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAI---GSKLAEVRAIDRDSGHNAEIQYSIITGNVGS-----------VFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVTMSENDPP--KFPTN------NIAIEIFENLPIGTF-VTQVTARSSSSIFFNIISGNINESFRINPSTGVIVINGNI----DYESIKVFNLTVKGTNMAAESSCQNIII 1803          

HSP 5 Score: 116.316 bits (290), Expect = 1.192e-25
Identity = 167/686 (24.34%), Postives = 282/686 (41.11%), Query Frame = 2
Query:  512 KVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLED--SEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQ-KLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTC---VLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDK-----FQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTIITVKISTAE 2530
            KV I ++D+NDN P F    K I ++E+   G+ +   TA D D       SY++ +  + PF        FS  +     LDFE +  R + L + A D G P +   + KL I V D NDN P F++   Y  + +S P+G+ +F+ +A D D+G    I+++L           FNL+  +G L +   L    ++  IL V A D      FS    + + +  E+       LG   S+                     L   G   C    + +  +  L+L   +N+K        +  VF         + ++   YG   HR                P F +    + I+E +++   +  I+A D+D  +  N  L  +++D      F+ID ++G L+ I + DRE   +Y++ + V D    T  T        +   ++   +   +  F + E+ +I   G ++  L   D D+  NA V       + LS   S        F ++     L +   LDRE+ D Y L+I   D G P  S+  ++ V+V+D NDN+P++  Q     Y   V  +      + +++A D D   N+ I ++      +    E+ F I    G I      D +    + L + A D G P   SD++I+ + I   E
Sbjct:  492 KVKISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLTAKDRDSGENSYISYSIANLNAVPF----EIDHFSGIVKTTSLLDFETMK-RNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFERVNCYGKVTKSAPMGTEVFVTSAIDFDAGDI--ISYRLSDGNEDG---CFNLDPTSGSLSISCDLKKTTLTNRILKVSATDGTH---FSDDLIINVHLMPED-------LGGDSSI---------------------LHGFGSFECRETGVARRLAETLSLAEKNNVKS------ASPSVFS-------DLSLTPSRYGQNVHR----------------PEFVNFPQELSINESVQLGETVAWIEAKDRDLGY--NGKLVFAISDGDYDSVFRIDPDRGELQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARI---GTVVHCLHATDADSGINAQVT------YALSVECS-------DFTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQE----YIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQD----EELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNE 1081          

HSP 6 Score: 107.842 bits (268), Expect = 4.774e-23
Identity = 184/782 (23.53%), Postives = 334/782 (42.71%), Query Frame = 2
Query:  227 EANVVKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLDFKGHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFPDHWIK----VFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNN--PIFDQTQNYKFIKESTPIGSVIFIFNASDADS-GLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVI--ASDGDLEDNGKVTC-VLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHS--LNYHLDPSVN-DKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQV--RXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLN----HSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNF-VNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTII 2506
            +  +  +RL E + I T++ +    + ++     +  +   +  +D   N T     G L +NK +DRE       K D+  L +         +     V+++++D+NDN P F  +E   KV E +  G  L +  A+DED+       ++L++      L      +  +     LD+EN   +  NL + A DGG P       + I + D N+N   P FD       +KE+ P G+ +    A D D+  L  KI + +           F +N + G +  ++ L+A+  + + L + A+D   + P S+  ++ I+V++EN++ P   L D+    +     + E+V ++   A D D++    +T  ++  N   Y  +D     K  +I    T R  DRE      + ++  D G+P   S     VSV DIN+  P F    Y + +     +N ++ Q+ A+D D   +  + Y +      +KF+ID  +G +      D +   ++ + +   D    + +       V + V   + N P++  +++    ENV  LT  +  G L TQ             +L+V    N   W  + N    ++F I +   N+ +   LD E    Y L I ++D      +N+    V V D NDN P    Q  +  Y VN++        I+ + ATD D  K   + Y+     D +SL     F I + +G + +++  D +++  + L +   D G+P + +   II
Sbjct:  878 QKTLATFRLTESARIGTVV-HCLHATDADSGINAQVTYALSVECSDFTVNATT----GCLRLNKPLDRE-------KQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQDEELFRIDKHTGAIRTQGYLDYEN--KQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLG---IFAVN-DQGSITSLSQLDAETKNFYWLTLCAQD-CAIVPLSNCVEVYIQVENENDNIP---LTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDS----KTGVIK--TTERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNKFRIDSQRGHIHIAKPLDSD--NEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLI--VRK--TSENVVDLTENDKPGFLVTQ-------------ILAVDD-DNDQLWYNISNGNDDNTFYIGQDNGNILLSKYLDYETQQSYNLTISVTDGTFTAFTNL---LVQVIDINDNPP----QFAKDVYHVNISENIEEESVIMQLHATDRDEDK--KLFYHLHATQDPSSL---ALFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKII 1599          

HSP 7 Score: 105.145 bits (261), Expect = 3.004e-22
Identity = 107/362 (29.56%), Postives = 162/362 (44.75%), Query Frame = 2
Query:  296 EDSRSEYMRKPKENFTY-----KIYTTDID------------SNLTKLDFK-----GHLLVNKRIDRE---FLCPNVDKIDDCQLELMIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLED 1306
            E S  +Y  K  EN T+     K+Y T ID            S   +  FK     G L++N  +D E   F    +  ID     L  +A+      V I I DINDN P F     RI V+E I VG+++    A DED +  G+ +YN+E  +        P  + T+ V + LD E ISH  + L + ACD G P +C+   + I + D+NDN PIF  +     ++E+  +G V   F  SDAD              R+      F L    G L   +  N  +  +F++ V   D NG  P  S   + +++ +E+ + PI++  +  ++   E+  +G  +G V ASD D  D
Sbjct: 3272 EFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAY------VNISILDINDNSPTFLQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQFSIDPK-NGTISVSRPLDRETISH--YTLEIQACDQGDPQRCNSVPININILDTNDNAPIFSSSNYSVVLQENRLLGYVFLTFKISDADET--PNTTPYTFDIRSGNEGGLFRLE-QDGSLRTASRFNHNLQDEFVIQVRVFD-NGTPPLYSDAWVVVKIIEESQYPPIVTPLEV-TINSFEDDFSGAFIGKVHASDQDKYD 3619          

HSP 8 Score: 103.605 bits (257), Expect = 1.021e-21
Identity = 147/574 (25.61%), Postives = 252/574 (43.90%), Query Frame = 2
Query:  839 LQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDE----NGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCV-LLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLD---PSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXX-XXXXXPVMTGIKQFV-IRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDK-YKLNIIISDLGIPKRSNMEI-ITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQES--GTYYLKIQATDNGSPPRFSDVTIITVKI 2518
            + I+V D ND +P+F  TQ    I E TP    I    A DAD G+ G+I + LL      +  YF ++  TGE+ L+  L     S F L V A D     N     +S+ +++I V+  N +AP +      S+T   N       G+V  +D D   NG +  + ++  + +   L ++   KDE    L      +++   Y   +++ +D G P   +++   + +   ++  P F    Y + I E   IN  +I++K  D D   +   +L+    +  D+F+I+ + G+L      D E    Y + V   DQ        ++         +NDN P+   + + + I EN      G+ + +L  +D D+  N+ +   + +++ +             FEID +   +   S LD E + + Y+L I  SD G+P R   EI ++++V+D NDN P +   N    Y   VT    +   + +  A D DA     ISY   + + +       F +   +G + +S DL+++      LK+ ATD      FSD  II V +
Sbjct:  169 IHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDADLGINGEIYYSLL-----MDSEYFAIHPTTGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSVTPTSNPLI---YGIVRVNDKDTGINGNIGRLEIVDGNPDGTFLLKAAETKDEYYIELNQFAHLNQQHFIYNLTLLA-EDLGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDEFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENN---LAGSFVVKLTAKDRDSGENSYISYSIANLNAV------------PFEIDHFSGIVKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFERVN---CYG-KVTKSAPMGTEVFVTSAIDFDA--GDIISYRLSDGNEDGC-----FNLDPTSGSLSISCDLKKTTLTNRILKVSATDG---THFSDDLIINVHL 704          

HSP 9 Score: 95.1301 bits (235), Expect = 3.497e-19
Identity = 114/440 (25.91%), Postives = 198/440 (45.00%), Query Frame = 2
Query:  398 GHLLVNKRIDREFLCP-NVD-KIDDCQLELMIHAFPDHWIK-VFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQL------PLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLK--NDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDKFQ 1684
            G + ++K +DRE +   N+  K +DC +  +      H I  V + I DINDN P+F  ++   K+ E+   G ++       +   ++ D+ YF + S N +      S       +  LV+   LD+E +S  YF LT+ A DGGTP   +   + I + D NDN+P F Q      + E   +GS I    A+D DS + G + + +       N   F+++   G + +   L+ + +S + L+++A D+ G     +   + I + D N++API S  +  S+ + EN   G        SD D   N       ++  N+     L++  +++        T   F+  L D F I +   D G PP  S     V + + +++PP       +I   ED    + + ++ A D+DK   LN+ L    +D +Q
Sbjct: 3223 GIIRLHKSLDRETISLFNLTVKAEDCGVPKL------HSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYF-IMSGNEQGKFKMDST------TGDLVLNATLDYE-MSKFYF-LTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNI---ERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACDQ-GDPQRCNSVPININILDTNDNAPIFSSSNY-SVVLQENRLLGYVFLTFKISDADETPNTTPYTFDIRSGNEGGLFRLEQDGSLR--------TASRFNHNLQDEFVIQVRVFDNGTPPLYSDAWVVVKIIEESQYPPIVTPLEVTINSFEDDFSGAFIGKVHASDQDKYDELNFSLVSGPDDMYQ 3634          

HSP 10 Score: 90.5077 bits (223), Expect = 8.758e-18
Identity = 169/698 (24.21%), Postives = 291/698 (41.69%), Query Frame = 2
Query:  521 IIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKF-IKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQD--ENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLED-NGKVTCVLLKNDS-NYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDK--DKTHSLNYHL-DPSVNDKFQIDINKGILKNIVH-FDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQ--DLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHS---------FEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNME---IITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWY-------EKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTIITVKI 2518
            I I D+NDN+P         +++ES  +G  +    A D D       +Y L      F++      +  L + K LD E   +  + L + A DGG+PV   +  + + V D NDN P+F   Q Y F ++E  P G+V+ +  A D D G   +I F L     T+++  F ++ +TG +     L+ +      L V A D  G    +S   + I + D  EN  AP       E   + EN P G  V  V A D D  D N K+T  +   D     A++   +        + +    D E  +++ + +  QD    P  +     + V + N+  P      Y + ++E    N  +I +KA D   D T ++ Y++   ++   F+ID   G++K      DRE   ++I+ V ++D                       +PV++   + V    V +L   +   E   +   +    +ATV   +  VH + +       + +S         F ID  + ++ +   LD +  ++++++I   D GIPK+S      I+ V V   + N+P+   + ++     NV   T  + P  LV  T I A          V++D + LWY       +  F I   NG I +S+  D +   +Y L I  TD G+   F+++ +  + I
Sbjct:  865 ITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYALSVECSDFTV---NATTGCLRLNKPLDREKQDN--YALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFG-VQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSL--KEETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAID-GGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEG-KVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGIFAVNDQGS--------ITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAISDN---------------------GSPVLSSTSRIV----VSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNKFRIDSQRGHIHIAKPLDSD--NEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSE-----NVVDLTENDKPGFLV--TQILA----------VDDDNDQLWYNISNGNDDNTFYIGQDNGNILLSKYLDYETQQSYNLTISVTD-GTFTAFTNLLVQVIDI 1499          

HSP 11 Score: 85.5001 bits (210), Expect = 3.045e-16
Identity = 87/342 (25.44%), Postives = 153/342 (44.74%), Query Frame = 2
Query:  761 NISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFS-SQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDY-FTIMISCQDYGNPPHRSFQL-FNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHL-DPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTD 1774
            N  H  +NLTL+A D GTP +   + + I++   + N PIF Q      I E+ PI   +     SD D G    +  +++          F +N ++G L     L+A+  S + L V A D+  VG    S  ++ I VQD N++ PI    ++  ++I EN+ AG  V  + A D D  +N  ++  +   ++    +D    +       + TT + D E +   + ++I   D+G P  R  ++  ++ V DIN+  P F   N    +++   + + +    A+D D    ++Y L D + +  F +D   G L       +  +   I+ V  TD
Sbjct:  360 NQQHFIYNLTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDE---FRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNK-VISINENNLAGSFVVKLTAKDRDSGENSYISYSIANLNAVPFEIDHFSGI-------VKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFERVNCYGKVTKSAPMGTEVFVTSAIDFDAGDIISYRLSDGNEDGCFNLDPTSGSLSISCDLKKTTLTNRILKVSATD 690          

HSP 12 Score: 76.6406 bits (187), Expect = 1.381e-13
Identity = 164/695 (23.60%), Postives = 295/695 (42.45%), Query Frame = 2
Query:  521 IIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVT----CVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKD--KTHSLNYHLDPSVN-DKFQIDINKGI--LKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVM-TGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESG--TYYLKIQATDNGSPPRFSDVTI------ITVKISTAEKTNYLIK 2551
            I + D+NDN P F        VS     G  +    A+D D    G   Y L+        L R   S  L + + ++  N   R + LT+ A DG       +  LQ++V D   + P+F++      +KE   + S + +  + +A+S L   + + +     +     F +++NTG + ++  L+ + +S    DV  R  + +    ++  L++ + D N+  P +   D  +LTI EN+  G  +  + A+D D   N K++     +  +N+S    +D +          L      D E + Y  I+++ +D+G+P   S     ++V D+N+  P F   +Y   +S        +   KA DKD   T SL Y +        + ID   G+  L+N+++F  +     ++ + V+D V     T    + I++   N  +P+      +  + EN   L +G+ I  ++  D D    A      L   ++S  M  I      F ID+    +  K + DRE+ D+Y + + +SD G   +     + V+V D NDN P +  +     Y++ V+     N  I+ V+A D D   N ++ +  V    N    +    I  + G I      +  G  +Y   ++A+D G P   S+V +          I T EK++ L+K
Sbjct: 2128 ISVLDVNDNCPLFVNMPYYATVSIDDPKGTIIMQVKAIDLDSAENGEVRYELKKGNGELFKLDRK--SGELSIKQHVEGHN---RNYELTVAAYDGAITPCSSEAPLQVKVIDR--SMPVFEKQFYTVSVKEDVEMYSALSV--SIEAESPLGRSLIYTI-----SSESQSFEIDYNTGSIFVVNELDYEKISSH--DVSIRATDSLSGVYAEVVLSVSIMDVNDCYPEIE-SDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNNSELFYIDVTDG-------NLYLKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCFVEPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNELQTYSIDKLTGVISLQNMLNFTDK--SSTVLNISVSDGVH----TAYARLKISLLPENVYSPLFDQSTYEAQVPEN---LLHGHNIITVKASDGDFGTYAN-----LYYEIVSEEMKKI------FLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGG--GKFGFASLKVIVVDVNDNVPYFLLKE----YKMVVSTTVEANQTILTVKAKDDDIVDNGSVHFQIVQKS-NDKAVKDVIEINEKTGDIVFKSKAESYGVNSYQFFVRASDRGEPQFHSEVPVSIEIIETDANIPTFEKSSVLLK 2771          

HSP 13 Score: 75.8702 bits (185), Expect = 2.802e-13
Identity = 142/608 (23.36%), Postives = 241/608 (39.64%), Query Frame = 2
Query:  767 SHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRV--FDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKD-KTHSLNYHLDPSVNDKFQIDINK-GILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNH-------MSWIRLLNHSFE----------------IDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQES--GTYYLKIQATDNGSPPRFSDVTI 2503
            S+++F   + A D G P    +  + IE+ +++ N P F+++     I ESTP G+V+   +       + G   FK   A    ++ +F ++ ++GEL+L  +L+ +      L V A + + V  F +   + I V+DEN++ P        S ++ ENS     +  V A+D D   NG +   L  +  N        N+ D  IY    T +   DRE+   +   +   D G+P H +     + + D N+  P F      + + E+    + LI +  +D D +   +++ +  S + + Q  I K G L      DRE +  Y + +  TD                               +F  + NV+I             D+ +  + T  C     H+ +N        +  ++ ++  F+                I K    L V S+LDRE   KYKL   + D     +     I + V D NDN PI+    +   Y+V+V  +  LN  I  V A D D   N  I Y+ +  +        YF I    G I + + L       + L ++A D G P   S  T+
Sbjct: 2728 SYQFF---VRASDRGEPQFHSEVPVSIEIIETDANIPTFEKSSVLLKIIESTPPGTVLTKLH-------MIGNYTFKFSIA---ADQDHFMIS-DSGELILQQTLDREQQESHNLIVVA-ETSTVPVFFAYADVLIDVRDENDNYPKFD-NTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTENI------QNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDIEKQEMDFFI-VSGDKQAQFQIGKSGELFIAKPLDREQLMFYNLSIIATD------------------------------GKFTAKANVEI-------------DVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFDFQSKLRFYLSGKGADDFSIGKESGILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIF----SMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGEN------HDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATV 3259          

HSP 14 Score: 66.6254 bits (161), Expect = 1.931e-10
Identity = 103/395 (26.08%), Postives = 168/395 (42.53%), Query Frame = 2
Query: 1166 LTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSAL-IQIKALDKDKTHSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHS--FEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFV 2341
            + I V D N++ P+  +      T+  + P G  +  V A D D  +NG+V   L K +     LDR     +  I + V     + EL       ++  D    P  S     V V  I+   P F    Y++ + ED+E+ SAL + I+A +     SL Y +  S +  F+ID N G +  +   D E I  + V +  TD + G       +V I   +      + + I    I EN    ++G  I ++   D D+  NA           LS ++  I   N+S  F ID    NL++K+ LD EQI  + + + + D G P  S+   + + V+D NDN+P +     + +Y   V+        + L +A D D     ++ Y  V
Sbjct: 2126 IDISVLDVNDNCPLF-VNMPYYATVSIDDPKGTIIMQVKAIDLDSAENGEVRYELKKGNGELFKLDRKSG--ELSIKQHVEGHNRNYEL------TVAAYDGAITPCSSEAPLQVKV--IDRSMPVFEKQFYTVSVKEDVEMYSALSVSIEA-ESPLGRSLIYTIS-SESQSFEIDYNTGSIFVVNELDYEKISSHDVSIRATDSLSGVYAEVVLSVSIMDVNDCYPE-IESDIYNLTIPENA---SFGTQILKINATDNDSGANAK----------LSYYIESINGQNNSELFYIDVTDGNLYLKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCFV----EPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIV 2489          

HSP 15 Score: 66.6254 bits (161), Expect = 1.948e-10
Identity = 151/717 (21.06%), Postives = 290/717 (40.45%), Query Frame = 2
Query:  503 HWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQ-LTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIAS----------DGDLEDNGKVTCVLLKN-DSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVG--DINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHL-DPSVNDKFQIDINKGIL--KNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTY--GNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMS---WIRLLNHSFEIDKYKCNLFVKSS---LDREQIDKYKL-----NIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQ-ESGTYYLKIQATDNGSPPRFSD----VTIITVKISTAEKTNYLI 2548
            ++ K+ + + D ND+ P+F  K  + KV ES A+G++L    A+D D  +     Y++            P F + + +   L+   I    + L + A D G P    +  + I VT S ++ P F        I E+ PIG+ +    A  + S  F  I+  +  +        F +N +TG +V+  +++ + +  F L V+  +        S CQ + I + D N++ P   + +     + E++  G +V  V  S          D D+  NG V   ++ +   N+  +D +    + +       R  D E    +T  ++  D G P   S    +V++   ++N+ PP F     ++ +      N  + Q+ A D D   +L + + D + N+ FQI+   GI+  +N    + E    Y + V  +D                            GI   ++   +++L+    N   + ++       N T V  +  V+V+ N +      R+LN +   D    +  +K++    DRE  D Y+L     +++   +    R  +  I + V D NDN P++        Y   V+ +      I+ V+A D+D+ +N  + Y     +       + F +  ++G + + + ++  +  Y L + A D    P  S+    V +I   +   EK  Y +
Sbjct: 1594 NYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGSVFEIDPTFGI-ITLAGNLNINKIQE--YMLQVKAVDLGNPPLSSQIPVHIIVTMSENDPPKFPTNNIAIEIFENLPIGTFVTQVTARSSSSIFFNIISGNINES--------FRINPSTGVIVINGNIDYESIKVFNLTVKGTNMAA----ESSCQNIIIHILDANDNIPYF-VQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVDDLAKNFFKIDSTTGAIELL-------RQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTIRVINVNDCPPVFNERELNVTLFLPTFENVFVRQVSAKDADN-DTLRFDIVDGNTNECFQIEKYTGIITTRNFEILNNENDRDYALHVRASD----------------------------GIFSAILIVKIKVLSAIDSNFAFQRESYRFSAFENNTKVATIGLVNVIGNTLDENVEYRILNPTQLFDIGISSGALKTTGVIFDREVKDLYRLFVEAKSMLYDGMNSNVRRAVTSIDISVLDVNDNCPLFV----NMPYYATVSIDDPKGTIIMQVKAIDLDSAENGEVRYELKKGN------GELFKLDRKSGELSIKQHVEGHNRNYELTVAAYDGAITPCSSEAPLQVKVIDRSMPVFEKQFYTV 2248          

HSP 16 Score: 51.6026 bits (122), Expect = 6.705e-6
Identity = 44/159 (27.67%), Postives = 75/159 (47.17%), Query Frame = 2
Query: 2063 LFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLW-------YEKYFTILTRNGGIFMSRDLQESGTYYLKIQATDNGSPPRFSDVTIITVKI 2518
            L ++ +LDREQ + + L ++     +P       + + V DENDN P +    + T Y  +V   +     ++ V ATD D   N +I Y ++ +D  ++        Y  + T+LT      + R++Q    Y  K+ A DNG P   + V  +T+KI
Sbjct: 2812 LILQQTLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKF----DNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRY-YLESDTENIQNIFDIDIYSGWITLLTS-----LDREVQSE--YNFKVIAADNGHPKHDAKVP-VTIKI 2957          

HSP 17 Score: 51.2174 bits (121), Expect = 8.558e-6
Identity = 80/334 (23.95%), Postives = 139/334 (41.62%), Query Frame = 2
Query:  839 LQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPIL-----SLGDRE--------SLTIMENSPAGEHVGMVIASDG-DLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHS--LNYHLDPSVNDK-----FQIDINKGILKNIVHFDREVIPKYIVPVFVTDQ 1777
            + I V D NDN P+F     Y  +    P G++I    A D DS   G++ ++L       N   F L+  +GEL +   +       + L V A D   + P SS+  L ++V D +   P+      ++  +E        S++I   SP G  +   I+S+    E +     + + N+ +Y  +  SH+         V+ R  D     Y  +++S                VS+ D+N+  P      Y++ I E+    + +++I A D D   +  L+Y+++ S+N +     F ID+  G L      D E I  + + V V D 
Sbjct: 2126 IDISVLDVNDNCPLFVNMPYYATVSIDDPKGTIIMQVKAIDLDSAENGEVRYELKKG----NGELFKLDRKSGELSIKQHVEGH-NRNYELTVAAYD-GAITPCSSEAPLQVKVIDRS--MPVFEKQFYTVSVKEDVEMYSALSVSIEAESPLGRSLIYTISSESQSFEIDYNTGSIFVVNELDYEKI-SSHD---------VSIRATDSLSGVYAEVVLS----------------VSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIE-SINGQNNSELFYIDVTDGNLYLKTPLDYEQIKYHHIVVNVKDH 2424          
BLAST of Protocadherin-1 vs. Ensembl Fly
Match: kug (gene:FBgn0261574 transcript:FBtr0332721)

HSP 1 Score: 144.05 bits (362), Expect = 4.397e-34
Identity = 160/587 (27.26%), Postives = 266/587 (45.32%), Query Frame = 2
Query:  731 LVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFV-IRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFM--SRDLQESGTYYLKIQATDNGSPP 2482
            L++ + LD E       NL ++A     PV      + I+V D NDN P FD T     + E++     +   +A+DAD+G  G I +  L + T   +  F+++  +G + L+TSL+ ++ S++   V A D NG     ++  +TI++ D N++AP+  L   E L++ EN+  G  +  ++  D D+E       ++  +      + +S          L   +  DRE L ++ + I   D       + +   + V DIN+  P      Y I  +E I I + L+++KA+D D    L ++L     D F I    GILK     DRE  PKY +   V D  +       + + ITV D+NDN P+ +  +  V + E+ Q+ T   LI ++   D D   N  +   L+      NH          F+I K    + +  SLDRE I  + L +   D G+PK  ++  + V + D NDN P +  +        N T  T     +  V AT ID   N++I Y  ++ +      +  F + +  G + +  + D + S  Y+L IQA D G+PP
Sbjct: 2812 LILQQTLDREQ--QESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRY-YLESDTENIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAAD-NGHPKHDAKVPVTIKIVDYNDNAPVFKL-PIEGLSVFENALPGTVLINLLLIDPDIEKQEMDFFIVSGDKQAQFQIGKSG--------ELFIAKPLDREQLMFYNLSIIATDGKFTAKANVE---IDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFDFQSKLRFYLSGKGADDFSIGKESGILKVASALDRETTPKYKLVAHVQDG-KDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNT---LITKVHAMDKDFGVNRQIKYSLMG----ENH--------DYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTE----VCKVYATSIDIGVNADIHYFIMSGN-----EQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPP 3357          

HSP 2 Score: 135.191 bits (339), Expect = 2.342e-31
Identity = 165/672 (24.55%), Postives = 289/672 (43.01%), Query Frame = 2
Query:  539 NDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSL-----TLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRL--VTTRVFDRELLDY-----FTIMISCQDYGNPPHRSFQLFNVSVGDINE--FPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDKFQIDI----NKGILKNIVHFDREVIPKYIVPVFVTD----QVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEID-KYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESGTYYLKIQATDNGSPPR 2485
            N ++P+F    + + ++ES+ +G  +    A D DL Y G   + + D +      Y  +F +      L ++  LD E  +    N+T+   D G P +   + L I + D NDN P+  +T     + ES  IG+V+   +A+DADSG+  ++ + L    +      F +N  TG L L   L+ +    + L + A+D  G    SS+  + + V D N++AP+  + +     + E+ P G  + ++ A D D+  N ++   L                +DE ++R+   T  +  +  LDY       +++S  D G+P   S     + + D+NE  F P F    Y   + E+    + ++ + A D D T  LN  +  S+     + I    ++G + ++   D E    Y + +   D     +   +                + PV          ENV+I+T       L+  D D     T+  +++S +++             FEID K       +  LDRE   ++ L + ISD G P  S+   I V V D NDNSP +    +Q  Y+V V +   +N  I  V A D D+ +N  I+Y+     + S   +  F I ++ G I +++ L     + + I+A DNG P +
Sbjct:  766 NVHRPEFVNFPQELSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDGD------YDSVFRIDPDRGELQIIGYLDRERQNEYVLNITVY--DLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYALSVECSD-----FTVNATTGCLRLNKPLDREKQDNYALHITAKD-GGSPVLSSEALVYVLVDDVNDNAPVFGVQEY-IFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSL------------KEETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMD-TVDLNSKITYSITGGDGLGIFAVNDQGSITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIIT-------LKAFDPDIDPTQTITYNIVSGNLVG-----------YFEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEF----DQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYS-----IKSGKGKNKFRIDSQRGHIHIAKPLDSDNEFEIHIKAEDNGIPKK 1382          

HSP 3 Score: 126.331 bits (316), Expect = 1.075e-28
Identity = 169/691 (24.46%), Postives = 295/691 (42.69%), Query Frame = 2
Query:  488 HAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLE-----YFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQC--QLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYH---LDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMS----RDLQESGTYYLKIQATDNGSPPRFSDVTIITVKI 2518
            H   D  + V I I D NDN P F    + + V E+   G  L     +D D+E     +F V      D +  F +      S  L + K LD E +   ++NL++IA DG       K  ++I+V D NDN P   + + +    ES  IG+ +    A D D     K+ F L    + K    F++   +G L + ++L+ +   K+ L    +D      F+ +C  ++ I V D N++ PI S+  +  +++ E++     +  V A D D   N ++   L+  + +Y  + +S       I RL   +  DRE +  F + +  +D G P   S     V++ DIN+ PP F    YS  I E+    + + ++ A   D   + + H   +  +   KF++D   G L      D E+   Y + +   D     +          +   +++   +  + +  + E++ +   G+ I +++  D D+  N  V  ++     +             F ID     + V   LDRE I  Y L I   D G P+R N   I + + D NDN+PI+   N    Y V +     L +  +  + +D D   N+   Y F   D+ S      F  L ++G +  +     +LQ+   + ++++  DNG+PP +SD  ++ VKI
Sbjct: 2944 HPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDIEKQEMDFFIVSG----DKQAQFQIGK----SGELFIAKPLDREQL--MFYNLSIIATDGKFTA---KANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFD--FQSKLRFYL----SGKGADDFSIGKESGILKVASALDRETTPKYKLVAHVQDGKD---FTQECFSEIIITVNDINDNMPIFSMA-QYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYFKISKSTG-----IIRL--HKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQNLYRINVNEDIFV---GSKILDVKATDEDSDVNGLVTYNIERGDNIGQ-----------FSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAPIFSSSN----YSVVLQENRLLGYVFLTFKISDADETPNTT-PYTF---DIRSGNEGGLFR-LEQDGSLRTASRFNHNLQDE--FVIQVRVFDNGTPPLYSDAWVV-VKI 3578          

HSP 4 Score: 119.013 bits (297), Expect = 2.164e-26
Identity = 164/685 (23.94%), Postives = 295/685 (43.07%), Query Frame = 2
Query:  503 HWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQ----LTIRVQDENNHAPILSLGDRESLT-IMENSPAGEHVGMVIASDGDLE------DNGKVTCVLLKNDSN--YLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHL----DPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVN-SLWYEKYFTILTRNGGIFMSRDLQESGTYYLKIQATDNGSPPRFSDVTI 2503
            + ++V+I +E+ NDN P        + V+E+     ++    A D D++     +YN+                +     +KLD EN +     + +   D G+PV     ++ + V D NDN+P FDQ      +  S  +   IF  +A D+DSG  G+I + +   ++ K K  F ++   G + +   L++   ++F + ++A D NG+ P  SQ      + + V   + +AP++     E++  + EN   G  V  ++A D D +       NG        ND N  Y+  D  +         ++ ++  D E    + + IS  D       +F    V V DIN+ PP F    Y + ISE+IE  S ++Q+ A D+D+   L YHL    DPS    F+ID   G +      D E   ++I+ VFV DQ           +       + +      I Q  + E+  I   G+ + E++  D D+ +NA +   +++ +V S            FEID     + +  +L+  +I +Y L +   DLG P  S+   + ++V    ++ P  ++  N      N+  E   N PI     T + A+ +S+I +N ++ ++N S        ++  NG I    D +    + L ++ T+  +     ++ I
Sbjct: 1175 NCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAI--SDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSI---KSGKGKNKFRIDSQRGHIHIAKPLDSD--NEFEIHIKAED-NGI-PKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVDDDNDQLWYNISNG--------NDDNTFYIGQDNGN---------ILLSKYLDYETQQSYNLTISVTD---GTFTAFTNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATDRDEDKKLFYHLHATQDPSSLALFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAI---GSKLAEVRAIDRDSGHNAEIQYSIITGNVGS-----------VFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVTMSENDPP--KFPTN------NIAIEIFENLPIGTF-VTQVTARSSSSIFFNIISGNINESFRINPSTGVIVINGNI----DYESIKVFNLTVKGTNMAAESSCQNIII 1803          

HSP 5 Score: 116.316 bits (290), Expect = 1.192e-25
Identity = 167/686 (24.34%), Postives = 282/686 (41.11%), Query Frame = 2
Query:  512 KVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLED--SEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQ-KLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTC---VLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDK-----FQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTIITVKISTAE 2530
            KV I ++D+NDN P F    K I ++E+   G+ +   TA D D       SY++ +  + PF        FS  +     LDFE +  R + L + A D G P +   + KL I V D NDN P F++   Y  + +S P+G+ +F+ +A D D+G    I+++L           FNL+  +G L +   L    ++  IL V A D      FS    + + +  E+       LG   S+                     L   G   C    + +  +  L+L   +N+K        +  VF         + ++   YG   HR                P F +    + I+E +++   +  I+A D+D  +  N  L  +++D      F+ID ++G L+ I + DRE   +Y++ + V D    T  T        +   ++   +   +  F + E+ +I   G ++  L   D D+  NA V       + LS   S        F ++     L +   LDRE+ D Y L+I   D G P  S+  ++ V+V+D NDN+P++  Q     Y   V  +      + +++A D D   N+ I ++      +    E+ F I    G I      D +    + L + A D G P   SD++I+ + I   E
Sbjct:  492 KVKISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLTAKDRDSGENSYISYSIANLNAVPF----EIDHFSGIVKTTSLLDFETMK-RNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFERVNCYGKVTKSAPMGTEVFVTSAIDFDAGDI--ISYRLSDGNEDG---CFNLDPTSGSLSISCDLKKTTLTNRILKVSATDGTH---FSDDLIINVHLMPED-------LGGDSSI---------------------LHGFGSFECRETGVARRLAETLSLAEKNNVKS------ASPSVFS-------DLSLTPSRYGQNVHR----------------PEFVNFPQELSINESVQLGETVAWIEAKDRDLGY--NGKLVFAISDGDYDSVFRIDPDRGELQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARI---GTVVHCLHATDADSGINAQVT------YALSVECS-------DFTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQE----YIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQD----EELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNE 1081          

HSP 6 Score: 107.842 bits (268), Expect = 4.774e-23
Identity = 184/782 (23.53%), Postives = 334/782 (42.71%), Query Frame = 2
Query:  227 EANVVKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLDFKGHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFPDHWIK----VFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNN--PIFDQTQNYKFIKESTPIGSVIFIFNASDADS-GLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVI--ASDGDLEDNGKVTC-VLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHS--LNYHLDPSVN-DKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQV--RXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLN----HSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNF-VNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTII 2506
            +  +  +RL E + I T++ +    + ++     +  +   +  +D   N T     G L +NK +DRE       K D+  L +         +     V+++++D+NDN P F  +E   KV E +  G  L +  A+DED+       ++L++      L      +  +     LD+EN   +  NL + A DGG P       + I + D N+N   P FD       +KE+ P G+ +    A D D+  L  KI + +           F +N + G +  ++ L+A+  + + L + A+D   + P S+  ++ I+V++EN++ P   L D+    +     + E+V ++   A D D++    +T  ++  N   Y  +D     K  +I    T R  DRE      + ++  D G+P   S     VSV DIN+  P F    Y + +     +N ++ Q+ A+D D   +  + Y +      +KF+ID  +G +      D +   ++ + +   D    + +       V + V   + N P++  +++    ENV  LT  +  G L TQ             +L+V    N   W  + N    ++F I +   N+ +   LD E    Y L I ++D      +N+    V V D NDN P    Q  +  Y VN++        I+ + ATD D  K   + Y+     D +SL     F I + +G + +++  D +++  + L +   D G+P + +   II
Sbjct:  878 QKTLATFRLTESARIGTVV-HCLHATDADSGINAQVTYALSVECSDFTVNATT----GCLRLNKPLDRE-------KQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQDEELFRIDKHTGAIRTQGYLDYEN--KQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLG---IFAVN-DQGSITSLSQLDAETKNFYWLTLCAQD-CAIVPLSNCVEVYIQVENENDNIP---LTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDS----KTGVIK--TTERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNKFRIDSQRGHIHIAKPLDSD--NEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLI--VRK--TSENVVDLTENDKPGFLVTQ-------------ILAVDD-DNDQLWYNISNGNDDNTFYIGQDNGNILLSKYLDYETQQSYNLTISVTDGTFTAFTNL---LVQVIDINDNPP----QFAKDVYHVNISENIEEESVIMQLHATDRDEDK--KLFYHLHATQDPSSL---ALFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKII 1599          

HSP 7 Score: 105.145 bits (261), Expect = 3.004e-22
Identity = 107/362 (29.56%), Postives = 162/362 (44.75%), Query Frame = 2
Query:  296 EDSRSEYMRKPKENFTY-----KIYTTDID------------SNLTKLDFK-----GHLLVNKRIDRE---FLCPNVDKIDDCQLELMIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLED 1306
            E S  +Y  K  EN T+     K+Y T ID            S   +  FK     G L++N  +D E   F    +  ID     L  +A+      V I I DINDN P F     RI V+E I VG+++    A DED +  G+ +YN+E  +        P  + T+ V + LD E ISH  + L + ACD G P +C+   + I + D+NDN PIF  +     ++E+  +G V   F  SDAD              R+      F L    G L   +  N  +  +F++ V   D NG  P  S   + +++ +E+ + PI++  +  ++   E+  +G  +G V ASD D  D
Sbjct: 3272 EFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAY------VNISILDINDNSPTFLQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQFSIDPK-NGTISVSRPLDRETISH--YTLEIQACDQGDPQRCNSVPININILDTNDNAPIFSSSNYSVVLQENRLLGYVFLTFKISDADET--PNTTPYTFDIRSGNEGGLFRLE-QDGSLRTASRFNHNLQDEFVIQVRVFD-NGTPPLYSDAWVVVKIIEESQYPPIVTPLEV-TINSFEDDFSGAFIGKVHASDQDKYD 3619          

HSP 8 Score: 103.605 bits (257), Expect = 1.021e-21
Identity = 147/574 (25.61%), Postives = 252/574 (43.90%), Query Frame = 2
Query:  839 LQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDE----NGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCV-LLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLD---PSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXX-XXXXXPVMTGIKQFV-IRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDK-YKLNIIISDLGIPKRSNMEI-ITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQES--GTYYLKIQATDNGSPPRFSDVTIITVKI 2518
            + I+V D ND +P+F  TQ    I E TP    I    A DAD G+ G+I + LL      +  YF ++  TGE+ L+  L     S F L V A D     N     +S+ +++I V+  N +AP +      S+T   N       G+V  +D D   NG +  + ++  + +   L ++   KDE    L      +++   Y   +++ +D G P   +++   + +   ++  P F    Y + I E   IN  +I++K  D D   +   +L+    +  D+F+I+ + G+L      D E    Y + V   DQ        ++         +NDN P+   + + + I EN      G+ + +L  +D D+  N+ +   + +++ +             FEID +   +   S LD E + + Y+L I  SD G+P R   EI ++++V+D NDN P +   N    Y   VT    +   + +  A D DA     ISY   + + +       F +   +G + +S DL+++      LK+ ATD      FSD  II V +
Sbjct:  169 IHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDADLGINGEIYYSLL-----MDSEYFAIHPTTGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSVTPTSNPLI---YGIVRVNDKDTGINGNIGRLEIVDGNPDGTFLLKAAETKDEYYIELNQFAHLNQQHFIYNLTLLA-EDLGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDEFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENN---LAGSFVVKLTAKDRDSGENSYISYSIANLNAV------------PFEIDHFSGIVKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFERVN---CYG-KVTKSAPMGTEVFVTSAIDFDA--GDIISYRLSDGNEDGC-----FNLDPTSGSLSISCDLKKTTLTNRILKVSATDG---THFSDDLIINVHL 704          

HSP 9 Score: 95.1301 bits (235), Expect = 3.497e-19
Identity = 114/440 (25.91%), Postives = 198/440 (45.00%), Query Frame = 2
Query:  398 GHLLVNKRIDREFLCP-NVD-KIDDCQLELMIHAFPDHWIK-VFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQL------PLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLK--NDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDKFQ 1684
            G + ++K +DRE +   N+  K +DC +  +      H I  V + I DINDN P+F  ++   K+ E+   G ++       +   ++ D+ YF + S N +      S       +  LV+   LD+E +S  YF LT+ A DGGTP   +   + I + D NDN+P F Q      + E   +GS I    A+D DS + G + + +       N   F+++   G + +   L+ + +S + L+++A D+ G     +   + I + D N++API S  +  S+ + EN   G        SD D   N       ++  N+     L++  +++        T   F+  L D F I +   D G PP  S     V + + +++PP       +I   ED    + + ++ A D+DK   LN+ L    +D +Q
Sbjct: 3223 GIIRLHKSLDRETISLFNLTVKAEDCGVPKL------HSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYF-IMSGNEQGKFKMDST------TGDLVLNATLDYE-MSKFYF-LTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNI---ERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACDQ-GDPQRCNSVPININILDTNDNAPIFSSSNY-SVVLQENRLLGYVFLTFKISDADETPNTTPYTFDIRSGNEGGLFRLEQDGSLR--------TASRFNHNLQDEFVIQVRVFDNGTPPLYSDAWVVVKIIEESQYPPIVTPLEVTINSFEDDFSGAFIGKVHASDQDKYDELNFSLVSGPDDMYQ 3634          

HSP 10 Score: 90.5077 bits (223), Expect = 8.758e-18
Identity = 169/698 (24.21%), Postives = 291/698 (41.69%), Query Frame = 2
Query:  521 IIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKF-IKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQD--ENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLED-NGKVTCVLLKNDS-NYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDK--DKTHSLNYHL-DPSVNDKFQIDINKGILKNIVH-FDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQ--DLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHS---------FEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNME---IITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWY-------EKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTIITVKI 2518
            I I D+NDN+P         +++ES  +G  +    A D D       +Y L      F++      +  L + K LD E   +  + L + A DGG+PV   +  + + V D NDN P+F   Q Y F ++E  P G+V+ +  A D D G   +I F L     T+++  F ++ +TG +     L+ +      L V A D  G    +S   + I + D  EN  AP       E   + EN P G  V  V A D D  D N K+T  +   D     A++   +        + +    D E  +++ + +  QD    P  +     + V + N+  P      Y + ++E    N  +I +KA D   D T ++ Y++   ++   F+ID   G++K      DRE   ++I+ V ++D                       +PV++   + V    V +L   +   E   +   +    +ATV   +  VH + +       + +S         F ID  + ++ +   LD +  ++++++I   D GIPK+S      I+ V V   + N+P+   + ++     NV   T  + P  LV  T I A          V++D + LWY       +  F I   NG I +S+  D +   +Y L I  TD G+   F+++ +  + I
Sbjct:  865 ITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYALSVECSDFTV---NATTGCLRLNKPLDREKQDN--YALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFG-VQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSL--KEETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAID-GGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEG-KVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGIFAVNDQGS--------ITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAISDN---------------------GSPVLSSTSRIV----VSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNKFRIDSQRGHIHIAKPLDSD--NEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSE-----NVVDLTENDKPGFLV--TQILA----------VDDDNDQLWYNISNGNDDNTFYIGQDNGNILLSKYLDYETQQSYNLTISVTD-GTFTAFTNLLVQVIDI 1499          

HSP 11 Score: 85.5001 bits (210), Expect = 3.045e-16
Identity = 87/342 (25.44%), Postives = 153/342 (44.74%), Query Frame = 2
Query:  761 NISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFS-SQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDY-FTIMISCQDYGNPPHRSFQL-FNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHL-DPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTD 1774
            N  H  +NLTL+A D GTP +   + + I++   + N PIF Q      I E+ PI   +     SD D G    +  +++          F +N ++G L     L+A+  S + L V A D+  VG    S  ++ I VQD N++ PI    ++  ++I EN+ AG  V  + A D D  +N  ++  +   ++    +D    +       + TT + D E +   + ++I   D+G P  R  ++  ++ V DIN+  P F   N    +++   + + +    A+D D    ++Y L D + +  F +D   G L       +  +   I+ V  TD
Sbjct:  360 NQQHFIYNLTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDE---FRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNK-VISINENNLAGSFVVKLTAKDRDSGENSYISYSIANLNAVPFEIDHFSGI-------VKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFERVNCYGKVTKSAPMGTEVFVTSAIDFDAGDIISYRLSDGNEDGCFNLDPTSGSLSISCDLKKTTLTNRILKVSATD 690          

HSP 12 Score: 76.6406 bits (187), Expect = 1.381e-13
Identity = 164/695 (23.60%), Postives = 295/695 (42.45%), Query Frame = 2
Query:  521 IIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVT----CVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKD--KTHSLNYHLDPSVN-DKFQIDINKGI--LKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVM-TGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESG--TYYLKIQATDNGSPPRFSDVTI------ITVKISTAEKTNYLIK 2551
            I + D+NDN P F        VS     G  +    A+D D    G   Y L+        L R   S  L + + ++  N   R + LT+ A DG       +  LQ++V D   + P+F++      +KE   + S + +  + +A+S L   + + +     +     F +++NTG + ++  L+ + +S    DV  R  + +    ++  L++ + D N+  P +   D  +LTI EN+  G  +  + A+D D   N K++     +  +N+S    +D +          L      D E + Y  I+++ +D+G+P   S     ++V D+N+  P F   +Y   +S        +   KA DKD   T SL Y +        + ID   G+  L+N+++F  +     ++ + V+D V     T    + I++   N  +P+      +  + EN   L +G+ I  ++  D D    A      L   ++S  M  I      F ID+    +  K + DRE+ D+Y + + +SD G   +     + V+V D NDN P +  +     Y++ V+     N  I+ V+A D D   N ++ +  V    N    +    I  + G I      +  G  +Y   ++A+D G P   S+V +          I T EK++ L+K
Sbjct: 2128 ISVLDVNDNCPLFVNMPYYATVSIDDPKGTIIMQVKAIDLDSAENGEVRYELKKGNGELFKLDRK--SGELSIKQHVEGHN---RNYELTVAAYDGAITPCSSEAPLQVKVIDR--SMPVFEKQFYTVSVKEDVEMYSALSV--SIEAESPLGRSLIYTI-----SSESQSFEIDYNTGSIFVVNELDYEKISSH--DVSIRATDSLSGVYAEVVLSVSIMDVNDCYPEIE-SDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNNSELFYIDVTDG-------NLYLKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCFVEPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNELQTYSIDKLTGVISLQNMLNFTDK--SSTVLNISVSDGVH----TAYARLKISLLPENVYSPLFDQSTYEAQVPEN---LLHGHNIITVKASDGDFGTYAN-----LYYEIVSEEMKKI------FLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGG--GKFGFASLKVIVVDVNDNVPYFLLKE----YKMVVSTTVEANQTILTVKAKDDDIVDNGSVHFQIVQKS-NDKAVKDVIEINEKTGDIVFKSKAESYGVNSYQFFVRASDRGEPQFHSEVPVSIEIIETDANIPTFEKSSVLLK 2771          

HSP 13 Score: 75.8702 bits (185), Expect = 2.802e-13
Identity = 142/608 (23.36%), Postives = 241/608 (39.64%), Query Frame = 2
Query:  767 SHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRV--FDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKD-KTHSLNYHLDPSVNDKFQIDINK-GILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNH-------MSWIRLLNHSFE----------------IDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQES--GTYYLKIQATDNGSPPRFSDVTI 2503
            S+++F   + A D G P    +  + IE+ +++ N P F+++     I ESTP G+V+   +       + G   FK   A    ++ +F ++ ++GEL+L  +L+ +      L V A + + V  F +   + I V+DEN++ P        S ++ ENS     +  V A+D D   NG +   L  +  N        N+ D  IY    T +   DRE+   +   +   D G+P H +     + + D N+  P F      + + E+    + LI +  +D D +   +++ +  S + + Q  I K G L      DRE +  Y + +  TD                               +F  + NV+I             D+ +  + T  C     H+ +N        +  ++ ++  F+                I K    L V S+LDRE   KYKL   + D     +     I + V D NDN PI+    +   Y+V+V  +  LN  I  V A D D   N  I Y+ +  +        YF I    G I + + L       + L ++A D G P   S  T+
Sbjct: 2728 SYQFF---VRASDRGEPQFHSEVPVSIEIIETDANIPTFEKSSVLLKIIESTPPGTVLTKLH-------MIGNYTFKFSIA---ADQDHFMIS-DSGELILQQTLDREQQESHNLIVVA-ETSTVPVFFAYADVLIDVRDENDNYPKFD-NTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTENI------QNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDIEKQEMDFFI-VSGDKQAQFQIGKSGELFIAKPLDREQLMFYNLSIIATD------------------------------GKFTAKANVEI-------------DVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFDFQSKLRFYLSGKGADDFSIGKESGILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIF----SMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGEN------HDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATV 3259          

HSP 14 Score: 66.6254 bits (161), Expect = 1.931e-10
Identity = 103/395 (26.08%), Postives = 168/395 (42.53%), Query Frame = 2
Query: 1166 LTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSAL-IQIKALDKDKTHSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHS--FEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFV 2341
            + I V D N++ P+  +      T+  + P G  +  V A D D  +NG+V   L K +     LDR     +  I + V     + EL       ++  D    P  S     V V  I+   P F    Y++ + ED+E+ SAL + I+A +     SL Y +  S +  F+ID N G +  +   D E I  + V +  TD + G       +V I   +      + + I    I EN    ++G  I ++   D D+  NA           LS ++  I   N+S  F ID    NL++K+ LD EQI  + + + + D G P  S+   + + V+D NDN+P +     + +Y   V+        + L +A D D     ++ Y  V
Sbjct: 2126 IDISVLDVNDNCPLF-VNMPYYATVSIDDPKGTIIMQVKAIDLDSAENGEVRYELKKGNGELFKLDRKSG--ELSIKQHVEGHNRNYEL------TVAAYDGAITPCSSEAPLQVKV--IDRSMPVFEKQFYTVSVKEDVEMYSALSVSIEA-ESPLGRSLIYTIS-SESQSFEIDYNTGSIFVVNELDYEKISSHDVSIRATDSLSGVYAEVVLSVSIMDVNDCYPE-IESDIYNLTIPENA---SFGTQILKINATDNDSGANAK----------LSYYIESINGQNNSELFYIDVTDGNLYLKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCFV----EPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIV 2489          

HSP 15 Score: 66.6254 bits (161), Expect = 1.948e-10
Identity = 151/717 (21.06%), Postives = 290/717 (40.45%), Query Frame = 2
Query:  503 HWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQ-LTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIAS----------DGDLEDNGKVTCVLLKN-DSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVG--DINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHL-DPSVNDKFQIDINKGIL--KNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTY--GNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMS---WIRLLNHSFEIDKYKCNLFVKSS---LDREQIDKYKL-----NIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQ-ESGTYYLKIQATDNGSPPRFSD----VTIITVKISTAEKTNYLI 2548
            ++ K+ + + D ND+ P+F  K  + KV ES A+G++L    A+D D  +     Y++            P F + + +   L+   I    + L + A D G P    +  + I VT S ++ P F        I E+ PIG+ +    A  + S  F  I+  +  +        F +N +TG +V+  +++ + +  F L V+  +        S CQ + I + D N++ P   + +     + E++  G +V  V  S          D D+  NG V   ++ +   N+  +D +    + +       R  D E    +T  ++  D G P   S    +V++   ++N+ PP F     ++ +      N  + Q+ A D D   +L + + D + N+ FQI+   GI+  +N    + E    Y + V  +D                            GI   ++   +++L+    N   + ++       N T V  +  V+V+ N +      R+LN +   D    +  +K++    DRE  D Y+L     +++   +    R  +  I + V D NDN P++        Y   V+ +      I+ V+A D+D+ +N  + Y     +       + F +  ++G + + + ++  +  Y L + A D    P  S+    V +I   +   EK  Y +
Sbjct: 1594 NYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGSVFEIDPTFGI-ITLAGNLNINKIQE--YMLQVKAVDLGNPPLSSQIPVHIIVTMSENDPPKFPTNNIAIEIFENLPIGTFVTQVTARSSSSIFFNIISGNINES--------FRINPSTGVIVINGNIDYESIKVFNLTVKGTNMAA----ESSCQNIIIHILDANDNIPYF-VQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVDDLAKNFFKIDSTTGAIELL-------RQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTIRVINVNDCPPVFNERELNVTLFLPTFENVFVRQVSAKDADN-DTLRFDIVDGNTNECFQIEKYTGIITTRNFEILNNENDRDYALHVRASD----------------------------GIFSAILIVKIKVLSAIDSNFAFQRESYRFSAFENNTKVATIGLVNVIGNTLDENVEYRILNPTQLFDIGISSGALKTTGVIFDREVKDLYRLFVEAKSMLYDGMNSNVRRAVTSIDISVLDVNDNCPLFV----NMPYYATVSIDDPKGTIIMQVKAIDLDSAENGEVRYELKKGN------GELFKLDRKSGELSIKQHVEGHNRNYELTVAAYDGAITPCSSEAPLQVKVIDRSMPVFEKQFYTV 2248          

HSP 16 Score: 51.6026 bits (122), Expect = 6.705e-6
Identity = 44/159 (27.67%), Postives = 75/159 (47.17%), Query Frame = 2
Query: 2063 LFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLW-------YEKYFTILTRNGGIFMSRDLQESGTYYLKIQATDNGSPPRFSDVTIITVKI 2518
            L ++ +LDREQ + + L ++     +P       + + V DENDN P +    + T Y  +V   +     ++ V ATD D   N +I Y ++ +D  ++        Y  + T+LT      + R++Q    Y  K+ A DNG P   + V  +T+KI
Sbjct: 2812 LILQQTLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKF----DNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRY-YLESDTENIQNIFDIDIYSGWITLLTS-----LDREVQSE--YNFKVIAADNGHPKHDAKVP-VTIKI 2957          

HSP 17 Score: 51.2174 bits (121), Expect = 8.558e-6
Identity = 80/334 (23.95%), Postives = 139/334 (41.62%), Query Frame = 2
Query:  839 LQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPIL-----SLGDRE--------SLTIMENSPAGEHVGMVIASDG-DLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHS--LNYHLDPSVNDK-----FQIDINKGILKNIVHFDREVIPKYIVPVFVTDQ 1777
            + I V D NDN P+F     Y  +    P G++I    A D DS   G++ ++L       N   F L+  +GEL +   +       + L V A D   + P SS+  L ++V D +   P+      ++  +E        S++I   SP G  +   I+S+    E +     + + N+ +Y  +  SH+         V+ R  D     Y  +++S                VS+ D+N+  P      Y++ I E+    + +++I A D D   +  L+Y+++ S+N +     F ID+  G L      D E I  + + V V D 
Sbjct: 2126 IDISVLDVNDNCPLFVNMPYYATVSIDDPKGTIIMQVKAIDLDSAENGEVRYELKKG----NGELFKLDRKSGELSIKQHVEGH-NRNYELTVAAYD-GAITPCSSEAPLQVKVIDRS--MPVFEKQFYTVSVKEDVEMYSALSVSIEAESPLGRSLIYTISSESQSFEIDYNTGSIFVVNELDYEKI-SSHD---------VSIRATDSLSGVYAEVVLS----------------VSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIE-SINGQNNSELFYIDVTDGNLYLKTPLDYEQIKYHHIVVNVKDH 2424          
BLAST of Protocadherin-1 vs. Ensembl Zebrafish
Match: pcdh2g28 (protocadherin 2 gamma 28 [Source:ZFIN;Acc:ZDB-GENE-050610-19])

HSP 1 Score: 217.238 bits (552), Expect = 1.553e-57
Identity = 183/672 (27.23%), Postives = 317/672 (47.17%), Query Frame = 2
Query:  239 VKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLDFKGHLLVNKRIDREFLCPNVDKIDDCQLEL-MIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYR-PMFS--LTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHS--LNYHLDPS------VNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQ----VRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHS------FEIDKYKCNL-FVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVED 2185
            ++Y + EE    +LIGN+ +D   +  R    +   +I T +          KG L+V++RIDRE LC +V     C     +I   P     V I I D ND+ P F  KE + ++SES A+G++  L++A D D+    +Q+Y L  +  F    +  P  S    +V+ K LD E   H + +L LIA DGG P +     + + V D+NDN P+F+QT     + E+ P G+ I   NA+DAD+G +G+I +     +    ++ FN++ NTG + ++  ++ +  +KF L VEARD+ G    +   ++T+ V D N++AP+++     S T+ E++P    + ++   D D +DNG+V+C  ++   +++      N      Y LVT  + DRE L  + I +   D G PP  S + FN+ V D+N+  P F    Y+ ++ E+     ++++I+A D D+  +  ++Y L+ S      V     ++   G++  +  FD E I    V V   D     +   +                  PV +G                +++ E+  +  D  Y   +V  +++V V S   +W+    H       FE+      +  V+   D++ + K +L +++ D G P RS    + V V D
Sbjct:   30 IRYSIPEEMKKGSLIGNVAQDLGLDLKRL--RSGRARIVTGESAQYAELKTDKGILVVSERIDREQLCGDVTP---CSFSFEIILENPMELHPVTIEILDENDHAPSFQNKELKFEISESAALGSRFLLESADDHDVGVNSLQNYILSTNNNFILKQHSNPDGSKYAEMVLQKALDRE--EHPHLSLKLIAVDGGNPQRSGSVIIDVTVLDANDNAPVFNQTVYRASVMENAPKGTYITTVNATDADAGSYGRITYNFYKQKGAAAQL-FNIDSNTGIISVVGEIDHEKDTKFELTVEARDQGG---LTDSSKITLDVIDVNDNAPVINAMSFSS-TVSEDAPPDTTIAIINVKDADTDDNGRVSC-FIEGSEDFVVKSTLRNY-----YSLVTNVILDREKLSEYNITVVATDSGKPPLTSRKTFNLKVVDVNDNAPVFRERVYNSYLPENNSPGVSILRIRAHDPDENQNARISYILEESDLGGFPVGTYVSVNAESGVVHAVRSFDYEQIKNIKVTVKAQDGGSPPLSSNVTVNIFIQDQNDNAPQVLYPVQSG---------------ASVVAEIVPRSADVGY---LVTKVVAVDVDSGQNAWLSYKLHKATDRALFEVGAQNGEIRTVRQVTDKDAV-KQRLTVVVEDNGQPSRSATVNVNVAVAD 664          

HSP 2 Score: 90.5077 bits (223), Expect = 7.958e-18
Identity = 151/652 (23.16%), Postives = 266/652 (40.80%), Query Frame = 2
Query:  839 LQIEVTDSNDNNPIFDQTQNYKF-IKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNT-----GELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINS--ALIQIKALDKDKTHSLNYHLDPSVNDKFQIDINKGILKNI------VHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQF------------VIRENV--QILTYGNLIG----ELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSP--IWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDL--QESGTYYLKIQATDNGSPPRFSDVTI-ITVKISTAEKTNYLIK-------NSQISFTLIVVTS--LASFSICVALMVGI-ILMWRKS 2653
            + IE+ D ND+ P F Q +  KF I ES  +GS   + +A D D G+    N+ L    +T N      + N       E+VL  +L+ +      L + A D  G    S    + + V D N++AP+ +     + ++MEN+P G ++  V A+D D    G++T    K      A  +  N+        V   + D E    F + +  +D G     S     + V D+N+  P     ++S  +SED   ++  A+I +K  D D    ++  ++ S  + F +   K  L+N       V  DRE + +Y + V  TD  +                     P +T  K F            V RE V    L   N  G     ++  D D + NA +       ++L         +     ++     +    S D EQI   K+ +   D G P  S+   + + ++D+NDN+P  ++  Q+  +     V    ++ + +  V A D+D+ +N+ +SY        +L     F +  +NG I   R +  +++    L +   DNG P R + V + + V  S  E  +           N+ ++F L++  +  L  F  C+ +++ + I  WR+S
Sbjct:  118 VTIEILDENDHAPSF-QNKELKFEISESAALGSRFLLESADDHDVGVNSLQNYIL----STNNNFILKQHSNPDGSKYAEMVLQKALDREEHPHLSLKLIAVD-GGNPQRSGSVIIDVTVLDANDNAPVFNQTVYRA-SVMENAPKGTYITTVNATDADAGSYGRITYNFYKQKG---AAAQLFNIDSNTGIISVVGEI-DHEKDTKFELTVEARDQGGLTDSS--KITLDVIDVNDNAPVINAMSFSSTVSEDAPPDTTIAIINVKDADTDDNGRVSCFIEGS--EDFVV---KSTLRNYYSLVTNVILDREKLSEYNITVVATDSGK---------------------PPLTSRKTFNLKVVDVNDNAPVFRERVYNSYLPENNSPGVSILRIRAHDPDENQNARIS------YILEESDLGGFPVGTYVSVNAESGVVHAVRSFDYEQIKNIKVTVKAQDGGSPPLSSNVTVNIFIQDQNDNAPQVLYPVQSGASVVAEIVPRSADVGYLVTKVVAVDVDSGQNAWLSYKLHKATDRAL-----FEVGAQNGEIRTVRQVTDKDAVKQRLTVVVEDNGQPSRSATVNVNVAVADSFPEVLSEFTDFTHDKEYNNNLTFYLVLALAAVLFLFVTCLVIIISVKIYRWRQS 719          
BLAST of Protocadherin-1 vs. Ensembl Zebrafish
Match: pcdh2aa15 (protocadherin 2 alpha a 15 [Source:ZFIN;Acc:ZDB-GENE-041118-15])

HSP 1 Score: 213.772 bits (543), Expect = 1.753e-56
Identity = 183/668 (27.40%), Postives = 313/668 (46.86%), Query Frame = 2
Query:  239 VKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLDFKGHLLVNKRIDREFLCPNVDKIDDCQLELMI---HAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFS----LTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKD--KTHSLNYHL--DPSVNDKFQ--IDINK--GILKNIVHFDREVIPKYIVPVFVTD----QVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLG-IPKRSNMEIITVMVE 2182
            ++Y + EE    T +GN+ +D   +     +  F  +I +T  +S  +     G L V  ++DRE +C   ++   C + L I   +    H++ V +I  D+ND+ P FP +EKR+++SE++  G +  LQ A D D     VQ+Y L  +E +F +  +  +       L++ K LD E    +   L L A DGG P +  K  + I+V D NDN P+F +      + E+TP+G+ I   NA+D D G  G + + L      K +  FN+N  TGE+V+   L+ ++   + +D++A D+ G+ P ++   +TI++ D N++ P + +    S TI E+S  G  V ++  SD D   NG+VTC L +N    L      N      Y LVTT   DRE + ++ I +  +D G PP  S +   V + D+N+  P F  S Y+ ++ E+     +L  + A DKD     +++Y +  D    +KF   I+IN   G +  +  FD E    +   +  TD     +   +      +           PV        + E  + +  G+L+ +++  D D  YN  +   L S+  +S+H          F +D+Y   +    S       ++KL I++ D G +   +   +I  +VE
Sbjct:   33 IRYSISEEQKDGTAVGNVAKDLGIDPKTLKERGF--RIVSTSGESMFSVNQNDGVLYVKGKLDRENVC---ERSTPCLINLKIALENPLEIHYVTVDVI--DVNDHAPMFPEQEKRLEISETVLPGARFQLQAARDPDSGSNSVQTYKLSHTE-YFRIEIKDRYEDGKVPVLILQKPLDRE--VTKSIKLQLTALDGGRPPKSGKMTIIIDVLDINDNAPVFIKEVYSVTLNENTPVGTTILRVNATDLDEGQNGVVVYSLGHDVNDKLRKLFNVNPVTGEIVVTGLLDFEVKDIYEIDIQASDK-GIAPLTTDKSVTIKIADVNDNEPQIEVTSLSS-TIPEDSKPGTTVALISVSDLDSGINGRVTCSLSENIPFQLMPSSQENT-----YSLVTTSALDRETIAHYDITLEAKDAGQPPLSSVKSVTVQISDVNDNSPEFSSSPYAFYVMENNAPGKSLFSVSASDKDTGANSAVSYQIWRDGGAENKFTSFININSENGEIYALKSFDFETSKTFQFHILATDSGSPSLSSNVTVNVFILDQNDNVPVILYPVSANGSAEGVEEIPRNVNAGHLVTKVRAYDADIGYNGWL---LFSLQEVSDH--------SLFALDRYTGQIRTLRSFTETDEAQHKLVILVKDNGNVSLSATATVIVKVVE 672          

HSP 2 Score: 108.997 bits (271), Expect = 1.722e-23
Identity = 118/464 (25.43%), Postives = 196/464 (42.24%), Query Frame = 2
Query: 1166 LTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHS--LNYHLDPSVNDKFQIDIN----------KGIL----KNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFM--SRDLQESGTYYLKIQATDNGSPPRFSDVTI 2503
            +T+ V D N+HAP+    ++  L I E    G    +  A D D   N   T  L  + + Y  ++     +D  +  L+  +  DRE+     + ++  D G PP        + V DIN+  P F    YS+ ++E+  + + ++++ A D D+  +  + Y L   VNDK +   N           G+L    K+I   D +   K I P+     V   I                    +T +   +  ++      G  +  +   DLD+  N  V C L      S ++ + +L+  S E + Y  +L   S+LDRE I  Y + +   D G P  S+++ +TV + D NDNSP +    + + Y   V         +  V A+D D   NS +SY    +      +  +  I + NG I+   S D + S T+   I ATD+GSP   S+VT+
Sbjct:  121 VTVDVIDVNDHAPMFPEQEKR-LEISETVLPGARFQLQAARDPDSGSNSVQTYKL--SHTEYFRIEIKDRYEDGKVPVLILQKPLDREVTKSIKLQLTALDGGRPPKSGKMTIIIDVLDINDNAPVFIKEVYSVTLNENTPVGTTILRVNATDLDEGQNGVVVYSLGHDVNDKLRKLFNVNPVTGEIVVTGLLDFEVKDIYEIDIQASDKGIAPLTTDKSVTIKIADVNDNEPQIE---------VTSLSSTIPEDS----KPGTTVALISVSDLDSGINGRVTCSL------SENIPF-QLMPSSQE-NTY--SLVTTSALDRETIAHYDITLEAKDAGQPPLSSVKSVTVQISDVNDNSPEF----SSSPYAFYVMENNAPGKSLFSVSASDKDTGANSAVSYQIWRDGGAENKFTSFININSENGEIYALKSFDFETSKTFQFHILATDSGSPSLSSNVTV 554          

HSP 3 Score: 60.8474 bits (146), Expect = 9.132e-9
Identity = 55/195 (28.21%), Postives = 92/195 (47.18%), Query Frame = 2
Query: 2000 NHMSWIRL-LNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTIITVKISTAEKTNYLIKNSQISFTL 2575
            +H  + R+ +   +E  K    L ++  LDRE     KL +   D G P +S    I + V D NDN+P++  +     Y V +   T +   I+ V ATD+D  +N  + Y+   +DVN     K F +    G I ++   D +    Y + IQA+D G  P  +D + +T+KI+        I+ + +S T+
Sbjct:  175 SHTEYFRIEIKDRYEDGKVPV-LILQKPLDREVTKSIKLQLTALDGGRPPKSGKMTIIIDVLDINDNAPVFIKE----VYSVTLNENTPVGTTILRVNATDLDEGQNGVVVYSL-GHDVND-KLRKLFNVNPVTGEIVVTGLLDFEVKDIYEIDIQASDKGIAPLTTDKS-VTIKIADVNDNEPQIEVTSLSSTI 361          
BLAST of Protocadherin-1 vs. Ensembl Zebrafish
Match: pcdh2aa15 (protocadherin 2 alpha a 15 [Source:ZFIN;Acc:ZDB-GENE-041118-15])

HSP 1 Score: 213.772 bits (543), Expect = 2.005e-56
Identity = 180/652 (27.61%), Postives = 306/652 (46.93%), Query Frame = 2
Query:  239 VKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLDFKGHLLVNKRIDREFLCPNVDKIDDCQLELMI---HAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFS----LTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKD--KTHSLNYHL--DPSVNDKFQ--IDINK--GILKNIVHFDREVIPKYIVPVFVTD----QVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLG 2137
            ++Y + EE    T +GN+ +D   +     +  F  +I +T  +S  +     G L V  ++DRE +C   ++   C + L I   +    H++ V +I  D+ND+ P FP +EKR+++SE++  G +  LQ A D D     VQ+Y L  +E +F +  +  +       L++ K LD E    +   L L A DGG P +  K  + I+V D NDN P+F +      + E+TP+G+ I   NA+D D G  G + + L      K +  FN+N  TGE+V+   L+ ++   + +D++A D+ G+ P ++   +TI++ D N++ P + +    S TI E+S  G  V ++  SD D   NG+VTC L +N    L      N      Y LVTT   DRE + ++ I +  +D G PP  S +   V + D+N+  P F  S Y+ ++ E+     +L  + A DKD     +++Y +  D    +KF   I+IN   G +  +  FD E    +   +  TD     +   +      +           PV        + E  + +  G+L+ +++  D D  YN  +   L S+  +S+H          F +D+Y   +    S       ++KL I++ D G
Sbjct:   33 IRYSISEEQKDGTAVGNVAKDLGIDPKTLKERGF--RIVSTSGESMFSVNQNDGVLYVKGKLDRENVC---ERSTPCLINLKIALENPLEIHYVTVDVI--DVNDHAPMFPEQEKRLEISETVLPGARFQLQAARDPDSGSNSVQTYKLSHTE-YFRIEIKDRYEDGKVPVLILQKPLDRE--VTKSIKLQLTALDGGRPPKSGKMTIIIDVLDINDNAPVFIKEVYSVTLNENTPVGTTILRVNATDLDEGQNGVVVYSLGHDVNDKLRKLFNVNPVTGEIVVTGLLDFEVKDIYEIDIQASDK-GIAPLTTDKSVTIKIADVNDNEPQIEVTSLSS-TIPEDSKPGTTVALISVSDLDSGINGRVTCSLSENIPFQLMPSSQENT-----YSLVTTSALDRETIAHYDITLEAKDAGQPPLSSVKSVTVQISDVNDNSPEFSSSPYAFYVMENNAPGKSLFSVSASDKDTGANSAVSYQIWRDGGAENKFTSFININSENGEIYALKSFDFETSKTFQFHILATDSGSPSLSSNVTVNVFILDQNDNVPVILYPVSANGSAEGVEEIPRNVNAGHLVTKVRAYDADIGYNGWL---LFSLQEVSDH--------SLFALDRYTGQIRTLRSFTETDEAQHKLVILVKDNG 656          

HSP 2 Score: 108.997 bits (271), Expect = 1.860e-23
Identity = 118/464 (25.43%), Postives = 196/464 (42.24%), Query Frame = 2
Query: 1166 LTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHS--LNYHLDPSVNDKFQIDIN----------KGIL----KNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFM--SRDLQESGTYYLKIQATDNGSPPRFSDVTI 2503
            +T+ V D N+HAP+    ++  L I E    G    +  A D D   N   T  L  + + Y  ++     +D  +  L+  +  DRE+     + ++  D G PP        + V DIN+  P F    YS+ ++E+  + + ++++ A D D+  +  + Y L   VNDK +   N           G+L    K+I   D +   K I P+     V   I                    +T +   +  ++      G  +  +   DLD+  N  V C L      S ++ + +L+  S E + Y  +L   S+LDRE I  Y + +   D G P  S+++ +TV + D NDNSP +    + + Y   V         +  V A+D D   NS +SY    +      +  +  I + NG I+   S D + S T+   I ATD+GSP   S+VT+
Sbjct:  121 VTVDVIDVNDHAPMFPEQEKR-LEISETVLPGARFQLQAARDPDSGSNSVQTYKL--SHTEYFRIEIKDRYEDGKVPVLILQKPLDREVTKSIKLQLTALDGGRPPKSGKMTIIIDVLDINDNAPVFIKEVYSVTLNENTPVGTTILRVNATDLDEGQNGVVVYSLGHDVNDKLRKLFNVNPVTGEIVVTGLLDFEVKDIYEIDIQASDKGIAPLTTDKSVTIKIADVNDNEPQIE---------VTSLSSTIPEDS----KPGTTVALISVSDLDSGINGRVTCSL------SENIPF-QLMPSSQE-NTY--SLVTTSALDRETIAHYDITLEAKDAGQPPLSSVKSVTVQISDVNDNSPEF----SSSPYAFYVMENNAPGKSLFSVSASDKDTGANSAVSYQIWRDGGAENKFTSFININSENGEIYALKSFDFETSKTFQFHILATDSGSPSLSSNVTV 554          

HSP 3 Score: 60.8474 bits (146), Expect = 9.368e-9
Identity = 55/195 (28.21%), Postives = 92/195 (47.18%), Query Frame = 2
Query: 2000 NHMSWIRL-LNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTIITVKISTAEKTNYLIKNSQISFTL 2575
            +H  + R+ +   +E  K    L ++  LDRE     KL +   D G P +S    I + V D NDN+P++  +     Y V +   T +   I+ V ATD+D  +N  + Y+   +DVN     K F +    G I ++   D +    Y + IQA+D G  P  +D + +T+KI+        I+ + +S T+
Sbjct:  175 SHTEYFRIEIKDRYEDGKVPV-LILQKPLDREVTKSIKLQLTALDGGRPPKSGKMTIIIDVLDINDNAPVFIKE----VYSVTLNENTPVGTTILRVNATDLDEGQNGVVVYSL-GHDVND-KLRKLFNVNPVTGEIVVTGLLDFEVKDIYEIDIQASDKGIAPLTTDKS-VTIKIADVNDNEPQIEVTSLSSTI 361          
BLAST of Protocadherin-1 vs. Ensembl Zebrafish
Match: pcdh1gb2 (protocadherin 1 gamma b 2 [Source:ZFIN;Acc:ZDB-GENE-041118-19])

HSP 1 Score: 211.846 bits (538), Expect = 3.389e-56
Identity = 184/682 (26.98%), Postives = 312/682 (45.75%), Query Frame = 2
Query:  239 VKYRLKEESDINTLIGNIFEDSRSEYMR--KPKENFTYKIYTTDIDSNLTKLDFKGHLLVNKRIDREFLCPNVDKIDDCQLEL-MIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLT-------LVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEII----YRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKD--KTHSLNYHL------DPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQ----VRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRL-LNHSFEIDKYKCNL------FVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVED 2185
            V+Y + EE    + +GNI +D   E  R    K     K     +D +  K    G L+V +RIDRE LC    +   C     +I   P    +V + ++DINDN P FP +   +++SE+  +G + PL  AMD D+   G+QSY L  ++ F       + SLT       +++ ++LD E        L L+A DGG+P +    K+ + + D+NDN P+  Q+     ++E++P G+V+   +A+DAD G+ G +++    A   + ++ FN+N  TGE+ L+  L+ +  + + L++ ARD+ G    S  C++ I V DEN++ P + L    S TI ENSP G  V ++   D D   NG V          + +++++   K E      Y L+T  + DRE +  + I I   D G+P   S +  NV + D+N+ PP F    Y  F++E+      ++ +KA D D      L+Y L         ++    +D   G +  +  FD E +  +   V   D     +   +                  PV TG                +++ E+  + +D  Y   +V  +++V V S   +W+   L  + +   ++  L       V+   D++ + K KL +++ D G P RS +  I V V D
Sbjct:   42 VRYSIPEEMPEGSFVGNIAKDLGIEISRLISGKARVVTKSGRQYVDLSRDK----GTLVVKERIDREELC---KQTTPCSFSFDLIVENPIQLHRVTVEVQDINDNAPLFPKESVNLEISENAVLGARFPLDRAMDTDVGLNGIQSYKLHPTDNF----KLEVHSLTDGNKYIEMILQRELDRE--ERDEIKLVLLATDGGSPQKSGTVKIHVTILDANDNAPVCKQSVFKTEVRENSPAGTVMGTVSAADADEGVNGHVSYYFALANKEEREL-FNINSETGEVTLLAHLDYESQNSYQLNINARDKGG---LSDTCKIVIDVTDENDNPPTIQLMSF-SNTIAENSPVGTTVAVINVEDADSGKNGLV----------HFSINQNIPFKIESTFSEYYSLITDDMLDRETVTEYNITILVSDQGSPARHSNKTLNVKISDVNDNPPKFGSDEYKTFVNENNSPGVTILTVKANDADWGPNAQLSYFLKDEDIRGAPLSSLVSVDALTGTVHAVKSFDFEQLKSFSFNVTARDGGSPPLSSEVTITINIQDQNDNAPQVLYPVQTG---------------ASVVAEIVPRAVDVGY---LVTKVVAVDVDSGQNAWLSYKLQKAPDRALFEVGLQNGEIRTVRQVTDKDAV-KQKLTVVVEDNGQPSRSAVVSINVAVAD 676          

HSP 2 Score: 111.309 bits (277), Expect = 2.447e-24
Identity = 161/681 (23.64%), Postives = 297/681 (43.61%), Query Frame = 2
Query:  728 TLVVLKKLDFENISHRY----FNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTG-ELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESL---TIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRL--VTTRVFDRELLDY-----FTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDKFQIDINKGILKNIV---HFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTG---IKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSP--IWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDL--QESGTYYLKIQATDNGSPPRFSDVTIITVKISTAEKTNYLIK-----------NSQISFTLIVVTSLASFSI--CVALMVGI-ILMWRKS 2653
            TLVV +++D E +  +     F+  LI  +   P+Q    ++ +EV D NDN P+F +      I E+  +G+   +  A D D GL G  ++KL P    K +V+   + N   E++L   L+ +   +  L + A D  G    S   ++ + + D N++AP+     ++S+    + ENSPAG  +G V A+D D   NG V        S Y AL    N ++  ++ +   T  V     LDY     + + I+ +D G        + +V+  D N+ PP+    ++S  I+E+  + + +  I   D D   +   H   + N  F+I+       +++     DRE + +Y + + V+DQ  G+    +           ++ P   G    K FV   N    + G  I  ++  D D   NA +   L    +    +S +        +D     +    S D EQ+  +  N+   D G P  S+   IT+ ++D+NDN+P  ++  Q   +     V    ++ + +  V A D+D+ +N+ +SY        +L     F +  +NG I   R +  +++    L +   DNG P R +   ++++ ++ A+    ++            N  ++F L++  +  SF    CV +++ + I  WR+S
Sbjct:   94 TLVVKERIDREELCKQTTPCSFSFDLIVEN---PIQL--HRVTVEVQDINDNAPLFPKESVNLEISENAVLGARFPLDRAMDTDVGLNGIQSYKLHPTDNFKLEVHSLTDGNKYIEMILQRELDREERDEIKLVLLATD-GGSPQKSGTVKIHVTILDANDNAPVC----KQSVFKTEVRENSPAGTVMGTVSAADADEGVNGHV--------SYYFAL---ANKEERELFNINSETGEVTLLAHLDYESQNSYQLNINARDKGGLSDTCKIVIDVT--DENDNPPTIQLMSFSNTIAENSPVGTTVAVINVEDADSGKNGLVHFSINQNIPFKIESTFSEYYSLITDDMLDRETVTEYNITILVSDQ--GSPARHSNKTLNVKISDVNDNPPKFGSDEYKTFVNENN----SPGVTILTVKANDADWGPNAQLSYFLKDEDIRGAPLSSL------VSVDALTGTVHAVKSFDFEQLKSFSFNVTARDGGSPPLSSEVTITINIQDQNDNAPQVLYPVQTGASVVAEIVPRAVDVGYLVTKVVAVDVDSGQNAWLSYKLQKAPDRAL-----FEVGLQNGEIRTVRQVTDKDAVKQKLTVVVEDNGQPSRSA---VVSINVAVADSFPEVLSEFTDITHEKQYNDSLTFYLVLALAAVSFLFITCVVVIISVKIYRWRQS 731          
BLAST of Protocadherin-1 vs. Ensembl Zebrafish
Match: pcdh1gb2 (protocadherin 1 gamma b 2 [Source:ZFIN;Acc:ZDB-GENE-041118-19])

HSP 1 Score: 213.001 bits (541), Expect = 3.893e-56
Identity = 188/682 (27.57%), Postives = 323/682 (47.36%), Query Frame = 2
Query:  239 VKYRLKEESDINTLIGNIFEDSRSEYMR--KPKENFTYKIYTTDIDSNLTKLDFKGHLLVNKRIDREFLCPNVDKIDDCQLEL-MIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLT-------LVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEII----YRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQ------------ILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRL-LNHSFEIDKYKCNL------FVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVED 2185
            V+Y + EE    + +GNI +D   E  R    K     K     +D +  K    G L+V +RIDRE LC    +   C     +I   P    +V + ++DINDN P FP +   +++SE+  +G + PL  AMD D+   G+QSY L  ++ F   ++    SLT       +++ ++LD E        L L+A DGG+P +    K+ + + D+NDN P+  Q+     ++E++P G+V+   +A+DAD G+ G +++    A   + ++ FN+N  TGE+ L+  L+ +  + + L++ ARD+ G    S  C++ I V DEN++ P + L    S TI ENSP G  V ++   D D   NG V          + +++++   K E      Y L+T  + DRE +  + I I   D G+P   S +  NV + D+N+ PP F    Y  F++E+      ++ +KA D D     N  L   + D+   DI    L ++V  D      + V  F  +Q++        +    VT  +  +P ++   +  I  N+Q            + T  +++ E+  + +D  Y   +V  +++V V S   +W+   L  + +   ++  L       V+   D++ + K KL +++ D G P RS +  I V V D
Sbjct:   42 VRYSIPEEMPEGSFVGNIAKDLGIEISRLISGKARVVTKSGRQYVDLSRDK----GTLVVKERIDREELC---KQTTPCSFSFDLIVENPIQLHRVTVEVQDINDNAPLFPKESVNLEISENAVLGARFPLDRAMDTDVGLNGIQSYKLHPTDNFKLEVH----SLTDGNKYIEMILQRELDRE--ERDEIKLVLLATDGGSPQKSGTVKIHVTILDANDNAPVCKQSVFKTEVRENSPAGTVMGTVSAADADEGVNGHVSYYFALANKEEREL-FNINSETGEVTLLAHLDYESQNSYQLNINARDKGG---LSDTCKIVIDVTDENDNPPTIQLMSF-SNTIAENSPVGTTVAVINVEDADSGKNGLV----------HFSINQNIPFKIESTFSEYYSLITDDMLDRETVTEYNITILVSDQGSPARHSNKTLNVKISDVNDNPPKFGSDEYKTFVNENNSPGVTILTVKANDAD--WGPNAQLSYFLKDE---DIRGAPLSSLVSVDALTGTVHAVKSFDFEQLK--------SFSFNVTARDGGSPPLS--SEVTITINIQDQNDNAPQVLYPVQTGASVVAEIVPRAVDVGY---LVTKVVAVDVDSGQNAWLSYKLQKAPDRALFEVGLQNGEIRTVRQVTDKDAV-KQKLTVVVEDNGQPSRSAVVSINVAVAD 676          

HSP 2 Score: 112.464 bits (280), Expect = 1.309e-24
Identity = 161/681 (23.64%), Postives = 297/681 (43.61%), Query Frame = 2
Query:  728 TLVVLKKLDFENISHRY----FNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTG-ELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESL---TIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRL--VTTRVFDRELLDY-----FTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDKFQIDINKGILKNIV---HFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTG---IKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSP--IWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDL--QESGTYYLKIQATDNGSPPRFSDVTIITVKISTAEKTNYLIK-----------NSQISFTLIVVTSLASFSI--CVALMVGI-ILMWRKS 2653
            TLVV +++D E +  +     F+  LI  +   P+Q    ++ +EV D NDN P+F +      I E+  +G+   +  A D D GL G  ++KL P    K +V+   + N   E++L   L+ +   +  L + A D  G    S   ++ + + D N++AP+     ++S+    + ENSPAG  +G V A+D D   NG V        S Y AL    N ++  ++ +   T  V     LDY     + + I+ +D G        + +V+  D N+ PP+    ++S  I+E+  + + +  I   D D   +   H   + N  F+I+       +++     DRE + +Y + + V+DQ  G+    +           ++ P   G    K FV   N    + G  I  ++  D D   NA +   L    +    +S +        +D     +    S D EQ+  +  N+   D G P  S+   IT+ ++D+NDN+P  ++  Q   +     V    ++ + +  V A D+D+ +N+ +SY        +L     F +  +NG I   R +  +++    L +   DNG P R +   ++++ ++ A+    ++            N  ++F L++  +  SF    CV +++ + I  WR+S
Sbjct:   94 TLVVKERIDREELCKQTTPCSFSFDLIVEN---PIQL--HRVTVEVQDINDNAPLFPKESVNLEISENAVLGARFPLDRAMDTDVGLNGIQSYKLHPTDNFKLEVHSLTDGNKYIEMILQRELDREERDEIKLVLLATD-GGSPQKSGTVKIHVTILDANDNAPVC----KQSVFKTEVRENSPAGTVMGTVSAADADEGVNGHV--------SYYFAL---ANKEERELFNINSETGEVTLLAHLDYESQNSYQLNINARDKGGLSDTCKIVIDVT--DENDNPPTIQLMSFSNTIAENSPVGTTVAVINVEDADSGKNGLVHFSINQNIPFKIESTFSEYYSLITDDMLDRETVTEYNITILVSDQ--GSPARHSNKTLNVKISDVNDNPPKFGSDEYKTFVNENN----SPGVTILTVKANDADWGPNAQLSYFLKDEDIRGAPLSSL------VSVDALTGTVHAVKSFDFEQLKSFSFNVTARDGGSPPLSSEVTITINIQDQNDNAPQVLYPVQTGASVVAEIVPRAVDVGYLVTKVVAVDVDSGQNAWLSYKLQKAPDRAL-----FEVGLQNGEIRTVRQVTDKDAVKQKLTVVVEDNGQPSRSA---VVSINVAVADSFPEVLSEFTDITHEKQYNDSLTFYLVLALAAVSFLFITCVVVIISVKIYRWRQS 731          
BLAST of Protocadherin-1 vs. Ensembl Xenopus
Match: PCDH17 (protocadherin 17 [Source:NCBI gene;Acc:100485388])

HSP 1 Score: 211.075 bits (536), Expect = 5.622e-55
Identity = 155/488 (31.76%), Postives = 247/488 (50.61%), Query Frame = 2
Query:  245 YRLKEESDINTLIGNIFEDSR---SEYMRKPK----ENFTYKIYTTDIDSNLTKLDFKGHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNL-EDSEPFFSLLYRPMFSLT----LVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTH--SLNYHLDPS 1666
            Y + +E    TLIGNI +D++    E  RK      EN    +   D DS        G L   +RIDRE LC    K   CQL L + A       + + I DINDN P FP+++  I +SE+ + G + PL +A D D    G+++Y +  D    FSL  +     T    LV+ K+LD E  SH    L L A DGG P +    ++ ++V DSNDN+P+F+       I E++P+G ++   NA+DAD G  G++ +        + +  F+++  TG + +  +L+ +      +DV+ARD+ G  P    C++T++V D+N++AP +S        I E +P G  + +V  +D D   NG++ C +L N    +      N  +  +Y +VT R  DRE+ D + + I  +D G+PP  S + F+V + D N+ PP F  + Y + +SE+      L  + A D D  H  +++Y + PS
Sbjct:   23 YSVPDEVGAGTLIGNISKDAKLGIPERGRKSNFRVLENSAPHLLDVDQDS--------GVLYTKQRIDRESLCRRSPK---CQLSLEVFANDKEICMIKVDILDINDNSPNFPSEQIDIDISENASPGTRFPLTSAHDPDAGENGLKTYVITRDDFGLFSLDVKSRGDGTKFPELVIQKELDREEQSHH--KLILTALDGGDPPRSATIQINVKVIDSNDNSPVFEALSYMVEIPENSPLGRIVIDLNATDADEGSNGEVVYSFSGYAPDRIRELFSIDSKTGIIQVKGNLDYEENGLIEIDVQARDQ-GPNPIPKHCKVTVKVIDKNDNAPSISFVSVRQGAISEAAPPGTVIALVRVTDKDSGKNGQLICRVLGN----VPFKLEENYDN--LYTVVTDRPLDREIQDEYNVTIIARDNGSPPLNSTKSFSVKILDENDNPPHFTKAMYVLQVSENNIPGEYLGSVLAQDPDLGHNGTVSYSILPS 490          

HSP 2 Score: 103.605 bits (257), Expect = 1.155e-21
Identity = 109/460 (23.70%), Postives = 193/460 (41.96%), Query Frame = 2
Query: 1160 CQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDK------THSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPV-MTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFV---KSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESGTYY--LKIQATDNGSPPRFSDVTI 2503
            C + + + D N+++P     ++  + I EN+  G    +  A D D  +NG  T V+ ++D    +LD            LV  +  DRE   +  ++++  D G+PP  +    NV V D N+  P F   +Y + I E+  +   +I + A D D+       +S + +    + + F ID   GI++   + D E      + V   DQ    I          +   ++   +    ++Q  I E       G +I  ++  D D+  N  ++C +L               N  F++++   NL+       LDRE  D+Y + II  D G P  ++ +  +V + DENDN P +     +  Y + V+        +  V A D D   N  +SY+ + + V  +    + ++   NG I+  R      T Y   K+ A D+GSP   S+ T+
Sbjct:  107 CMIKVDILDINDNSPNFP-SEQIDIDISENASPGTRFPLTSAHDPDAGENGLKTYVITRDDFGLFSLDVKSRGDGTKFPELVIQKELDREEQSHHKLILTALDGGDPPRSATIQINVKVIDSNDNSPVFEALSYMVEIPENSPLGRIVIDLNATDADEGSNGEVVYSFSGYAPDRIRELFSIDSKTGIIQVKGNLDYEENGLIEIDVQARDQGPNPIPKHCKVTVKVIDKNDNAPSISFVSVRQGAISEAA---PPGTVIALVRVTDKDSGKNGQLICRVLG--------------NVPFKLEENYDNLYTVVTDRPLDREIQDEYNVTIIARDNGSPPLNSTKSFSVKILDENDNPPHF----TKAMYVLQVSENNIPGEYLGSVLAQDPDLGHNGTVSYSILPSHVGDVSIYTFVSVNPTNGAIYALRSFNYEQTKYFEFKVLAKDSGSPHLESNATV 544          

HSP 3 Score: 102.834 bits (255), Expect = 1.956e-21
Identity = 141/603 (23.38%), Postives = 254/603 (42.12%), Query Frame = 2
Query:  344 YKIYTTDIDSNLTKLDFKGHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFP------DHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSL-----TLVVLKKLDFENISHRYFNLTLIACDGGT---PVQCDKQKLQIEVTDSNDNNP-IFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITS---LNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDR--SHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFP-----PSFYHSNYSIFISEDIEINSALIQIKALDKD--KTHSLNYHLDPSVNDK-FQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSW-IRLLNHSFEIDKYKCNL 2065
            + +++ D+ S      F   L++ K +DRE         +    +L++ A           I++ + + D NDN P F      +++ E+  +G  +    A D D    G   Y+     P      R +FS+      + V   LD+E   +    + + A D G    P  C   K+ ++V D NDN P I   +     I E+ P G+VI +   +D DSG  G++  ++L        V F L  N   L  + +   L+ +I  ++ + + ARD NG  P +S    ++++ DEN++ P  +      L + EN+  GE++G V+A D DL  NG V+  +L +    +++    S N  +  IY L   R F+ E   YF   +  +D G+P   S     VSV D+N+       P+  +    I +  ++ +   +  ++A+D D  ++  L Y +     D  F+ID   G +K +  +  EV P   + + VTD  +                     P ++ + + +I+     L  G      +    D S    V    +S+ +L+  ++  ++    + EI  Y C +
Sbjct:  167 FGLFSLDVKSRGDGTKFP-ELVIQKELDRE---------EQSHHKLILTALDGGDPPRSATIQINVKVIDSNDNSPVFEALSYMVEIPENSPLGRIVIDLNATDADEGSNGEVVYSFSGYAPD---RIRELFSIDSKTGIIQVKGNLDYE--ENGLIEIDVQARDQGPNPIPKHC---KVTVKVIDKNDNAPSISFVSVRQGAISEAAPPGTVIALVRVTDKDSGKNGQLICRVL------GNVPFKLEENYDNLYTVVTDRPLDREIQDEYNVTIIARD-NGSPPLNSTKSFSVKILDENDNPPHFTKA-MYVLQVSENNIPGEYLGSVLAQDPDLGHNGTVSYSILPSHVGDVSIYTFVSVNPTNGAIYAL---RSFNYEQTKYFEFKVLAKDSGSPHLESNATVRVSVLDVNDNAPVICLPTLQNDTAEIHVPRNVGVGYLITTVRAMDNDFGESGRLTYEIVYGNEDHLFEIDSVTGEIKTLTPYWDEVSPVVELVIKVTDNGK---------------------PSLSAVAKLIIKSYTGSLPEGEPRVNGKQNQWDMSLPLIVTLSTISIILLAAMITIVVKCKRENKEIRTYNCRI 719          
BLAST of Protocadherin-1 vs. Ensembl Xenopus
Match: PCDH17 (protocadherin 17 [Source:NCBI gene;Acc:100485388])

HSP 1 Score: 211.075 bits (536), Expect = 6.022e-55
Identity = 155/488 (31.76%), Postives = 247/488 (50.61%), Query Frame = 2
Query:  245 YRLKEESDINTLIGNIFEDSR---SEYMRKPK----ENFTYKIYTTDIDSNLTKLDFKGHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNL-EDSEPFFSLLYRPMFSLT----LVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTH--SLNYHLDPS 1666
            Y + +E    TLIGNI +D++    E  RK      EN    +   D DS        G L   +RIDRE LC    K   CQL L + A       + + I DINDN P FP+++  I +SE+ + G + PL +A D D    G+++Y +  D    FSL  +     T    LV+ K+LD E  SH    L L A DGG P +    ++ ++V DSNDN+P+F+       I E++P+G ++   NA+DAD G  G++ +        + +  F+++  TG + +  +L+ +      +DV+ARD+ G  P    C++T++V D+N++AP +S        I E +P G  + +V  +D D   NG++ C +L N    +      N  +  +Y +VT R  DRE+ D + + I  +D G+PP  S + F+V + D N+ PP F  + Y + +SE+      L  + A D D  H  +++Y + PS
Sbjct:   23 YSVPDEVGAGTLIGNISKDAKLGIPERGRKSNFRVLENSAPHLLDVDQDS--------GVLYTKQRIDRESLCRRSPK---CQLSLEVFANDKEICMIKVDILDINDNSPNFPSEQIDIDISENASPGTRFPLTSAHDPDAGENGLKTYVITRDDFGLFSLDVKSRGDGTKFPELVIQKELDREEQSHH--KLILTALDGGDPPRSATIQINVKVIDSNDNSPVFEALSYMVEIPENSPLGRIVIDLNATDADEGSNGEVVYSFSGYAPDRIRELFSIDSKTGIIQVKGNLDYEENGLIEIDVQARDQ-GPNPIPKHCKVTVKVIDKNDNAPSISFVSVRQGAISEAAPPGTVIALVRVTDKDSGKNGQLICRVLGN----VPFKLEENYDN--LYTVVTDRPLDREIQDEYNVTIIARDNGSPPLNSTKSFSVKILDENDNPPHFTKAMYVLQVSENNIPGEYLGSVLAQDPDLGHNGTVSYSILPS 490          

HSP 2 Score: 103.605 bits (257), Expect = 1.230e-21
Identity = 109/460 (23.70%), Postives = 193/460 (41.96%), Query Frame = 2
Query: 1160 CQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDK------THSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPV-MTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFV---KSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESGTYY--LKIQATDNGSPPRFSDVTI 2503
            C + + + D N+++P     ++  + I EN+  G    +  A D D  +NG  T V+ ++D    +LD            LV  +  DRE   +  ++++  D G+PP  +    NV V D N+  P F   +Y + I E+  +   +I + A D D+       +S + +    + + F ID   GI++   + D E      + V   DQ    I          +   ++   +    ++Q  I E       G +I  ++  D D+  N  ++C +L               N  F++++   NL+       LDRE  D+Y + II  D G P  ++ +  +V + DENDN P +     +  Y + V+        +  V A D D   N  +SY+ + + V  +    + ++   NG I+  R      T Y   K+ A D+GSP   S+ T+
Sbjct:  107 CMIKVDILDINDNSPNFP-SEQIDIDISENASPGTRFPLTSAHDPDAGENGLKTYVITRDDFGLFSLDVKSRGDGTKFPELVIQKELDREEQSHHKLILTALDGGDPPRSATIQINVKVIDSNDNSPVFEALSYMVEIPENSPLGRIVIDLNATDADEGSNGEVVYSFSGYAPDRIRELFSIDSKTGIIQVKGNLDYEENGLIEIDVQARDQGPNPIPKHCKVTVKVIDKNDNAPSISFVSVRQGAISEAA---PPGTVIALVRVTDKDSGKNGQLICRVLG--------------NVPFKLEENYDNLYTVVTDRPLDREIQDEYNVTIIARDNGSPPLNSTKSFSVKILDENDNPPHF----TKAMYVLQVSENNIPGEYLGSVLAQDPDLGHNGTVSYSILPSHVGDVSIYTFVSVNPTNGAIYALRSFNYEQTKYFEFKVLAKDSGSPHLESNATV 544          

HSP 3 Score: 102.834 bits (255), Expect = 2.137e-21
Identity = 141/603 (23.38%), Postives = 254/603 (42.12%), Query Frame = 2
Query:  344 YKIYTTDIDSNLTKLDFKGHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFP------DHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSL-----TLVVLKKLDFENISHRYFNLTLIACDGGT---PVQCDKQKLQIEVTDSNDNNP-IFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITS---LNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDR--SHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFP-----PSFYHSNYSIFISEDIEINSALIQIKALDKD--KTHSLNYHLDPSVNDK-FQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSW-IRLLNHSFEIDKYKCNL 2065
            + +++ D+ S      F   L++ K +DRE         +    +L++ A           I++ + + D NDN P F      +++ E+  +G  +    A D D    G   Y+     P      R +FS+      + V   LD+E   +    + + A D G    P  C   K+ ++V D NDN P I   +     I E+ P G+VI +   +D DSG  G++  ++L        V F L  N   L  + +   L+ +I  ++ + + ARD NG  P +S    ++++ DEN++ P  +      L + EN+  GE++G V+A D DL  NG V+  +L +    +++    S N  +  IY L   R F+ E   YF   +  +D G+P   S     VSV D+N+       P+  +    I +  ++ +   +  ++A+D D  ++  L Y +     D  F+ID   G +K +  +  EV P   + + VTD  +                     P ++ + + +I+     L  G      +    D S    V    +S+ +L+  ++  ++    + EI  Y C +
Sbjct:  167 FGLFSLDVKSRGDGTKFP-ELVIQKELDRE---------EQSHHKLILTALDGGDPPRSATIQINVKVIDSNDNSPVFEALSYMVEIPENSPLGRIVIDLNATDADEGSNGEVVYSFSGYAPD---RIRELFSIDSKTGIIQVKGNLDYE--ENGLIEIDVQARDQGPNPIPKHC---KVTVKVIDKNDNAPSISFVSVRQGAISEAAPPGTVIALVRVTDKDSGKNGQLICRVL------GNVPFKLEENYDNLYTVVTDRPLDREIQDEYNVTIIARD-NGSPPLNSTKSFSVKILDENDNPPHFTKA-MYVLQVSENNIPGEYLGSVLAQDPDLGHNGTVSYSILPSHVGDVSIYTFVSVNPTNGAIYAL---RSFNYEQTKYFEFKVLAKDSGSPHLESNATVRVSVLDVNDNAPVICLPTLQNDTAEIHVPRNVGVGYLITTVRAMDNDFGESGRLTYEIVYGNEDHLFEIDSVTGEIKTLTPYWDEVSPVVELVIKVTDNGK---------------------PSLSAVAKLIIKSYTGSLPEGEPRVNGKQNQWDMSLPLIVTLSTISIILLAAMITIVVKCKRENKEIRTYNCRI 719          
BLAST of Protocadherin-1 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 207.223 bits (526), Expect = 7.081e-54
Identity = 206/778 (26.48%), Postives = 345/778 (44.34%), Query Frame = 2
Query:  239 VKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLDFK-GHLLVNK-RIDREFL--CPNVDKIDDCQLEL------MIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNL---EDSEPFFSLLY---RPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLT-------IMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHL----DPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDL--QESGTYYLKIQATDNGSPPR 2485
            V YR+ EE   N LIG++  D        P     YK+   ++     ++D K G +   +  IDRE L  C N++  + C LE       ++   P   +   I I DINDN P F +    + + E+  +G   P+  A D D    GV SY L    +++  F L     +      L+V+  LD E      ++LT+   DGGTP +     L+I + D+NDN P F++      + E++P+G  +    A+D+D G+  +I++    A  T  ++  +L+ +TG + +   ++ + V      V A+D+ G  P +++ Q+TI ++D N++ P++ +     +T       I E+ P    V +V  SD D   N  VTCV+  +    L          +  Y L TT   D E +  +TI I   D GNPP  S     V V D+N+  P F  S   +   E+ +IN  ++++ A D D   +   H     DPS    F I+ + G ++     DRE    Y   V   D+   ++    + V   +   +++   M     F + EN+  L+    +G +   D D   NA +            H+S +   +  F I      +    S DRE    Y   +   D G P RS+   +T+ V DENDN+P+    +N  +Y+  +T +T+   P+  V+A D+D   N+ + Y+  + +   L     F I   NG + + + +  +  G + L ++ TD G P R
Sbjct:   69 VAYRVPEEQPPNILIGSLASD-----YGYPDSKHLYKL---ELGHPYLRVDGKTGDIYTTETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSPVP-RLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQ--RDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRL-LHLDRSTGLITVQGPIDREDVGTLKFSVVAKDK-GANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLS---PVGMVTVIDADKGENAHI------------HLS-VEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSN-ISYKY-LTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFEL-----FQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSR 810          

HSP 2 Score: 104.375 bits (259), Expect = 7.783e-22
Identity = 134/601 (22.30%), Postives = 242/601 (40.27%), Query Frame = 2
Query:  842 QIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKN----KVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSN---YLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIF--------ISEDIEINS--ALIQIKALDKDKTHSLN--------YHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESGTYYLKIQATDNGSPPRFSDVTIITVKISTAEKTNYLIKNSQISF 2569
            QIE+ D NDN P F+       I E+T IG +  I  A+D DSG+ G  +++L+     ++    +V  + +    +L+++  L+ +    + L ++ +D  G    +S   L I + D N++AP       E+  + ENSP G  V  V A+D D   N ++     +        L LDRS  +       +      DRE +      +  +D G  P  +     +++ D N+  P      + +         ISED+ + +  AL+Q+  +D+    ++         + L   V+D       K  L+     D E + +Y + +   D     + +  +         ++       + + V  EN  I    +L+ E+   D D+  N+      L   +L +  +        F I+     + V + LDREQ + Y  +++  D GIP       + + V D NDN P +        Y  +V        P+ +V   D D  +N++I  +        +      TIL+      +S D +   TY  +++A D G PPR S V +    +   +    ++  S IS+
Sbjct:  163 QIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQD-GGTPARASSALLRISILDTNDNAPKFEKMAYEA-ELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGL-------ITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLK-QVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDI---NDLVMEVSATDADSGPNSQ-----LHYSILPDPSA-----RGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLN----GYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGEFVIQNGTGTILSS-----ISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISY 731          
BLAST of Protocadherin-1 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 206.068 bits (523), Expect = 1.759e-53
Identity = 206/778 (26.48%), Postives = 345/778 (44.34%), Query Frame = 2
Query:  239 VKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLDFK-GHLLVNK-RIDREFL--CPNVDKIDDCQLEL------MIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNL---EDSEPFFSLLY---RPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLT-------IMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHL----DPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDL--QESGTYYLKIQATDNGSPPR 2485
            V YR+ EE   N LIG++  D        P     YK+   ++     ++D K G +   +  IDRE L  C N++  + C LE       ++   P   +   I I DINDN P F +    + + E+  +G   P+  A D D    GV SY L    +++  F L     +      L+V+  LD E      ++LT+   DGGTP +     L+I + D+NDN P F++      + E++P+G  +    A+D+D G+  +I++    A  T  ++  +L+ +TG + +   ++ + V      V A+D+ G  P +++ Q+TI ++D N++ P++ +     +T       I E+ P    V +V  SD D   N  VTCV+  +    L          +  Y L TT   D E +  +TI I   D GNPP  S     V V D+N+  P F  S   +   E+ +IN  ++++ A D D   +   H     DPS    F I+ + G ++     DRE    Y   V   D+   ++    + V   +   +++   M     F + EN+  L+    +G +   D D   NA +            H+S +   +  F I      +    S DRE    Y   +   D G P RS+   +T+ V DENDN+P+    +N  +Y+  +T +T+   P+  V+A D+D   N+ + Y+  + +   L     F I   NG + + + +  +  G + L ++ TD G P R
Sbjct:   69 VAYRVPEEQPPNILIGSLASD-----YGYPDSKHLYKL---ELGHPYLRVDGKTGDIYTTETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSPVP-RLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQ--RDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRL-LHLDRSTGLITVQGPIDREDVGTLKFSVVAKDK-GANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLS---PVGMVTVIDADKGENAHI------------HLS-VEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSN-ISYKY-LTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFEL-----FQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSR 810          

HSP 2 Score: 103.605 bits (257), Expect = 1.313e-21
Identity = 135/601 (22.46%), Postives = 241/601 (40.10%), Query Frame = 2
Query:  842 QIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKN----KVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSN---YLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSF--------YHSNYSIFISEDIEINS--ALIQIKALDKDKTHSLN--------YHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESGTYYLKIQATDNGSPPRFSDVTIITVKISTAEKTNYLIKNSQISF 2569
            QIE+ D NDN P F+       I E+T IG +  I  A+D DSG+ G  +++L+     ++    +V  + +    +L+++  L+ +    + L ++ +D  G    +S   L I + D N++AP       E+  + ENSP G  V  V A+D D   N ++     +        L LDRS  +       +      DRE +      +  +D G  P  +     +++ D N+  P           H      ISED+ + +  AL+Q+  +D+    ++         + L   V+D       K  L+     D E + +Y + +   D     + +  +         ++       + + V  EN  I    +L+ E+   D D+  N+      L   +L +  +        F I+     + V + LDREQ + Y  +++  D GIP       + + V D NDN P +        Y  +V        P+ +V   D D  +N++I  +        +      TIL+      +S D +   TY  +++A D G PPR S V +    +   +    ++  S IS+
Sbjct:  163 QIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQD-GGTPARASSALLRISILDTNDNAPKFEKMAYEA-ELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGL-------ITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLK-QVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDI---NDLVMEVSATDADSGPNSQ-----LHYSILPDPSA-----RGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFML----NGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGEFVIQNGTGTILSS-----ISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISY 731          
BLAST of Protocadherin-1 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 206.838 bits (525), Expect = 1.782e-53
Identity = 206/778 (26.48%), Postives = 345/778 (44.34%), Query Frame = 2
Query:  239 VKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLDFK-GHLLVNK-RIDREFL--CPNVDKIDDCQLEL------MIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNL---EDSEPFFSLLY---RPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLT-------IMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHL----DPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDL--QESGTYYLKIQATDNGSPPR 2485
            V YR+ EE   N LIG++  D        P     YK+   ++     ++D K G +   +  IDRE L  C N++  + C LE       ++   P   +   I I DINDN P F +    + + E+  +G   P+  A D D    GV SY L    +++  F L     +      L+V+  LD E      ++LT+   DGGTP +     L+I + D+NDN P F++      + E++P+G  +    A+D+D G+  +I++    A  T  ++  +L+ +TG + +   ++ + V      V A+D+ G  P +++ Q+TI ++D N++ P++ +     +T       I E+ P    V +V  SD D   N  VTCV+  +    L          +  Y L TT   D E +  +TI I   D GNPP  S     V V D+N+  P F  S   +   E+ +IN  ++++ A D D   +   H     DPS    F I+ + G ++     DRE    Y   V   D+   ++    + V   +   +++   M     F + EN+  L+    +G +   D D   NA +            H+S +   +  F I      +    S DRE    Y   +   D G P RS+   +T+ V DENDN+P+    +N  +Y+  +T +T+   P+  V+A D+D   N+ + Y+  + +   L     F I   NG + + + +  +  G + L ++ TD G P R
Sbjct:   69 VAYRVPEEQPPNILIGSLASD-----YGYPDSKHLYKL---ELGHPYLRVDGKTGDIYTTETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSPVP-RLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQ--RDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRL-LHLDRSTGLITVQGPIDREDVGTLKFSVVAKDK-GANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLS---PVGMVTVIDADKGENAHI------------HLS-VEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSN-ISYKY-LTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFEL-----FQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSR 810          

HSP 2 Score: 103.605 bits (257), Expect = 1.216e-21
Identity = 135/601 (22.46%), Postives = 241/601 (40.10%), Query Frame = 2
Query:  842 QIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKN----KVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSN---YLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSF--------YHSNYSIFISEDIEINS--ALIQIKALDKDKTHSLN--------YHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESGTYYLKIQATDNGSPPRFSDVTIITVKISTAEKTNYLIKNSQISF 2569
            QIE+ D NDN P F+       I E+T IG +  I  A+D DSG+ G  +++L+     ++    +V  + +    +L+++  L+ +    + L ++ +D  G    +S   L I + D N++AP       E+  + ENSP G  V  V A+D D   N ++     +        L LDRS  +       +      DRE +      +  +D G  P  +     +++ D N+  P           H      ISED+ + +  AL+Q+  +D+    ++         + L   V+D       K  L+     D E + +Y + +   D     + +  +         ++       + + V  EN  I    +L+ E+   D D+  N+      L   +L +  +        F I+     + V + LDREQ + Y  +++  D GIP       + + V D NDN P +        Y  +V        P+ +V   D D  +N++I  +        +      TIL+      +S D +   TY  +++A D G PPR S V +    +   +    ++  S IS+
Sbjct:  163 QIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQD-GGTPARASSALLRISILDTNDNAPKFEKMAYEA-ELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGL-------ITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLK-QVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDI---NDLVMEVSATDADSGPNSQ-----LHYSILPDPSA-----RGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLN----GYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGEFVIQNGTGTILSS-----ISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISY 731          
BLAST of Protocadherin-1 vs. Ensembl Mouse
Match: Pcdhga3 (protocadherin gamma subfamily A, 3 [Source:MGI Symbol;Acc:MGI:1935215])

HSP 1 Score: 211.075 bits (536), Expect = 1.534e-55
Identity = 199/688 (28.92%), Postives = 324/688 (47.09%), Query Frame = 2
Query:  239 VKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFTYKIYT-TDIDSNLTKLDFK-GHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFPDHWIKVFII---IEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFS----LTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKL--LPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLT--IMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDK--DKTHSLNYHLDPSVNDKFQ---------IDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIREN---VQIL-----TYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWI--RLLNHS----FEIDKYKCNL-FVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVED 2185
            ++Y + EE D  + +GNI +D   E    P+E     +   +   S L  LD + G L+   RIDRE LC        C +   I    +  +K+F +   I DINDN P FPT+E  IK+ E    G + PL+TA D D+    +Q+Y L +S  +FSL    +        LV+ + LD E        L LIA DGG PV   K  +Q+ V+D+NDN P+F + + +  + E+ P+G+ +   NA+D D G   ++++ L  +P +  +    F+LN  TG++ ++ SL+ +    + + +EA+D  G G F S+ ++ + V D N++AP +S+    SLT  + E +PAG  + ++   D D   NG+VT  +L N      L++S +      YRLVT R  D E +  + I +   D G+PP  +     + V DIN+ PP+F H++YS +I E+    +++  + A D   DK   + Y L     D  Q         I+ N G+L  +  FD E      + +   D     + +                   T +  FV+ +N    +IL       G+   EL  +  D  Y   +V  +++V   S   +W+  RLL  S    F +  +   +   ++ LDR+ + K  L + + D G P  S    +T+ V D
Sbjct:   28 IRYSVPEELDKGSFVGNISKDLGLE----PRELAERGVRIISRGKSQLFSLDPRSGSLVTRGRIDREELCAQSAP---CLVSFNI--LVEDKLKIFEVEVDISDINDNAPSFPTEELEIKIGELTVPGTRFPLKTAFDPDVGMNALQNYKL-NSNDYFSLAVNSVIDDAKYPELVLERALDREK--KAVHQLDLIASDGGDPVHTSKLCIQVIVSDANDNPPVFTKPEYHVSVLENVPVGTRLITVNATDPDEGFNAQVSYILDKMPGKIAQ---VFHLNSVTGDISILKSLDYEDAVFYEIKIEAQD--GPGLF-SRAKVLVTVLDVNDNAPEVSV---TSLTGSVPEEAPAGREIALINVHDRDSGQNGQVTVFVLGNLP--FTLEKSIDQ----YYRLVTARSLDHEEVSQYNISLRATDGGSPPLSTETHITLHVSDINDNPPTFTHASYSAYIPENNARGASIFSVTAQDPDTDKNAQVTYSL---AEDTLQGLPLSSYISINSNTGVLYALCSFDYEQFRDLQLQITARDSGTPPLSSN------------------TTLNLFVLDQNDNTPEILYPTLPVDGSTGVELAPRSADPGY---LVTKVVAVDKDSGQNAWLSYRLLKASEPGLFSVGLHTGEVRTARALLDRDAL-KQSLVVAVQDHGQPPLSATVTLTIAVAD 663          

HSP 2 Score: 92.4337 bits (228), Expect = 2.260e-18
Identity = 115/456 (25.22%), Postives = 186/456 (40.79%), Query Frame = 2
Query: 1163 QLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKT--HSLNYHLDP---SVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFE--IDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFM--SRDLQESGTYYLKIQATDNGSPPRFSDVTI 2503
            ++ + + D N++AP     + E + I E +  G    +  A D D+  N      L  ND  Y +L  +  + D     LV  R  DRE      + +   D G+P H S     V V D N+ PP F    Y + + E++ + + LI + A D D+     ++Y LD     +   F ++   G +  +   D E    Y + +   D              + V D      V T +   V  E       G  I  +   D D+  N  V     +V VL N       L  + E  ID+Y   L    SLD E++ +Y +++  +D G P  S    IT+ V D NDN P + +     +Y   +         I  V A D D  KN+ ++Y+   + +  L    Y +I +  G ++   S D ++     L+I A D+G+PP  S+ T+
Sbjct:  115 EVEVDISDINDNAPSFPTEELE-IKIGELTVPGTRFPLKTAFDPDVGMNALQNYKLNSND--YFSLAVNSVIDDAKYPELVLERALDREKKAVHQLDLIASDGGDPVHTSKLCIQVIVSDANDNPPVFTKPEYHVSVLENVPVGTRLITVNATDPDEGFNAQVSYILDKMPGKIAQVFHLNSVTGDISILKSLDYEDAVFYEIKIEAQDGPGLFSRAKVLVTVLDVNDNAPEVSV-TSLTGSVPEE----APAGREIALINVHDRDSGQNGQV-----TVFVLGN-------LPFTLEKSIDQYY-RLVTARSLDHEEVSQYNISLRATDGGSPPLSTETHITLHVSDINDNPPTFTH----ASYSAYIPENNARGASIFSVTAQDPDTDKNAQVTYSLAEDTLQGLPLSSYISINSNTGVLYALCSFDYEQFRDLQLQITARDSGTPPLSSNTTL 545          

HSP 3 Score: 77.411 bits (189), Expect = 8.699e-14
Identity = 140/583 (24.01%), Postives = 243/583 (41.68%), Query Frame = 2
Query:  836 KLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNT-------GELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHS----------LNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMT--GIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVC----DLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQ---ATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRD-LQESGTYYLKIQATDNGSPPRFSDVTI 2503
            +++++++D NDN P F   +    I E T  G+   +  A D D G+    N+KL       +  YF+L  N+        ELVL  +L+ +  +   LD+ A D  G    +S+  + + V D N++ P+ +  +   ++++EN P G  +  V A+D D   N +V+ +L K       +   +++  +I       +  D E   ++ I I  QD   P   S     V+V D+N+  P    ++ +  + E+      +  I   D+D   +          L + L+ S++  +++   + +       D E + +Y + +  TD      L+  T + + V+D+NDN P  T      ++   N +    G  I  +  QD D   NA V      D L    LS+++S          I+     L+   S D EQ    +L I   D G P  S+   + + V D+NDN+P   Y          V        P  LV    A D D+ +N+ +SY  +      L+     T   R     + RD L++S    L +   D+G PP  + VT+
Sbjct:  115 EVEVDISDINDNAPSFPTEELEIKIGELTVPGTRFPLKTAFDPDVGMNALQNYKL------NSNDYFSLAVNSVIDDAKYPELVLERALDREKKAVHQLDLIASD-GGDPVHTSKLCIQVIVSDANDNPPVFTKPEYH-VSVLENVPVGTRLITVNATDPDEGFNAQVSYILDKMPGKIAQVFHLNSVTGDI----SILKSLDYEDAVFYEIKIEAQD--GPGLFSRAKVLVTVLDVNDNAPEVSVTSLTGSVPEEAPAGREIALINVHDRDSGQNGQVTVFVLGNLPFTLEKSIDQYYRLVTARSL-------DHEEVSQYNISLRATDG-GSPPLSTETHITLHVSDINDNPPTFTHASYSAYIPENNAR----GASIFSVTAQDPDTDKNAQVTYSLAEDTLQGLPLSSYIS----------INSNTGVLYALCSFDYEQFRDLQLQITARDSGTPPLSSNTTLNLFVLDQNDNTPEILYPTLPVDGSTGVELAPRSADPGYLVTKVVAVDKDSGQNAWLSYRLLKASEPGLFSVGLHTGEVRTARALLDRDALKQS----LVVAVQDHGQPPLSATVTL 657          

HSP 4 Score: 60.8474 bits (146), Expect = 1.173e-8
Identity = 71/252 (28.17%), Postives = 103/252 (40.87%), Query Frame = 2
Query:  527 IEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSE----PFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNP-------IFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMEN 1249
            + DINDN P F        + E+ A G  +   TA D D +     +Y+L +      P  S +     +  L  L   D+E    R   L + A D GTP       L + V D NDN P         D +   +    S   G ++    A D DSG    ++++LL A        F++  +TGE+    +L  +   K  L V  +D +G  P S+   LTI V D     P + LGD ES+    N
Sbjct:  439 VSDINDNPPTFTHASYSAYIPENNARGASIFSVTAQDPDTDKNAQVTYSLAEDTLQGLPLSSYISINSNTGVLYALCSFDYEQF--RDLQLQITARDSGTPPLSSNTTLNLFVLDQNDNTPEILYPTLPVDGSTGVELAPRSADPGYLVTKVVAVDKDSGQNAWLSYRLLKA---SEPGLFSVGLHTGEVRTARALLDRDALKQSLVVAVQD-HGQPPLSATVTLTIAVADS---IPDI-LGDLESIHTPAN 680          

HSP 5 Score: 58.5362 bits (140), Expect = 5.786e-8
Identity = 54/201 (26.87%), Postives = 97/201 (48.26%), Query Frame = 2
Query: 1916 IGELQTQD----LDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESGTYYLKIQATDNGSPPRFSDVTII 2506
            IGEL        L  +++  V  + L  + L+++  +   +N   +  KY   L ++ +LDRE+   ++L++I SD G P  ++   I V+V D NDN P++     +  Y V+V     +   +I V ATD D   N+ +SY  ++     +    +   +T +  I  S D +++  Y +KI+A D   P  FS   ++
Sbjct:  139 IGELTVPGTRFPLKTAFDPDVGMNALQNYKLNSNDYFSLAVNSVIDDAKYP-ELVLERALDREKKAVHQLDLIASDGGDPVHTSKLCIQVIVSDANDNPPVF----TKPEYHVSVLENVPVGTRLITVNATDPDEGFNAQVSY-ILDKMPGKIAQVFHLNSVTGDISILKSLDYEDAVFYEIKIEAQDG--PGLFSRAKVL 331          
BLAST of Protocadherin-1 vs. Ensembl Mouse
Match: Pcdhgb5 (protocadherin gamma subfamily B, 5 [Source:MGI Symbol;Acc:MGI:1935196])

HSP 1 Score: 209.534 bits (532), Expect = 4.010e-55
Identity = 145/470 (30.85%), Postives = 241/470 (51.28%), Query Frame = 2
Query:  239 VKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLDFKGHLLVNKRIDREFLCPNVDKIDDCQLEL-MIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFS----LTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESL-TIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKD 1630
            ++Y++ EE    +++GN+ +D        P    T K+  +      +     G LLV+ R+DRE +C    K   C LE   +   P ++  V + +EDIND+ P F      +++SES   G +  L+ A D D+    +Q+Y L  S P FSL+ +          LV+ K LD E     Y+ L L A DGG P      +L+I+VTD+NDN P+F+Q      + E+ P G+ +    A+D D G+  +I++        +    F LN  +GE++   +L+ + + ++ + VEARD  G+    +QC + I +QDEN++ P +++  R  L  I EN+P G  + ++   DGD  +NG+V C  L ++  +  +  S N      Y+LVT R  DREL   + + I+  D G PP  S     + VGD+N+  P F+ ++Y ++I+E+    +++ Q+ A D D
Sbjct:   33 IRYKIPEEMPTGSVVGNLAKDLGFSVQELP----TRKLRISSEKPYFSVSSESGELLVSSRLDREQIC---GKKLVCALEFEAVAENPLNFYHVSVELEDINDHTPNFTHTFSELQISESAQPGTRFILEVAEDADIALNSLQNYKLSPS-PGFSLVNKEKQDGRKYPELVLEKTLDREQ--QNYYRLVLTALDGGDPPLSGTTELRIQVTDANDNPPVFNQEVYKVRLPENVPPGTTVLRVTATDKDEGVNSEISYSF-----HRAGQVFGLNSKSGEIITQKTLDFEEIKEYSIVVEARDGGGL---VAQCTVEINIQDENDNRPEITV--RSLLEMIPENAPPGTLIALIKIHDGDSGENGEVNC-RLDDEVPFKIISSSKNS-----YKLVTDRALDRELTPEYNVTITATDRGKPPLSSSTKVTLHVGDVNDNAPLFHQASYLVYIAENNPPGASIAQVSASDPD 476          

HSP 2 Score: 122.865 bits (307), Expect = 9.124e-28
Identity = 140/560 (25.00%), Postives = 245/560 (43.75%), Query Frame = 2
Query:  875 PIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKL--LPART---TKNKVYFNLNFNTGELVLITSLN-AKIVSKFI---LDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTH----SLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDV--NSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTI 2503
            P   +   YK I E  P GSV+           L   + F +  LP R    +  K YF+++  +GEL++ + L+  +I  K +   L+ EA  EN +  +     +++ ++D N+H P  +    E L I E++  G    + +A D D+  N      L  + S   +L             LV  +  DRE  +Y+ ++++  D G+PP        + V D N+ PP F    Y + + E++   + ++++ A DKD+      S ++H    V   F ++   G +      D E I +Y + V   D                  D      V + ++  +I EN      G LI  ++  D D+  N  V C L       +     ++++ S    K    L    +LDRE   +Y + I  +D G P  S+   +T+ V D NDN+P++    +Q +Y V +         I  V A+D D   N ++SY+ + +D+   SLW   Y T+  ++G +F  R  D ++  ++ L +QA D+GSP   ++V++
Sbjct:   27 PALSEQIRYK-IPEEMPTGSVV---------GNLAKDLGFSVQELPTRKLRISSEKPYFSVSSESGELLVSSRLDREQICGKKLVCALEFEAVAENPLNFY----HVSVELEDINDHTPNFTHTFSE-LQISESAQPGTRFILEVAEDADIALNSLQNYKL--SPSPGFSLVNKEKQDGRKYPELVLEKTLDREQQNYYRLVLTALDGGDPPLSGTTELRIQVTDANDNPPVFNQEVYKVRLPENVPPGTTVLRVTATDKDEGVNSEISYSFHRAGQV---FGLNSKSGEIITQKTLDFEEIKEYSIVVEARDGGGLVAQCTVEINIQDENDNRPEITVRSLLE--MIPENA---PPGTLIALIKIHDGDSGENGEVNCRL-------DDEVPFKIISSS----KNSYKLVTDRALDRELTPEYNVTITATDRGKPPLSSSTKVTLHVGDVNDNAPLF----HQASYLVYIAENNPPGASIAQVSASDPDLGSNGHVSYSIIASDLEPKSLW--SYVTVNAQSGVVFAQRAFDHEQLRSFQLTLQARDHGSPTLSANVSM 544          

HSP 3 Score: 119.783 bits (299), Expect = 9.159e-27
Identity = 111/416 (26.68%), Postives = 199/416 (47.84%), Query Frame = 2
Query:  521 IIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPV-QCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNL---NFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDR--SHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINE-----FPPSFYHSNYSIF--ISEDIEINSALIQIKALDKDKTHS--LNYHL----DPSVNDKFQIDINKGILK 1711
            I + D NDN P F  +  ++++ E++  G  +   TA D+D       SY+   +   F L  +   S  ++  K LDFE I  + +++ + A DGG  V QC    ++I + D NDN P        + I E+ P G++I +    D DSG  G++N +L       ++V F +   + N+ +LV   +L+ ++  ++ + + A D  G  P SS  ++T+ V D N++AP+        + I EN+P G  +  V ASD DL  NG V+  ++ +D    +L    + N +  +++     R FD E L  F + +  +D+G+P   +     V VGD N+       P+      ++F  +    +    + ++ A+D D  H+  L+YH+    DP +   F + +  G ++
Sbjct:  230 IQVTDANDNPPVFNQEVYKVRLPENVPPGTTVLRVTATDKDEGVNSEISYSFHRAGQVFGLNSK---SGEIITQKTLDFEEI--KEYSIVVEARDGGGLVAQC---TVEINIQDENDNRPEITVRSLLEMIPENAPPGTLIALIKIHDGDSGENGEVNCRL------DDEVPFKIISSSKNSYKLVTDRALDRELTPEYNVTITATDR-GKPPLSSSTKVTLHVGDVNDNAPLFHQASY-LVYIAENNPPGASIAQVSASDPDLGSNGHVSYSIIASDLEPKSLWSYVTVNAQSGVVF---AQRAFDHEQLRSFQLTLQARDHGSPTLSANVSMRVLVGDRNDNAPRVLYPALEPDGSALFDMVPRAAQPGYLVTKVVAVDADSGHNAWLSYHVLQASDPGL---FSLGLRTGEVR 623          

HSP 4 Score: 96.6709 bits (239), Expect = 1.211e-19
Identity = 171/721 (23.72%), Postives = 307/721 (42.58%), Query Frame = 2
Query:  563 TKEKRIKVSESIAVGNQLP-LQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTL-IACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTG----ELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINS--ALIQIKALDKDKTHSLNYHLDPSVNDKFQIDINKGILKNIV--HFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFV-IRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRY---QNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQE--SGTYYLKIQATDNGSPPRFSDVTIITVKISTAEKTNYLIKN--------SQISFTLIVVTSLASFSICVALMVGIILMWRKS 2653
            +++ R K+ E +  G+ +  L   +   ++    +   +   +P+FS+      S  L+V  +LD E I  +     L        P+  +   + +E+ D ND+ P F  T +   I ES   G+   +  A DAD  L    N+KL P   +      N     G    ELVL  +L+ +  + + L + A D  G  P S   +L I+V D N++ P+ +  +   + + EN P G  V  V A+D D   N +++    +    +    +S          ++T +  D E +  ++I++  +D G    +      +++ D N+  P     +    I E+    +  ALI+I   D  +   +N  LD  V  K  I  +K   K +     DRE+ P+Y V +  TD+ +   L+ +T V + V DVNDN P+       V I EN      G  I ++   D D   N  V     S  ++++ +    L ++   ++     +F + + D EQ+  ++L +   D G P  S    + V+V D NDN+P   Y   + + +A    V       + +  V A D D+  N+ +SY+ +      L     F++  R G +  +R L E  +    L +   D G PP  +  T++ V   + ++    + +        +++ F L+V  +L S    +A+++ I L  R S
Sbjct:   30 SEQIRYKIPEEMPTGSVVGNLAKDLGFSVQELPTRKLRISSEKPYFSVSSE---SGELLVSSRLDREQICGKKLVCALEFEAVAENPL--NFYHVSVELEDINDHTPNFTHTFSELQISESAQPGTRFILEVAEDADIALNSLQNYKLSP---SPGFSLVNKEKQDGRKYPELVLEKTLDREQQNYYRLVLTALD-GGDPPLSGTTELRIQVTDANDNPPVFNQ-EVYKVRLPENVPPGTTVLRVTATDKDEGVNSEISYSFHRAGQVFGLNSKSG--------EIITQKTLDFEEIKEYSIVVEARDGGGLVAQC--TVEINIQDENDNRPEITVRSLLEMIPENAPPGTLIALIKIHDGDSGENGEVNCRLDDEVPFKI-ISSSKNSYKLVTDRALDRELTPEYNVTITATDRGK-PPLSSSTKVTLHVGDVNDNAPLFHQASYLVYIAENN---PPGASIAQVSASDPDLGSNGHV-----SYSIIASDLEPKSLWSY-VTVNAQSGVVFAQRAFDHEQLRSFQLTLQARDHGSPTLSANVSMRVLVGDRNDNAPRVLYPALEPDGSALFDMVPRAAQPGYLVTKVVAVDADSGHNAWLSYHVLQASDPGL-----FSLGLRTGEVRTARALGEKDAARQRLLVGVRDGGQPPLSATATLLLVFADSLQEALPDLSDHSLPPDPQAELQFYLVVALALVSVLFLLAVILAIALRLRHS 714          

HSP 5 Score: 84.3445 bits (207), Expect = 6.513e-16
Identity = 83/333 (24.92%), Postives = 145/333 (43.54%), Query Frame = 2
Query:  515 VFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKV--YFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAP--ILSLGDRESLTIMENSPAGEHVG----MVIASDGDLEDNGKVTC-VLLKNDSNYLALD-RSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPP 1483
            V I I+D NDN+P+   +     + E+   G  + L    D D    G  +  L+D  PF  ++     S  LV  + LD E      +N+T+ A D G P      K+ + V D NDN P+F Q     +I E+ P G+ I   +ASD D G  G +++ ++ +      +  Y  +N  +G +    + + + +  F L ++ARD +G    S+   + + V D N++AP  +    + +   + +  P     G     V+A D D   N  ++  VL  +D    +L  R+  ++        T R    +      +++  +D G PP
Sbjct:  329 VEINIQDENDNRPEITVRSLLEMIPENAPPGTLIALIKIHDGDSGENGEVNCRLDDEVPF-KIISSSKNSYKLVTDRALDRELTPE--YNVTITATDRGKPPLSSSTKVTLHVGDVNDNAPLFHQASYLVYIAENNPPGASIAQVSASDPDLGSNGHVSYSIIASDLEPKSLWSYVTVNAQSGVVFAQRAFDHEQLRSFQLTLQARD-HGSPTLSANVSMRVLVGDRNDNAPRVLYPALEPDGSALFDMVPRAAQPGYLVTKVVAVDADSGHNAWLSYHVLQASDPGLFSLGLRTGEVR--------TARALGEKDAARQRLLVGVRDGGQPP 649          

HSP 6 Score: 71.633 bits (174), Expect = 6.102e-12
Identity = 66/239 (27.62%), Postives = 105/239 (43.93%), Query Frame = 2
Query:  512 KVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNL--EDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIF-------DQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHA 1201
            KV + + D+NDN P F      + ++E+   G  +   +A D DL   G  SY++   D EP     Y  + + + VV  +  F++   R F LTL A D G+P       +++ V D NDN P         D +  +  +  +   G ++    A DADSG    +++ +L A    +   F+L   TGE+    +L  K  ++  L V  RD  G  P S+   L +   D    A
Sbjct:  433 KVTLHVGDVNDNAPLFHQASYLVYIAENNPPGASIAQVSASDPDLGSNGHVSYSIIASDLEPKSLWSYVTVNAQSGVVFAQRAFDHEQLRSFQLTLQARDHGSPTLSANVSMRVLVGDRNDNAPRVLYPALEPDGSALFDMVPRAAQPGYLVTKVVAVDADSGHNAWLSYHVLQA---SDPGLFSLGLRTGEVRTARALGEKDAARQRLLVGVRD-GGQPPLSATATLLLVFADSLQEA 667          
BLAST of Protocadherin-1 vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 207.994 bits (528), Expect = 2.540e-54
Identity = 207/784 (26.40%), Postives = 346/784 (44.13%), Query Frame = 2
Query:  239 VKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLDFK-GHLLVNK-RIDREFL--CPNVDKIDDCQLEL------MIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLE---DSEPFFSLLY---RPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLT-------IMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHS--LNYHL--DPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQES--GTYYLKIQATDNGSPPRFSDVTI 2503
            V Y++ EE   NTLIG++  D        P     YK+   ++ +   ++D K G +   +  IDRE L  C N    + C LE       ++       ++  I ++DINDN P F +    + + E+  +G+  P+  A D D    GV SY L+   +++  F L     +      L+V+  LD E      ++LT+   DGG P +     L++ V D+NDN P F++      + E++PIG  +    A+D+D G   +I++    A     ++   L+ NTG + +   ++ + +S     V A+D  G  P S++ Q+ + V+D N++AP + +     +T       I E+      V +V  SD D  +N  VTCV+  +    L          +  Y L TT   D E +  +TI I   D GNPP  S     V V D+N+  P F  S   +   E+ +    + ++ A D D   +  L Y L  +P+    F I    G ++     DRE    Y + V   D+   ++    T +   +   +++   M     F + EN+  L+    +G +   D D   NA V    LSV             N  F I      +    S DREQ   Y   +   D G+P RS    +T+ V DENDN+P     +N T++++ +T +T L   +  V A DID+  N+ ++Y+    +   L     F I + +G I + ++++    G + L ++ +D G PPR+    +
Sbjct:   38 VVYKVPEEQPPNTLIGSLAAD-----YGLPDVGHLYKL---EVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQIPGNPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDS--YDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAPEVVRRL-LRLDRNTGLITVQGPVDREDLSTLRFSVLAKDR-GATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSP---VGMVTVIDGDKGENARV---QLSVE----------QDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSN-TSHRL-LTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGNPYGL-----FQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALV 786          

HSP 2 Score: 117.857 bits (294), Expect = 3.335e-26
Identity = 150/605 (24.79%), Postives = 252/605 (41.65%), Query Frame = 2
Query:  842 QIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKN----KVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDS---NYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSF--------YHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDKFQI---------DINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMT-GIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESGTYYLKIQATDNGSPPRFSDVTIITVKISTAEKTNYLIKNSQISFTLIV 2581
            QIEV D NDN P F        I E+T IGS+  I  A+D D+G  G  +++L      +     +V  +      +L+++ +L+ +    + L ++ +D  G  P +S   L + V D N++AP       E+  + ENSP G  V  V A+D D   N ++     +        L LDR+  +       +      DRE L      +  +D G  P  +     V+V D+N+  P+          H +    ISED+   +A+  ++  D+D+  +       + +  FQ+            K  L+     D E +  Y + +   D      L+ T ++ + V DVNDN PV T  I +    EN +    G ++ E+   D D+  NA +V  L                   F I      + VK+SLDREQ D Y+L ++ +D G P       + V V D NDN P +      + Y  +V        P+ +V   D D  +N+ +  +   ++ + +      TIL+      +S D ++  TY  +++A D G PPR + V +    +   +   ++   S  S  L+ 
Sbjct:  133 QIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQD-GGNPPRASSALLRVTVLDTNDNAPKFERPTYEA-ELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAPEVVRRLLRLDRNTGL-------ITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDS-GNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKP---GEVVAEVTASDADSGSNAELVYSLEPEPAAQGL----------FTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFML----SGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNGDFVIQNGTGTILSS-----LSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRLLT 705          
BLAST of Protocadherin-1 vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 207.994 bits (528), Expect = 2.540e-54
Identity = 207/784 (26.40%), Postives = 346/784 (44.13%), Query Frame = 2
Query:  239 VKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLDFK-GHLLVNK-RIDREFL--CPNVDKIDDCQLEL------MIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLE---DSEPFFSLLY---RPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLT-------IMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHS--LNYHL--DPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQES--GTYYLKIQATDNGSPPRFSDVTI 2503
            V Y++ EE   NTLIG++  D        P     YK+   ++ +   ++D K G +   +  IDRE L  C N    + C LE       ++       ++  I ++DINDN P F +    + + E+  +G+  P+  A D D    GV SY L+   +++  F L     +      L+V+  LD E      ++LT+   DGG P +     L++ V D+NDN P F++      + E++PIG  +    A+D+D G   +I++    A     ++   L+ NTG + +   ++ + +S     V A+D  G  P S++ Q+ + V+D N++AP + +     +T       I E+      V +V  SD D  +N  VTCV+  +    L          +  Y L TT   D E +  +TI I   D GNPP  S     V V D+N+  P F  S   +   E+ +    + ++ A D D   +  L Y L  +P+    F I    G ++     DRE    Y + V   D+   ++    T +   +   +++   M     F + EN+  L+    +G +   D D   NA V    LSV             N  F I      +    S DREQ   Y   +   D G+P RS    +T+ V DENDN+P     +N T++++ +T +T L   +  V A DID+  N+ ++Y+    +   L     F I + +G I + ++++    G + L ++ +D G PPR+    +
Sbjct:   38 VVYKVPEEQPPNTLIGSLAAD-----YGLPDVGHLYKL---EVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQIPGNPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDS--YDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAPEVVRRL-LRLDRNTGLITVQGPVDREDLSTLRFSVLAKDR-GATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSP---VGMVTVIDGDKGENARV---QLSVE----------QDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSN-TSHRL-LTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGNPYGL-----FQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALV 786          

HSP 2 Score: 117.857 bits (294), Expect = 3.335e-26
Identity = 150/605 (24.79%), Postives = 252/605 (41.65%), Query Frame = 2
Query:  842 QIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKN----KVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDS---NYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSF--------YHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDKFQI---------DINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMT-GIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESGTYYLKIQATDNGSPPRFSDVTIITVKISTAEKTNYLIKNSQISFTLIV 2581
            QIEV D NDN P F        I E+T IGS+  I  A+D D+G  G  +++L      +     +V  +      +L+++ +L+ +    + L ++ +D  G  P +S   L + V D N++AP       E+  + ENSP G  V  V A+D D   N ++     +        L LDR+  +       +      DRE L      +  +D G  P  +     V+V D+N+  P+          H +    ISED+   +A+  ++  D+D+  +       + +  FQ+            K  L+     D E +  Y + +   D      L+ T ++ + V DVNDN PV T  I +    EN +    G ++ E+   D D+  NA +V  L                   F I      + VK+SLDREQ D Y+L ++ +D G P       + V V D NDN P +      + Y  +V        P+ +V   D D  +N+ +  +   ++ + +      TIL+      +S D ++  TY  +++A D G PPR + V +    +   +   ++   S  S  L+ 
Sbjct:  133 QIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQD-GGNPPRASSALLRVTVLDTNDNAPKFERPTYEA-ELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAPEVVRRLLRLDRNTGL-------ITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDS-GNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKP---GEVVAEVTASDADSGSNAELVYSLEPEPAAQGL----------FTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFML----SGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNGDFVIQNGTGTILSS-----LSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRLLT 705          
BLAST of Protocadherin-1 vs. Ensembl Mouse
Match: Pcdhac2 (protocadherin alpha subfamily C, 2 [Source:MGI Symbol;Acc:MGI:1891443])

HSP 1 Score: 204.142 bits (518), Expect = 3.679e-53
Identity = 187/669 (27.95%), Postives = 308/669 (46.04%), Query Frame = 2
Query:  230 ANVVKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLDFK-GHLLVNKRIDREFLCPNVDKIDDCQLELMIHAF-PDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFS----LTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHS--LNYHL------DPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVM--TGIKQFVIRENV-QILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVED 2185
            A+ ++Y + EE     L+GN+      E +R+         +         +LD   G L VN+RIDRE LC   ++   C L L + A  P     + + I DINDN P+FP  + +++VSES+A G +  +++A D D+    VQ+Y L  SE  F L  +P+      L LV+ K LD E  +  Y  L L A DGG P +    ++ + V D+NDN+P FDQ+     ++E  P G+++   NASD D G  G++ + L    + + +  F+++  TGE+ +  +L+ +  S + + V+A D   V P +  C++ + + D N++AP + L D  S  + E+      V ++  +D D   N KV+  L    S    L+   N      Y LV +   DRE +  + I ++  D G PP  S +   V + DIN+ PPSF   +YSI+I E+      L  ++A D D+  +  + Y L         V     I+   G L  +  FD E   ++ V V   D+ R  + +  T     V   +    ++  T        E V +    G L+ ++   D D+  NA      L  H++    S +      F+++ +   + +   +  E    + L +++ D G P  S    ITV V D
Sbjct:   40 ASQLRYSVPEEQSPGALVGNVARALGLE-LRRLGPGCLRINHLGAPSPRYLELDLTNGALFVNERIDREALC---EQRPRCLLSLEVLAHNPVAVSAIEVEILDINDNSPRFPRPDYQLQVSESVAPGARFHIESAQDPDVGANSVQTYELSPSE-HFELDLKPLQENSKVLELVLRKGLDREQTALHY--LVLTAVDGGIPARSGTAQIAVRVLDTNDNSPAFDQSTYRVQLREDAPPGTLVVKLNASDPDEGSNGELRYSLSSYTSDRERQLFSIDVTTGEVRVSGTLDYEESSSYQIYVQATDRGPV-PMAGHCKVLVDIIDVNDNAPEVVLTDLYS-PVPEDVALNTVVALLSVNDQDSGSNRKVSLGL--EASLPFRLNGFGNS-----YTLVVSGPLDRERVAAYNITVTATDGGVPPLTSQRTLQVEISDINDNPPSFLKDSYSIYIEENNLPGVLLCTVQATDPDQKENAEVTYSLLDREIQGLPVTSYVSINSASGSLYAVNSFDYEKFREFFVTVEAQDKGRPPLSSTVTANVYVVDVNDHAPHILYPTSTNTSAAIEMVPRTAPAGYLVTKVIAMDSDSGQNA-----WLFYHLVPTSDSDL------FKVELHTGEIRITRKIGDESGTTFNLTVVVRDNGEPPLSATVAITVAVVD 681          

HSP 2 Score: 98.2117 bits (243), Expect = 3.654e-20
Identity = 115/507 (22.68%), Postives = 218/507 (43.00%), Query Frame = 2
Query: 1031 YFNLNFNTGELVLITSLNAKIV----SKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHS--LNYHLDPSVNDK----FQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKY--KCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIIL---VQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFM--SRDLQESGTYYLKIQATDNGSPPRFSDVT 2500
            Y  L+   G L +   ++ + +     + +L +E    N V    +   + + + D N+++P     D + L + E+   G    +  A D D+  N   T  L  + S +  LD     ++  +  LV  +  DRE      ++++  D G P         V V D N+  P+F  S Y + + ED    + ++++ A D D+  +  L Y L    +D+    F ID+  G ++     D E    Y + V  TD+    +      +   +   ++   V+       + E+V + T   ++  L   D D+  N  V   L +              +  F ++ +     L V   LDRE++  Y + +  +D G+P  ++   + V + D NDN P +     + +Y + +  E NL  P +L   VQATD D K+N+ ++Y+ ++ ++  L    Y +I + +G ++   S D ++   +++ ++A D G PP  S VT
Sbjct:   88 YLELDLTNGALFVNERIDREALCEQRPRCLLSLEVLAHNPV----AVSAIEVEILDINDNSPRFPRPDYQ-LQVSESVAPGARFHIESAQDPDVGANSVQTYEL--SPSEHFELDLKPLQENSKVLELVLRKGLDREQTALHYLVLTAVDGGIPARSGTAQIAVRVLDTNDNSPAFDQSTYRVQLREDAPPGTLVVKLNASDPDEGSNGELRYSLSSYTSDRERQLFSIDVTTGEVRVSGTLDYEESSSYQIYVQATDRGPVPMAGHCKVLVDIIDVNDNAPEVVLTDLYSPVPEDVALNT---VVALLSVNDQDSGSNRKVSLGLEA--------------SLPFRLNGFGNSYTLVVSGPLDRERVAAYNITVTATDGGVPPLTSQRTLQVEISDINDNPPSFL----KDSYSIYIE-ENNL--PGVLLCTVQATDPDQKENAEVTYSLLDREIQGLPVTSYVSINSASGSLYAVNSFDYEKFREFFVTVEAQDKGRPPLSSTVT 563          

HSP 3 Score: 97.8265 bits (242), Expect = 4.966e-20
Identity = 151/629 (24.01%), Postives = 257/629 (40.86%), Query Frame = 2
Query:  839 LQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNL-------NFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRES--LTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNM--KDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINS--ALIQIKALDKDKTHSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSP--IWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDL-QESGTYY-LKIQATDNGSPPRFSDVTIITVKISTAEK----TNYLIKN----SQISFTLIVVTSLASFSICVALMV-GIILMWR 2647
            +++E+ D NDN+P F +      + ES   G+   I +A D D G      ++L P+       +F L       N    ELVL   L+ +  +   L + A D  G+   S   Q+ +RV D N+++P     D+ +  + + E++P G  V  + ASD D   NG++   L    S+Y + DR   +   D     +  +   D E    + I +   D G  P        V + D+N+  P    ++    + ED+ +N+  AL+ +   D      ++  L+ S+  +     N   L      DRE +  Y + V  TD     + +  T         ++    +       I EN      G L+  +Q  D D   NA V   LL   +    ++          I+    +L+  +S D E+  ++ + +   D G P  S+     V V D ND++P  ++    N +A    V       + +  V A D D+ +N+ + Y+ V    + L     F +    G I ++R +  ESGT + L +   DNG PP  + V I    +    K    T   IK+    S+I+  LI+  S  SF   + ++V  II  +R
Sbjct:  133 IEVEILDINDNSPRFPRPDYQLQVSESVAPGARFHIESAQDPDVGANSVQTYELSPSE------HFELDLKPLQENSKVLELVLRKGLDREQTALHYLVLTAVD-GGIPARSGTAQIAVRVLDTNDNSPAF---DQSTYRVQLREDAPPGTLVVKLNASDPDEGSNGELRYSL----SSYTS-DRERQLFSIDVTTGEVRVSGTLDYEESSSYQIYVQATDRGPVPMAGHCKVLVDIIDVNDNAPEVVLTDLYSPVPEDVALNTVVALLSVNDQDSGSNRKVSLGLEASLPFRLNGFGNSYTLVVSGPLDRERVAAYNITVTATDGGVPPLTSQRTLQVEISDINDNPPSFLKDSYSIYIEENN---LPGVLLCTVQATDPDQKENAEVTYSLLDREIQGLPVTSY------VSINSASGSLYAVNSFDYEKFREFFVTVEAQDKGRPPLSSTVTANVYVVDVNDHAPHILYPTSTNTSAAIEMVPRTAPAGYLVTKVIAMDSDSGQNAWLFYHLVPTSDSDL-----FKVELHTGEIRITRKIGDESGTTFNLTVVVRDNGEPPLSATVAITVAVVDRVSKMLPDTQRHIKSPRTYSEITLYLIIALSTVSFIFLLTIIVLSIIKCYR 732          
BLAST of Protocadherin-1 vs. UniProt/SwissProt
Match: sp|Q9BZA7|PC11X_HUMAN (Protocadherin-11 X-linked OS=Homo sapiens OX=9606 GN=PCDH11X PE=2 SV=1)

HSP 1 Score: 213.001 bits (541), Expect = 1.128e-54
Identity = 222/819 (27.11%), Postives = 358/819 (43.71%), Query Frame = 2
Query:  212 HSYNFEANVVKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFT----YKIYTTDIDSNLTKL--DFKGHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFPD---HWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSL--LYRPMFS--LTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSL-----GDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLV----------TTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDK--THSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIK-QFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTIITV----KISTAEKTNYLIKNS 2557
            HS   E N   Y ++EE   N LIG++ +D     +  P ++ T    +K+     D  L ++  D         RIDRE LC  + + + C  E+ +   PD     +K+  +IEDINDN P FP     I + E+ A+ ++  L  A+D D+   GVQ+Y L  S+  F L  +  P       L+V K+LD E      + + +   DGG P +     LQ+ VTD+NDN+P+F +T+    I E+ P+G+ +   +A+DAD G   KI+F      +   +  F+LN  TG + +   L+ +      L V A D  G+ P  ++  + + V D N++ P + +        +++ + EN P    + ++  +D D + NG+VTC                    EI +RL           T    D E    + I +   D G PP     +  + V D N+  P F  S  ++ I E+      L ++ A+D D      +NY L P    +F +D   G+L  +   DRE   KY+  +   D      LT   TV++++ D NDN+PV T  +  F + EN   L     +G +   D D   N+ V   +L               N  F ID     +    S DRE+ + Y   +   D G   RS+   +T+ V D NDN P++    +  +Y++ V   TN    +  V A D D   N+ + Y+ V  +   L     F I    G I +    D+ + G + + ++A D G P     V I+ +     ++ A   N L++ S
Sbjct:   20 HSGAQEKN---YTIREEMPENVLIGDLLKDLNLSLI--PNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREE--KDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASD-GGLMP--ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCF----------------TDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDN-GVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPEN---LPRHGTVGLITVTDPDYGDNSAVTLSILDE-------------NDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYEL-VLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDL-----FAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNATLINELVRKS 789          
BLAST of Protocadherin-1 vs. UniProt/SwissProt
Match: sp|Q6WXV7|PC11X_PONPY (Protocadherin-11 X-linked OS=Pongo pygmaeus OX=9600 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 3.280e-54
Identity = 223/819 (27.23%), Postives = 358/819 (43.71%), Query Frame = 2
Query:  212 HSYNFEANVVKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFT----YKIYTTDIDSNLTKL--DFKGHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFPD---HWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSL--LYRPMFS--LTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSL-----GDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLV----------TTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDK--THSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIK-QFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTIITV----KISTAEKTNYLIKNS 2557
            HS   E N   Y ++EE   N LIG++ +D     +  P ++ T    +K+     D  LT++  D         RIDRE LC  + + + C  E+ +   PD     +K+  +IEDINDN P FP     I + E+ A+ ++  L  A+D D+   GVQ+Y L  S+  F L  +  P       L+V K+LD E      + + +   DGG P +     LQ+ VTD+NDN+P+F +T+    I E+ P+G+ +   +A+DAD G   KI+F      +   +  F+LN  TG + +   L+ +      L V A D  G+ P  ++  + + V D N++ P + +        +++ + EN P    + ++  +D D + NG+VTC                    EI +RL           T    D E    + I +   D G PP     +  + V D N+  P F  S  ++ I E+      L ++ A D D      +NY L P    +F +D   G+L  +   DRE   KY+  +   D      LT   TV++++ D NDN+PV T  +  F + EN   L     +G +   D D   N+ V   +L               N  F ID     +    S DRE+ + Y   +   D G   RS+   +T+ V D NDN P++    +  +Y++ V   TN    +  V A D D   N+ + Y+ V  +   L     F I    G I +    D+ + G + + ++A D G P     V I+ +     ++ A   N L++ S
Sbjct:   20 HSGAQEKN---YTIREEMPENVLIGDLLKDLNLSLI--PNKSLTTAMQFKLVYKTGDVPLTRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREE--KDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASD-GGLMP--ARAMVLVNVTDVNDNVPSIDIRYIVNPINDTVVLSENIPLNTKIALITVTDKDADHNGRVTCF----------------TDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDN-GVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPEN---LPRHGTVGLITVTDPDYGDNSAVTLSILDE-------------NDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYEL-VLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDL-----FAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNATLINELVRKS 789          
BLAST of Protocadherin-1 vs. UniProt/SwissProt
Match: sp|Q9BZA8|PC11Y_HUMAN (Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 GN=PCDH11Y PE=1 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 5.802e-54
Identity = 234/855 (27.37%), Postives = 373/855 (43.63%), Query Frame = 2
Query:  212 HSYNFEANVVKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFT----YKIYTTDIDSNLTKL--DFKGHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFPD---HWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSL--LYRPMFS--LTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSL-----GDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDREL-------LDY-----FTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDK--THSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIK-QFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTIITV----KISTAEKTNYLIKNSQISFTLIVVTSLASFS--------ICVALMVGII 2635
            HS   E N   Y ++EE   N LIGN+ +D     +  P ++ T    +K+     D  L ++  D         RIDRE LC  + + + C  E+ +   PD     +K+  +IEDINDN P FP     I + E+ A+ ++  L  A+D D+   GVQ+Y L  S+  F L  +  P       L+V K+LD E      + + +   DGG P +     LQ+ VTD+NDN+P+F +T+    I E+ P+G+ +   +A+DAD G   KI+F      +   +  F+LN  TG + +   L+ +      L V A D  G+ P  ++  + + V D N++ P + +        +++ + EN P    + ++  +D D + NG+VTC                    EI +RL    VF  +        LDY     + I +   D G PP     +  + V D N+  P F  S  ++ I E+      L+++ A D D      +NY L P    +F +D   G+L  +   DRE   KY+  +   D      LT   TV++++ D NDN+PV T  + +F + EN   L     +G +   D D   N+ V   +L               N  F ID     +    S DRE+ + Y   +   D G   RS+   +T+ V D NDN P++       +Y++ V   TN    +  V A D D   N+ + Y+ V  +   L     F I    G I +    D+ + G + + ++A D G P     V I+ +     ++ A   N L++ S I   +   T +A  S        I VA + G I
Sbjct:   52 HSGAQEKN---YTIREEIPENVLIGNLLKDLNLSLI--PNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREE--KDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASD-GGLMP--ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCF----------------TDHEIPFRL--RPVFSNQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDN-GVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPEN---LPRHGTVGLITVTDPDYGDNSAVTLSILDE-------------NDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPYNYSYEL-VLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDL-----FAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNATLINELVRKS-IEAPVTPNTEIADVSSPTSDYVKILVAAVAGTI 854          
BLAST of Protocadherin-1 vs. UniProt/SwissProt
Match: sp|Q6WYY1|PC11X_PANPA (Protocadherin-11 X-linked OS=Pan paniscus OX=9597 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 6.563e-54
Identity = 222/819 (27.11%), Postives = 357/819 (43.59%), Query Frame = 2
Query:  212 HSYNFEANVVKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFT----YKIYTTDIDSNLTKL--DFKGHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFPD---HWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSL--LYRPMFS--LTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSL-----GDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLV----------TTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDK--THSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIK-QFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTIITV----KISTAEKTNYLIKNS 2557
            HS   E N   Y ++EE   N LIG++ +D     +  P ++ T    +K+     D  L ++  D         RIDRE LC  + + + C  E+ +   PD     +K+  +IEDINDN P FP     I + E+ A+ ++  L  A+D D+   GVQ+Y L  S+  F L  +  P       L+V K+LD E      + + +   DGG P +     LQ+ VTD+NDN+P+F +T+    I E+ P+G+ +   +A+DAD G   KI+F      +   +  F+LN  TG + +   L+ +      L V A D  G+ P  ++  + + V D N++ P + +        +++ + EN P    + ++  +D D + NG+VTC                    EI +RL           T    D E    + I +   D G PP     +  + V D N+  P F  S  ++ I E+      L ++ A D D      +NY L P    +F +D   G+L  +   DRE   KY+  +   D      LT   TV++++ D NDN+PV T  +  F + EN   L     +G +   D D   N+ V   +L               N  F ID     +    S DRE+ + Y   +   D G   RS+   +T+ V D NDN P++    +  +Y++ V   TN    +  V A D D   N+ + Y+ V  +   L     F I    G I +    D+ + G + + ++A D G P     V I+ +     ++ A   N L++ S
Sbjct:   20 HSGAQEKN---YTIREEMPENVLIGDLLKDLNLSLI--PNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGTNGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREE--KDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASD-GGLMP--ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCF----------------TDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDN-GVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPEN---LPRHGTVGLITVTDPDYGDNSAVTLSILDE-------------NDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYEL-VLPSTNPGTVVFQVMAVDNDTGMNAEVRYSIVGGNTRDL-----FAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNATLINELVRKS 789          
BLAST of Protocadherin-1 vs. UniProt/SwissProt
Match: sp|Q71M42|PC11X_PANTR (Protocadherin-11 X-linked OS=Pan troglodytes OX=9598 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 6.736e-54
Identity = 222/819 (27.11%), Postives = 357/819 (43.59%), Query Frame = 2
Query:  212 HSYNFEANVVKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFT----YKIYTTDIDSNLTKL--DFKGHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFPD---HWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSL--LYRPMFS--LTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSL-----GDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLV----------TTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDK--THSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIK-QFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTIITV----KISTAEKTNYLIKNS 2557
            HS   E N   Y ++EE   N LIG++ +D     +  P ++ T    +K+     D  L ++  D         RIDRE LC  + + + C  E+ +   PD     +K+  +IEDINDN P FP     I + E+ A+ ++  L  A+D D+   GVQ+Y L  S+  F L  +  P       L+V K+LD E      + + +   DGG P +     LQ+ VTD+NDN+P+F +T+    I E+ P+G+ +   +A+DAD G   KI+F      +   +  F+LN  TG + +   L+ +      L V A D  G+ P  ++  + + V D N++ P + +        +++ + EN P    + ++  +D D + NG+VTC                    EI +RL           T    D E    + I +   D G PP     +  + V D N+  P F  S  ++ I E+      L ++ A D D      +NY L P    +F +D   G+L  +   DRE   KY+  +   D      LT   TV++++ D NDN+PV T  +  F + EN   L     +G +   D D   N+ V   +L               N  F ID     +    S DRE+ + Y   +   D G   RS+   +T+ V D NDN P++    +  +Y++ V   TN    +  V A D D   N+ + Y+ V  +   L     F I    G I +    D+ + G + + ++A D G P     V I+ +     ++ A   N L++ S
Sbjct:   20 HSGAQEKN---YTIREEMPENVLIGDLLKDLNLSLI--PNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGTNGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREE--KDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASD-GGLMP--ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCF----------------TDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDN-GVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPEN---LPRHGTVGLITVTDPDYGDNSAVTLSILDE-------------NDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYEL-VLPSTNPGTVVFQVMAVDNDTGMNAEVRYSIVGGNTRDL-----FAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNATLINELVRKS 789          
BLAST of Protocadherin-1 vs. TrEMBL
Match: A0A183A885 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS3170 PE=4 SV=1)

HSP 1 Score: 343.969 bits (881), Expect = 3.945e-96
Identity = 277/928 (29.85%), Postives = 428/928 (46.12%), Query Frame = 2
Query:  239 VKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLDFKGHLLVNKRIDREFLCPNVDKI---------DD------------------CQLELMIHAFPDHWIKVFIIIEDINDNKPKFPTKEK-------RIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSE---PFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTP-VQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSL-----------GDRE-----SLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMIS--CQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSN--YSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVT--DQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIP-KRSNMEIITVMVEDENDNSPIW-------------------RYQNNQTAYQ-------VNVTAETNLNHPIILVQATDIDAKKNSNISYNFV-------NNDVNSLW-------------YEKYFTILTRNGGIFMSRDL-----QESGTYYLKIQATDNGSPP------RFSDVTIITVKISTAEKT-----NYLIKNSQISFTLIVVTSLASFSICVALMVGIILMWRKS 2653
            + Y + EES++ + +GN+  D+  +++    +   +++Y              G L V  RIDRE +CP  D +         DD                  CQ+ L +H    +W+ V + I DIND+KP FP            + VSES+  G ++PL  A D D     VQSY+L  +E     F++ Y+P F+L LVVL++LD E  S   +   LIACDGG P  QC  Q  QI V D NDN P+F ++     ++E+ P+ S +   NA+DADSG  G+I +      +     +F L+   GEL     LNA+   +F++ V A+D  G+ P   Q  + I V+D N+H P + +           GDR+     +L + EN P G ++G++IA D D+ +N  V C  LK++ +   L+ +++ K   +YRL T   FDRE L    + +   C D G P   + +   V + D NEF P+F  S    ++++ E  ++ + + Q++A D D T  + YHL     + F ID + GI+   V  DRE +PK    VF T  DQ           V + + D+NDN P +TG + F I EN     + +L+G+L + D D   N TV   L+SV    N      L+N +F ++     LF   SLDRE+  +Y+L +++ D G P K ++ E ITV V DENDN+P+W                   R  +             +N T        I  + ATD DA  N+N+SY+ +       N + N +                 +F + +  G +F+   L      + G   L  +  DNG+PP       F  +T  +   +  + T     +YLI    +   LIVV  +      + L+V    + RKS
Sbjct:   36 LTYAINEESEVGSFVGNLKLDAERKFLIPYNQLTRFELYDDTRQGYFRVEQDTGKLFVAARIDRETICPQPDALIPETMPTYPDDLWASVPTQQDSDQSEGSVCQVHLALHIAQQYWVNVIVTIHDINDHKPYFPLGPSGLGLPVYTVNVSESVTAGYEIPLVGAKDADAGINSVQSYSLRGAELDPALFAIAYKPPFTLNLVVLQELDAETKS--TYTGELIACDGGQPQPQCGVQPFQIIVNDLNDNKPVFAKSLYEVEVEETLPVNSTVIRLNATDADSGPRGEIRYVFGQPISQAVLHHFFLDSVIGELTTRRPLNARENPRFLIPVLAKD-GGIVPLIGQTVVQITVRDVNDHDPWIEIRAVQSVGQQGAGDRQVEQNITLFVPENQPIGTNIGLLIAGDEDVGENSAVVC-QLKSNQDRFYLEHANSAKGREMYRLGTNLSFDRESLPNGIVYVDVLCVDGGKPKRSTERKIPVQILDENEFAPAFDPSKKIQNVYLEEGKDVGTFVTQVQATDADATPKIQYHLSREAQNLFHIDADTGIIVTRVVLDREQMPKIRFSVFATDHDQSDRQAAPAVANVTVHLVDINDNAPELTGNRAFHIVENRP--GFSDLVGQLTSVDKDVGNNGTVRYRLVSVSGNGN-----PLVNETFMLNPDSGKLFTLHSLDREEYSQYELTVLLEDQGTPYKLNSTESITVEVLDENDNAPVWGDPLRIMTTVEHLPTPEALRKSSRMLGLSKLKDLGLLNATTPFYHGQKIAKLTATDPDAPHNANLSYHLLATYFIPFNEEFNVIGEHTQLVSSKPAPNVPTHFKLASATGDLFIGPGLGGVGSAKGGLAELYFRVCDNGNPPLDSSARLFIQLTAYSSNSAALDSTSGGFLSYLISTGHLGIALIVVLFVIMCLTSICLVVAFTTIRRKS 952          
BLAST of Protocadherin-1 vs. TrEMBL
Match: A0A2H1C537 (Cadherin domain protein OS=Fasciola hepatica OX=6192 GN=D915_10443 PE=4 SV=1)

HSP 1 Score: 340.117 bits (871), Expect = 8.117e-95
Identity = 279/931 (29.97%), Postives = 433/931 (46.51%), Query Frame = 2
Query:  239 VKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLDFKGHLLVNKRIDREFLCPNVDKI---------------------------DDCQLELMIHAFPDHWIKVFIIIEDINDNKPKFPTKEK-------RIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSE---PFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQ-CDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPIL-----------------SLGDR-ESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRE-LLDYFT-IMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYS--IFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXX--XXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSN-MEIITVMVEDENDNSPIW----------RY--------QNNQTAYQVN------VTAETNLNH--PIILVQATDIDAKKNSNISYNFVN------NDVNSLWYEK--------------YFTILTRNGGIFMSRDL-----QESGTYYLKIQATDNGSPPRFSDVTIITVKISTAEKT------------NYLIKNSQISFTLIVVTSLASFSICVALMVGIILMWRKS 2653
            + Y + EES++ + +GN+  D+  +++    +   + +Y              G L V  RIDRE +CP  D +                           + CQ+ L +H     W+ V I I DIND+KP FP            + +SES+  G ++PL  A D D     VQ+Y+L  +E     F++ Y+P F+L LV+L++LD E  S   ++  L+ACDGG P   C  Q  Q+ V D NDN P+F ++     ++E+ PI S +   NA+DADSG  G + +      +     +F L+  TGEL+    +NA+   +FI+ V A+D  G+ P   Q  + I V+D N+H P +                 +L D+  SL + EN P G ++G++IA D D+ DN  V C L  N +++  L+ +++ K   +YRL T   FDRE LLD    + + C D GNP   + +   + V D NEF PSF  S  +  +++ E   + + +IQ++A D+D T  + ++L     + F ID   G +   V  DRE +PK    V+ TDQ +           ITV     NDN P +TG + F I EN     + +L+G+L + D D   N TV   L+SV    N ++     N +F ++     LF   SLDREQ  +Y+L +++ D G P+  N    ITV V DENDN+P+W          +Y        QN++    VN      + A T   H   +  + ATD DA  N+N++Y+ +       N+   L  E               YF +    G +F+   L      +SG   L ++  DNG+PP  S   +  V++++   T            +YLI    +   LIVV  +      + L+V    + RKS
Sbjct:   36 LTYAINEESEVGSFVGNLKLDAERKFLIPYNQLTRFDLYDDTRQGYFRVEQETGKLFVAARIDREAICPQPDALIPDKLTTYTEDLWSTLPGQRNGDQSGANVCQVHLALHIAQQFWVNVIITIHDINDHKPYFPIGSADAEPSLYTVNISESVTAGYEVPLIGAKDADAGMNSVQTYSLRGAELDPSLFAIAYKPPFTLNLVILRELDAETKS--TYHGELVACDGGQPQPLCGAQPFQVFVNDLNDNKPVFTKSLYEVEVEETLPINSTVIRLNATDADSGPRGHVQYLFGQPISQAVHHHFRLDPVTGELITQRGMNARENPRFIIPVVAKD-GGLVPLIGQTVVQITVRDVNDHDPWIEIRAVQSVRQQGPQSRSNLTDKNTSLFVSENQPIGTNIGLLIAGDEDVGDNSAVVCHLKSNQAHFY-LEHANSAKGREMYRLGTNLSFDREALLDGVVYVDVLCLDGGNPKRSTERKIAIQVLDENEFTPSFDTSQKTQNVYLEEGKPVGTFVIQVRATDEDATPKIEHYLSREAQNLFHIDAESGAITTRVILDREQMPKIRFNVYATDQDQSDRRASPAVANITVHLADINDNAPELTGNRAFHIVENRP--GFSDLVGQLTSIDKDVGNNGTVRYSLVSVSGNGNPIA-----NDTFMLNPDSGKLFTLRSLDREQYSQYELVVLLEDRGTPQALNSTATITVDVLDENDNAPVWSDPLRIMSALKYVSIPEALRQNSRMLGLVNFKDLGLLNATTPFYHGQKVTRLTATDPDAPHNANLTYHLLATYFIPFNEEFDLGKESAHSFASRVAPNVPTYFKLSATTGDLFIGPGLGGAGSAKSGLAELYLRVCDNGNPPLDSSARLF-VQLTSYNPTSVILDPNNGGFLSYLISTGHLGIALIVVLFVIMCLTSICLVVAFTTIRRKS 954          
BLAST of Protocadherin-1 vs. TrEMBL
Match: A0A0R3VT89 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS439 PE=4 SV=2)

HSP 1 Score: 337.035 bits (863), Expect = 2.076e-94
Identity = 285/921 (30.94%), Postives = 445/921 (48.32%), Query Frame = 2
Query:  239 VKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLDF-KGHLLVNKRIDREFLCP-----------------NVD-KIDDCQLELMIHAFPDHWIKVFIIIEDINDNKPKFPTKE-----KRIK-------VSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSE---PFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPV-QCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILS-------LGDRES------LTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFT---IMISCQDYGNPPHRSFQLFNVSVGDINEFPPSF--YHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPK-----YIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIP-KRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVT---------------------AETNLNHP------IILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQ----------------------------ESGTYYLKIQATDNGSPPRFSDVTI-ITVKISTAEKTN-YLIKNSQISFTLIVVTSLASFSICVALMVGIILMWRKS 2653
            + Y +KEESD  T IGN+  DS    +     +   ++Y   + + L ++D   G L+V+ RIDRE +CP                 N D     CQ++ + H  PDHWI + +I+EDIND+ P+F   +      RI        +SE +++G ++PL  A DED +  G+QSY+L  S+     F+L + P   L LVV KKLDFE  +   +   +  CDGG P  QC  Q + I +TDSNDNNP FD+      I E+TP+ ++I    A DADSG FGKI ++           +F +N NTGE+ + + L+AKI+S   + + A+D  G  P +    L I ++D NNH P +        +G ++S      L + EN P G  +G+++  D D+  NG+V+C L  NDS +  L  S + ++  +Y L +T  FD E +   T   + + C D GNP   S Q   V++ D+NE+P  F    SN  + + ED    S ++ I+A D+D T  + + L  S ++ F+ID + G +  I  FDRE I K      +V + V D            V + + D+NDN+PV+  I  F I EN     Y +L+G+L+  D D   N TV             MS     N  F+I+     ++ K+ LDRE + +Y+L I I+DLG P  R  +E I + VED NDN PIW+    +T  ++++T                     A  N++H       I  + A D D + N+N S++ ++ +    +Y     +L  N  + ++ + Q                            ESG + L ++ +DNG+PP  SD  + I ++ +    T+ Y I        L VV  L + S+ + +++ +I   +KS
Sbjct:   26 ITYVVKEESDNGTFIGNLLIDSGLNDIVPTGGDVGIQLYEDQV-TGLFRIDGNSGKLVVSGRIDREAICPQQGGTPASNSLASHLLGNTDNSPSKCQVDFIAHIPPDHWINIAVIVEDINDHAPQFQHNDPNEFGGRITNPPYIVFISEGVSIGYEVPLNGATDEDADSNGIQSYSLCGSDIDNSTFALKFVPPAELNLVVKKKLDFEEKTS--YKGQIKVCDGGRPTPQCAFQNISIFITDSNDNNPHFDKEFYEVKISETTPVMTIIAAVTAKDADSGGFGKITYRFGQIYDRNVINFFGINENTGEVWVKSPLDAKILSHLKIPIIAQD-GGTIPKTGTAMLQIDIEDVNNHPPWIEVKPISPPVGMKKSTDGFVQLWVEENQPIGTQLGIILTGDRDIGTNGEVSCELKGNDSPF-RLSYSSSGRERKMYSLQSTIRFDLEAMLPHTPIALQVECSDGGNPKMISRQNIQVNIVDVNEYPSYFTKTQSNLVVHLPEDAPPGSLVVDIQATDRDATPKMKFELVDSSSNLFRIDSSSGRVYTIGSFDREQIEKIYFAVRVVEMDVLDPRIPPSGYEIANVTLVLDDINDNSPVLESISTFRILENRP--AYSDLVGQLKAFDPDLGENGTV-----------RFMSS----NDLFDINPISGKIYAKAVLDRETVSQYQLEIEITDLGRPISRKTLERICINVEDVNDNKPIWKAP-EKTHQEISMTKVAKIIRSSNRYPGLDGVPCVALVNISHHASAQLNIAKLMAADADTEPNANFSFSIISGN----YYSGESFVLNTNYTLNLTSEPQIINANEHFHINQITWVLSVLNREHISQSESGLFELILRVSDNGNPPLHSDALMYIRLQKNNGFVTSFYGILQHSKHVILFVVACLMACSVILPIVICLIRNRQKS 919          
BLAST of Protocadherin-1 vs. TrEMBL
Match: A0A0R3X3J4 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS7908 PE=4 SV=1)

HSP 1 Score: 337.421 bits (864), Expect = 5.319e-94
Identity = 294/1011 (29.08%), Postives = 457/1011 (45.20%), Query Frame = 2
Query:  239 VKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLDFKGHLLVNKRIDREFLCPNVDKID--------------DCQLELMIHAFPDHWIKVFIIIEDINDNKPKFPTKEKR------------IKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSE---PFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPV-QCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSL-------GDRES------LTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELL---DYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSF--YHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQ-----VRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIP-KRSNMEIITVMVEDENDNSPIWRYQ----------------NNQTAYQ----VNVTAETNLNHP------IILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQ----------------------------ESGTYYLKIQATDNGSPPRFSDVTIITVKISTAEKTNYL--IKNSQISFTLIVVTSLASFSICVALMVGIILMWRKS--------------------YPIQLNSDRTTGNWDDPKTLQWEISPFV---DVDHRPNESIVL----NDSKFYNSMTSDLCNICVADPLLTQFRDF 2860
            V Y +KEE+D  T IGNI  DS    +     +   ++Y   +          G L+V+ RIDRE +CP    I                CQ++ + H  PDHWI + +I+EDIND+ P+F   +              + +SE +++G ++PL  A DED +  G+QSY L  ++     F L +     L LVV KKLDFE  +   +   + ACDGG P+ QC  Q + I +TDSNDN P FD+      I E+TP+ +VI +  A DADSG FGK+ ++           +F +N NTGE+ +   L+AKI+S   + V A+D  G  P +    L I ++D NNH P + +       G R+S      L + EN P G  +G+++  D D+  NG+V+C L  N+S +  L  S + ++  +Y L +T  FD E +       + + C D G P   S Q   V++ D+NEFP  F    SN  + + ED    S +++I+A D+D T  + + L  S ++ F+ID + G +  +  FDRE   K    V V D                 + + + DVNDN+P +  I  F I EN     Y +LIG+L+  D D   N TV             MS     N  F+I+     ++ K+ LDRE + +Y+L + ISDLG P  R  +E I+++VED NDN P+W+                   + T Y     V+  A  N++H       I+ + A+D D + N+N S++ V+ +    +Y      L  N  + +S + Q                             SG + L ++ +DNG+PP  SD  +            YL  I +      L VV  L   S+ + +++ +I   RKS                    YP   N     G W   + L  +  PF+   D+    + S++      ++  ++ M++  C +C   P L Q   +
Sbjct:   26 VTYVVKEEADNGTFIGNILVDSGLSDVISTGGDMGIQLYEDQVTGLFRTDGNSGRLVVSGRIDREMICPQRGTISASNLLLGGVDNTPSKCQVDFIAHIPPDHWINIAVIVEDINDHAPQFQHNDPNAFGGRTANPPYIVFISEGVSIGYEVPLTGATDEDADNNGIQSYTLCGTDIDNSTFDLKFALPGELNLVVKKKLDFEEKTS--YKGQIKACDGGRPIPQCAYQNISIFITDSNDNKPHFDKEIYELRISEATPVMTVIAVVTAKDADSGDFGKLTYRFGQVYDHNAINFFGINENTGEVWVKRPLDAKIMSHLKIPVIAQD-GGTIPKTGTAMLQIDIEDVNNHPPWIEVKPISPPAGMRKSTDGYVQLWVEENQPIGTQIGIILTGDQDIGPNGEVSCELKGNNSPF-QLSYSSSGQERKMYGLQSTIRFDLEAMLPHAPIALQVECSDAGTPKIVSRQNIQVNIVDVNEFPAHFTKIQSNLVVHLPEDAPPGSLVVEIQATDRDATPKMKFELVESGSNLFRIDSSSGRIYTLGSFDREQTGKIDFAVRVVDMDVLGPRTPNSEYELANITVVLDDVNDNSPALESICTFKILENRP--AYSDLIGQLRAFDPDLGENGTV-----------RFMSS----NELFDINPISGKIYAKAVLDREIVSQYQLEVEISDLGRPFSRKTLERISIIVEDVNDNEPVWKVPEKMHQEISITAVTKIIRSSTRYAGLDGVSCVALVNISHQAPTQLNIVKLMASDADTEPNANFSFSIVSGN----YYSDTSFALNANYTLNLSAEPQYINANEHFHINQITWVVSVLNSELPSQDGSGLFELILRVSDNGNPPLHSDALMYIQHRKNNGFVAYLFGILHHSKHVILFVVACLMVCSVVLPVVICLIRNRRKSQECGGRGIVACVSGEGVGQNYP--PNDRSAAGGWAKEQMLLAQ-PPFISSFDIAEEMSASLIRCSTDREAVNFSQMSNVQCQVC---PSLAQLSGY 1005          
BLAST of Protocadherin-1 vs. TrEMBL
Match: A0A4E0R475 (Protocadherin-1 OS=Fasciola hepatica OX=6192 GN=D915_007004 PE=4 SV=1)

HSP 1 Score: 339.732 bits (870), Expect = 1.081e-93
Identity = 279/931 (29.97%), Postives = 433/931 (46.51%), Query Frame = 2
Query:  239 VKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLDFKGHLLVNKRIDREFLCPNVDKI---------------------------DDCQLELMIHAFPDHWIKVFIIIEDINDNKPKFPTKEK-------RIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSE---PFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQ-CDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPIL-----------------SLGDR-ESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRE-LLDYFT-IMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYS--IFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXX--XXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSN-MEIITVMVEDENDNSPIW----------RY--------QNNQTAYQVN------VTAETNLNH--PIILVQATDIDAKKNSNISYNFVN------NDVNSLWYEK--------------YFTILTRNGGIFMSRDL-----QESGTYYLKIQATDNGSPPRFSDVTIITVKISTAEKT------------NYLIKNSQISFTLIVVTSLASFSICVALMVGIILMWRKS 2653
            + Y + EES++ + +GN+  D+  +++    +   + +Y              G L V  RIDRE +CP  D +                           + CQ+ L +H     W+ V I I DIND+KP FP            + +SES+  G ++PL  A D D     VQ+Y+L  +E     F++ Y+P F+L LV+L++LD E  S   ++  L+ACDGG P   C  Q  Q+ V D NDN P+F ++     ++E+ PI S +   NA+DADSG  G + +      +     +F L+  TGEL+    +NA+   +FI+ V A+D  G+ P   Q  + I V+D N+H P +                 +L D+  SL + EN P G ++G++IA D D+ DN  V C L  N +++  L+ +++ K   +YRL T   FDRE LLD    + + C D GNP   + +   + V D NEF PSF  S  +  +++ E   + + +IQ++A D+D T  + ++L     + F ID   G +   V  DRE +PK    V+ TDQ +           ITV     NDN P +TG + F I EN     + +L+G+L + D D   N TV   L+SV    N ++     N +F ++     LF   SLDREQ  +Y+L +++ D G P+  N    ITV V DENDN+P+W          +Y        QN++    VN      + A T   H   +  + ATD DA  N+N++Y+ +       N+   L  E               YF +    G +F+   L      +SG   L ++  DNG+PP  S   +  V++++   T            +YLI    +   LIVV  +      + L+V    + RKS
Sbjct:   36 LTYAINEESEVGSFVGNLKLDAERKFLIPYNQLTRFDLYDDTRQGYFRVEQETGKLFVAARIDREAICPQPDALIPDKLTTYTEDLWSTLPGQRNGDQSGANVCQVHLALHIAQQFWVNVIITIHDINDHKPYFPIGSADAEPSLYTVNISESVTAGYEVPLIGAKDADAGMNSVQTYSLRGAELDPSLFAIAYKPPFTLNLVILRELDAETKS--TYHGELVACDGGQPQPLCGAQPFQVFVNDLNDNKPVFTKSLYEVEVEETLPINSTVIRLNATDADSGPRGHVQYLFGQPISQAVHHHFRLDPVTGELITQRGMNARENPRFIIPVVAKD-GGLVPLIGQTVVQITVRDVNDHDPWIEIRAVQSVRQQGPQSRSNLTDKNTSLFVSENQPIGTNIGLLIAGDEDVGDNSAVVCHLKSNQAHFY-LEHANSAKGREMYRLGTNLSFDREALLDGVVYVDVLCLDGGNPKRSTERKIAIQVLDENEFTPSFDTSQKTQNVYLEEGKPVGTFVIQVRATDEDATPKIEHYLSREAQNLFHIDAESGAITTRVILDREQMPKIRFNVYATDQDQSDRRASPAVANITVHLADINDNAPELTGNRAFHIVENRP--GFSDLVGQLTSIDKDVGNNGTVRYSLVSVSGNGNPIA-----NDTFMLNPDSGKLFTLRSLDREQYSQYELVVLLEDRGTPQALNSTATITVDVLDENDNAPVWSDPLRIMSALKYVSIPEALRQNSRMLGLVNFKDLGLLNATTPFYHGQKVTRLTATDPDAPHNANLTYHLLATYFIPFNEEFDLGKESAHSFASRVAPNVPTYFKLSATTGDLFIGPGLGGAGSAKSGLAELYLRVCDNGNPPLDSSARLF-VQLTSYNPTSVILDPNNGGFLSYLISTGHLGIALIVVLFVIMCLTSICLVVAFTTIRRKS 954          
BLAST of Protocadherin-1 vs. Ensembl Cavefish
Match: pcdh18a (protocadherin 18a [Source:ZFIN;Acc:ZDB-GENE-000607-1])

HSP 1 Score: 233.032 bits (593), Expect = 3.312e-62
Identity = 184/662 (27.79%), Postives = 317/662 (47.89%), Query Frame = 2
Query:  230 ANVVKYRLKEESDINTLIGNIFEDSRSEYMRKPKE-NFTYKIYT---TDIDSNLTKLDFKGHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFPDHWIKVF-IIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPF-FSLLYRPMFS--LTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFS--SQCQLTIRVQDENNHAP-----ILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKD--KTHSLNYHL------DPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQI---LTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLG 2137
             + V+YR+ EE  + ++IG + +D+  +  R P   +  ++  T       S L+  +  G + V  R+DRE LC       +C LE  +   P   +++F +++ D+ND+ P+F      +++SES AVG ++PL +A D D    G+ SY+L  S+ F   +L RP  +    LVVL  LD E  S   + L L A DGG P +     L+I V DSNDN+P F+++     + E  P+G +I   NA+D D G  GKI +      + K    F ++ + G L L+  ++ ++   + +DV+A+D   +GP S  + C++T++V+D N++ P     +++  D ++  + E +P    V +V   D D   NG+V C LL     +  L ++H    E  Y ++T    DRE    +++ +  +D G P   + + F V V D N+  PSF  S Y IF +E+    + L  ++A D D      ++Y +        S++    +D + G L  +  FDRE + +    V   D      L+   +V + V D NDN PV+     +     V +      G L+  ++  D D   N  V C     HV+  + +        F +D   C ++  +S+    +D+  + +++ D G
Sbjct:   29 GSTVRYRVPEELPVGSVIGRLADDAAEDLARLPGSVSPRFRAVTRRGAPASSALSVRERDGEISVRARLDRETLCSGGLMEANCTLEFDVLTLPTEHLQLFHVVLLDVNDHAPRFARPMVPVEISESAAVGTRVPLDSATDLDTGENGLHSYSLASSKTFGIDVLTRPNGAKYAELVVLAPLDREERSS--YELELTATDGGDPPRTGTTMLRITVADSNDNSPTFEKSSYVVTLAEDAPLGMLIVDLNATDPDEGTNGKIVYSFGAHVSPKVLETFRIDPDDGRLTLLRKVDFEMTDSYDIDVQAQD---MGPNSMPAHCKVTVKVRDVNDNKPDVTVSLMTPSDEDAAFVSETAPTDTFVALVRVDDADSGLNGEVVCRLLGQ--GHFRLQKTH----EKNYMILTNASLDREKRSEYSLTVIAEDRGTPSMSTVKHFTVQVQDENDNAPSFDKSRYEIFKAENNSPGAYLATLQASDPDLGANGQVSYSILESLVQGSSISTYVTVDPSTGALYALRTFDREELSQIYFLVQAKDS-GNPSLSSNVSVILNVLDENDNRPVILAPPLWNHSAEVPVSRRAEAGELVSAIRVTDRDTGANGDVSC-----HVIGGNEAGY------FSMDSRSCEIYTNTSMREVPVDRVDMTVLVQDHG 667          

HSP 2 Score: 129.028 bits (323), Expect = 1.021e-29
Identity = 131/555 (23.60%), Postives = 240/555 (43.24%), Query Frame = 2
Query:  908 IKESTPIGSVI--FIFNASDADSGLFGKIN--FKLLPARTTKNKVYFNLNFNTGELVLITSLNAK-IVSKFILDVEARDENGVGPFSSQ-CQL-TIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYL-ALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDK------THSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGI------KQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTII 2506
            + E  P+GSVI     +A++  + L G ++  F+ +  R        ++    GE+ +   L+ + + S  +++     E  V    ++  QL  + + D N+HAP  +      + I E++  G  V +  A+D D  +NG  +  L  + +  +  L R +  K      LV     DRE    + + ++  D G+PP     +  ++V D N+  P+F  S+Y + ++ED  +   ++ + A D D+       +S   H+ P V + F+ID + G L  +   D E+   Y + V   D    ++              ++   V   +          + E     T+  L+   +  D D+  N  VVC LL       H    +    ++ I          +SLDRE+  +Y L +I  D G P  S ++  TV V+DENDN+P +    +++ Y++      +    +  +QA+D D   N  +SY+ + + V       Y T+    G ++  R  D +E    Y  +QA D+G+P   S+V++I
Sbjct:   36 VPEELPVGSVIGRLADDAAEDLARLPGSVSPRFRAVTRRGAPASSALSVRERDGEISVRARLDRETLCSGGLMEANCTLEFDVLTLPTEHLQLFHVVLLDVNDHAPRFAR-PMVPVEISESAAVGTRVPLDSATDLDTGENGLHSYSLASSKTFGIDVLTRPNGAK---YAELVVLAPLDREERSSYELELTATDGGDPPRTGTTMLRITVADSNDNSPTFEKSSYVVTLAEDAPLGMLIVDLNATDPDEGTNGKIVYSFGAHVSPKVLETFRIDPDDGRLTLLRKVDFEMTDSYDIDVQAQDMGPNSMPAHCKVTVKVRDVNDNKPDVTVSLMTPSDEDAAFVSETAPTDTFVALV---RVDDADSGLNGEVVCRLLG----QGHFRLQKTHEKNYMI-------LTNASLDREKRSEYSLTVIAEDRGTPSMSTVKHFTVQVQDENDNAPSF----DKSRYEIFKAENNSPGAYLATLQASDPDLGANGQVSYSILESLVQGSSISTYVTVDPSTGALYALRTFDREELSQIYFLVQAKDSGNPSLSSNVSVI 568          

HSP 3 Score: 98.9821 bits (245), Expect = 2.197e-20
Identity = 100/394 (25.38%), Postives = 179/394 (45.43%), Query Frame = 2
Query:  398 GHLLVNKRIDREFLCPNVDKID-DCQLELM-IHAFPDHWIKVFIIIEDINDNKPKF------PTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLT------LVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKV--YFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSL----GDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTC-VLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSV 1516
            G L + +++D E      D  D D Q + M  ++ P H  KV + + D+NDNKP        P+ E    VSE+      + L    D D    G         E    LL +  F L        ++L     +      ++LT+IA D GTP     +   ++V D NDN P FD+++   F  E+   G+ +    ASD D G  G++++ +L +    + +  Y  ++ +TG L  + + + + +S+    V+A+D +G    SS   + + V DEN++ P++           + +   + AGE V  +  +D D   NG V+C V+  N++ Y ++D     +   IY   + R    + +D  T+++  QD+G+ P  +  L  +++
Sbjct:  310 GRLTLLRKVDFEM----TDSYDIDVQAQDMGPNSMPAH-CKVTVKVRDVNDNKPDVTVSLMTPSDEDAAFVSETAPTDTFVALVRVDDADSGLNG---------EVVCRLLGQGHFRLQKTHEKNYMILTNASLDREKRSEYSLTVIAEDRGTPSMSTVKHFTVQVQDENDNAPSFDKSRYEIFKAENNSPGAYLATLQASDPDLGANGQVSYSILESLVQGSSISTYVTVDPSTGALYALRTFDREELSQIYFLVQAKD-SGNPSLSSNVSVILNVLDENDNRPVILAPPLWNHSAEVPVSRRAEAGELVSAIRVTDRDTGANGDVSCHVIGGNEAGYFSMDS----RSCEIYTNTSMREVPVDRVD-MTVLV--QDHGSEPLGTKALLRLTL 681          
BLAST of Protocadherin-1 vs. Ensembl Cavefish
Match: pcdh18a (protocadherin 18a [Source:ZFIN;Acc:ZDB-GENE-000607-1])

HSP 1 Score: 231.876 bits (590), Expect = 7.449e-62
Identity = 185/664 (27.86%), Postives = 318/664 (47.89%), Query Frame = 2
Query:  230 ANVVKYRLKEESDINTLIGNIFEDSRSEYMRKPKE-NFTYKIYT---TDIDSNLTKLDFKGHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFPDHWIKVF-IIIE--DINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPF-FSLLYRPMFS--LTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFS--SQCQLTIRVQDENNHAP-----ILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKD--KTHSLNYHL------DPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQI---LTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLG 2137
             + V+YR+ EE  + ++IG + +D+  +  R P   +  ++  T       S L+  +  G + V  R+DRE LC       +C LE  +   P   +++F +++E  D+ND+ P+F      +++SES AVG ++PL +A D D    G+ SY+L  S+ F   +L RP  +    LVVL  LD E  S   + L L A DGG P +     L+I V DSNDN+P F+++     + E  P+G +I   NA+D D G  GKI +      + K    F ++ + G L L+  ++ ++   + +DV+A+D   +GP S  + C++T++V+D N++ P     +++  D ++  + E +P    V +V   D D   NG+V C LL     +  L ++H    E  Y ++T    DRE    +++ +  +D G P   + + F V V D N+  PSF  S Y IF +E+    + L  ++A D D      ++Y +        S++    +D + G L  +  FDRE + +    V   D      L+   +V + V D NDN PV+     +     V +      G L+  ++  D D   N  V C     HV+  + +        F +D   C ++  +S+    +D+  + +++ D G
Sbjct:   29 GSTVRYRVPEELPVGSVIGRLADDAAEDLARLPGSVSPRFRAVTRRGAPASSALSVRERDGEISVRARLDRETLCSGGLMEANCTLEFDVLTLPTEHLQLFHVVVELLDVNDHAPRFARPMVPVEISESAAVGTRVPLDSATDLDTGENGLHSYSLASSKTFGIDVLTRPNGAKYAELVVLAPLDREERSS--YELELTATDGGDPPRTGTTMLRITVADSNDNSPTFEKSSYVVTLAEDAPLGMLIVDLNATDPDEGTNGKIVYSFGAHVSPKVLETFRIDPDDGRLTLLRKVDFEMTDSYDIDVQAQD---MGPNSMPAHCKVTVKVRDVNDNKPDVTVSLMTPSDEDAAFVSETAPTDTFVALVRVDDADSGLNGEVVCRLLGQ--GHFRLQKTH----EKNYMILTNASLDREKRSEYSLTVIAEDRGTPSMSTVKHFTVQVQDENDNAPSFDKSRYEIFKAENNSPGAYLATLQASDPDLGANGQVSYSILESLVQGSSISTYVTVDPSTGALYALRTFDREELSQIYFLVQAKDS-GNPSLSSNVSVILNVLDENDNRPVILAPPLWNHSAEVPVSRRAEAGELVSAIRVTDRDTGANGDVSC-----HVIGGNEAGY------FSMDSRSCEIYTNTSMREVPVDRVDMTVLVQDHG 669          

HSP 2 Score: 129.413 bits (324), Expect = 7.372e-30
Identity = 129/557 (23.16%), Postives = 239/557 (42.91%), Query Frame = 2
Query:  908 IKESTPIGSVI--FIFNASDADSGLFGKIN--FKLLPARTTKNKVYFNLNFNTGELVLITSLNAK-IVSKFILDVEARDENGVGPFSSQ----CQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYL-ALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDK------THSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGI------KQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTII 2506
            + E  P+GSVI     +A++  + L G ++  F+ +  R        ++    GE+ +   L+ + + S  +++     E  V    ++      + + + D N+HAP  +      + I E++  G  V +  A+D D  +NG  +  L  + +  +  L R +  K      LV     DRE    + + ++  D G+PP     +  ++V D N+  P+F  S+Y + ++ED  +   ++ + A D D+       +S   H+ P V + F+ID + G L  +   D E+   Y + V   D    ++              ++   V   +          + E     T+  L+   +  D D+  N  VVC LL       H    +    ++ I          +SLDRE+  +Y L +I  D G P  S ++  TV V+DENDN+P +    +++ Y++      +    +  +QA+D D   N  +SY+ + + V       Y T+    G ++  R  D +E    Y  +QA D+G+P   S+V++I
Sbjct:   36 VPEELPVGSVIGRLADDAAEDLARLPGSVSPRFRAVTRRGAPASSALSVRERDGEISVRARLDRETLCSGGLMEANCTLEFDVLTLPTEHLQLFHVVVELLDVNDHAPRFAR-PMVPVEISESAAVGTRVPLDSATDLDTGENGLHSYSLASSKTFGIDVLTRPNGAK---YAELVVLAPLDREERSSYELELTATDGGDPPRTGTTMLRITVADSNDNSPTFEKSSYVVTLAEDAPLGMLIVDLNATDPDEGTNGKIVYSFGAHVSPKVLETFRIDPDDGRLTLLRKVDFEMTDSYDIDVQAQDMGPNSMPAHCKVTVKVRDVNDNKPDVTVSLMTPSDEDAAFVSETAPTDTFVALV---RVDDADSGLNGEVVCRLLG----QGHFRLQKTHEKNYMI-------LTNASLDREKRSEYSLTVIAEDRGTPSMSTVKHFTVQVQDENDNAPSF----DKSRYEIFKAENNSPGAYLATLQASDPDLGANGQVSYSILESLVQGSSISTYVTVDPSTGALYALRTFDREELSQIYFLVQAKDSGNPSLSSNVSVI 570          

HSP 3 Score: 98.2117 bits (243), Expect = 3.123e-20
Identity = 100/394 (25.38%), Postives = 179/394 (45.43%), Query Frame = 2
Query:  398 GHLLVNKRIDREFLCPNVDKID-DCQLELM-IHAFPDHWIKVFIIIEDINDNKPKF------PTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLT------LVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKV--YFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSL----GDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTC-VLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSV 1516
            G L + +++D E      D  D D Q + M  ++ P H  KV + + D+NDNKP        P+ E    VSE+      + L    D D    G         E    LL +  F L        ++L     +      ++LT+IA D GTP     +   ++V D NDN P FD+++   F  E+   G+ +    ASD D G  G++++ +L +    + +  Y  ++ +TG L  + + + + +S+    V+A+D +G    SS   + + V DEN++ P++           + +   + AGE V  +  +D D   NG V+C V+  N++ Y ++D     +   IY   + R    + +D  T+++  QD+G+ P  +  L  +++
Sbjct:  312 GRLTLLRKVDFEM----TDSYDIDVQAQDMGPNSMPAHC-KVTVKVRDVNDNKPDVTVSLMTPSDEDAAFVSETAPTDTFVALVRVDDADSGLNG---------EVVCRLLGQGHFRLQKTHEKNYMILTNASLDREKRSEYSLTVIAEDRGTPSMSTVKHFTVQVQDENDNAPSFDKSRYEIFKAENNSPGAYLATLQASDPDLGANGQVSYSILESLVQGSSISTYVTVDPSTGALYALRTFDREELSQIYFLVQAKD-SGNPSLSSNVSVILNVLDENDNRPVILAPPLWNHSAEVPVSRRAEAGELVSAIRVTDRDTGANGDVSCHVIGGNEAGYFSMDS----RSCEIYTNTSMREVPVDRVD-MTVLV--QDHGSEPLGTKALLRLTL 683          
BLAST of Protocadherin-1 vs. Ensembl Cavefish
Match: ENSAMXT00000044488.1 (pep primary_assembly:Astyanax_mexicanus-2.0:8:9178681:9223080:1 gene:ENSAMXG00000016031.2 transcript:ENSAMXT00000044488.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 229.18 bits (583), Expect = 1.610e-61
Identity = 193/676 (28.55%), Postives = 330/676 (48.82%), Query Frame = 2
Query:  239 VKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLDFKGHLLVNKRIDREFLCPNVDKIDDCQLEL-MIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFS----LTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEI----IYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKD--KTHSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIK-QFVIREN----VQIL----TYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRL-LNHSFEIDKYKCNL------FVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVED 2185
            V+Y ++EE    + +G+I +D   E+ R        +++T      +     KGH++V +R+DRE LC +   I  C +   +I   P    +V + I D+NDN P FP  E ++++SES + G +  +++A+D D+   G+QSY++  ++  FSL  +        + LV+   LD E   H Y  LT+ A DGGTP +    K+ + V D ND+ PIF++      + E+T  G+++   NA+DAD+     I +      T K +  F+++ +TGE+ L+  L+ +  S     ++A+D+ G    S   ++ I V D N++AP ++L    S T+ ENSP G  V M+   D D E+NGKVTC++          DRS   + E      Y +VT    DRE +  + I I+ +D G PP  + +   V + DIN+  P F H +Y+ +I+E+   + +L+ +KA D D      ++Y L+    DK   D+N  +   +V  D      Y +  F  +QV+       +           + P+ T     F+I++      Q+L    T G+L+ E+  +  +  Y   +V  +++V V S   +W+   L  + +   ++  L       V+   D++ + K KL +++ D G P RS    I V V D
Sbjct:   28 VRYSVQEEMPPGSFVGDILKDLGLEFKRL--TTGKARVFTASGREYVGLDRDKGHIVVKERMDREVLCSSA--ISTCSISFEIIFENPIELYRVTVEILDVNDNSPAFPKGEIQLEISESASAGARFSVESAVDPDVGLNGIQSYSIHPTD-HFSLKTQSRAGSGKKVELVLQTPLDREKEEHVY--LTITASDGGTPKRSGTVKIHVIVLDINDSPPIFEKDDYRLSVPENTAKGALLLTVNATDADTASNAHIGY-YFEHTTPKIRELFSIDASTGEVRLVGELDFEEGSVHEFKIQAKDQGG---LSDSSEVVIEVTDVNDNAPKITLMSF-SNTLPENSPPGTVVAMINVQDSDSEENGKVTCLI----------DRSLPFRTESSLNNYYSIVTDSSLDREQMAEYNITITAKDGGQPPLFNTKTLLVKISDINDHLPQFEHESYNAYITENNSPSLSLLSVKANDADLGANARISYFLE----DK---DLNGALASTLVSIDSVSGMLYALKSFDYEQVK-------SFSITVKAQDGGSPPLSTNTTVNFIIQDQNDNAPQVLYPVQTGGSLVAEMVPRSAEVGY---LVTKVVAVDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTVRQVTDKDAV-KQKLTVVVEDNGQPSRSATVNINVAVAD 663          

HSP 2 Score: 108.227 bits (269), Expect = 2.445e-23
Identity = 145/656 (22.10%), Postives = 270/656 (41.16%), Query Frame = 2
Query: 1013 TTKNKVYFNLNFNTGELVLITSLNAKI-----VSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNY-----HLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFM--SRDLQESGTYYLKIQATDNGSPPRFSDVT---IITVKISTAEKTNYLIKNSQISFTLIVVTSLASFSICVALMVGIIL-----MWRKSYPIQLNSD-------------RTTGNWDDPKTLQWEISPFVDVDHRPNESIVLNDSKFYNSMTSDLCNICVADP---LLTQFRDFPQNR 2872
            T   + Y  L+ + G +V+   ++ ++     +S   +  E   EN +  +    ++T+ + D N+++P    G+ + L I E++ AG    +  A D D+  NG  +  +   D  + +L             LV     DRE  ++  + I+  D G P        +V V DIN+ PP F   +Y + + E+    + L+ + A D D   + +      H  P + + F ID + G ++ +   D E    +   +   DQ   +  +        V D      +M+      + EN      G ++  +  QD D+  N  V C +          S    LN+ + I          SSLDREQ+ +Y + I   D G P   N + + V + D ND+ P + ++    +Y   +T   + +  ++ V+A D D   N+ ISY   + D+N        +I + +G ++   S D ++  ++ + ++A D GSPP  ++ T   II  +   A +  Y ++    S    +V   A     V  +V + +      W  SY +Q  +D             RT     D   ++ +++  V+ + +P+ S  +N             N+ VAD    +L++F DF  ++
Sbjct:   65 TASGREYVGLDRDKGHIVVKERMDREVLCSSAISTCSISFEIIFENPIELY----RVTVEILDVNDNSPAFPKGEIQ-LEISESASAGARFSVESAVDPDVGLNGIQSYSIHPTD--HFSLKTQSRAGSGKKVELVLQTPLDREKEEHVYLTITASDGGTPKRSGTVKIHVIVLDINDSPPIFEKDDYRLSVPENTAKGALLLTVNATDADTASNAHIGYYFEHTTPKIRELFSIDASTGEVRLVGELDFEEGSVHEFKIQAKDQGGLSDSSEVVIEVTDVNDNAPKITLMSFSN--TLPENSPP---GTVVAMINVQDSDSEENGKVTCLIDRSLPFRTESS----LNNYYSI-------VTDSSLDREQMAEYNITITAKDGGQPPLFNTKTLLVKISDINDHLPQFEHE----SYNAYITENNSPSLSLLSVKANDADLGANARISYFLEDKDLNGALASTLVSIDSVSGMLYALKSFDYEQVKSFSITVKAQDGGSPPLSTNTTVNFIIQDQNDNAPQVLYPVQTGG-SLVAEMVPRSAEVGYLVTKVVAVDVDSGQNAWL-SYKLQKATDRALFEVGLQNGEIRTVRQVTDKDAVKQKLTVVVEDNGQPSRSATVN------------INVAVADSFPEVLSEFTDFTHDK 679          

HSP 3 Score: 70.0922 bits (170), Expect = 1.294e-11
Identity = 85/353 (24.08%), Postives = 154/353 (43.63%), Query Frame = 2
Query:  512 KVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSL----TLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPA--RTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHA-----PILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFP 1537
            +V I + D+NDN PK         + E+   G  + +    D D E  G  +  ++ S PF     R   SL    ++V    LD E ++   +N+T+ A DGG P   + + L ++++D ND+ P F+      +I E+      +    A+DAD G   +I++ L              +++  +G L  + S + + V  F + V+A+D  G  P S+   +   +QD+N++A     P+ + G   +  +  ++  G  V  V+A D D   N  ++  L K     L      N +   + ++       ++L    T+++  +D G P   +    NV+V D   FP
Sbjct:  330 EVVIEVTDVNDNAPKITLMSFSNTLPENSPPGTVVAMINVQDSDSEENGKVTCLIDRSLPF-----RTESSLNNYYSIVTDSSLDREQMAE--YNITITAKDGGQPPLFNTKTLLVKISDINDHLPQFEHESYNAYITENNSPSLSLLSVKANDADLGANARISYFLEDKDLNGALASTLVSIDSVSGMLYALKSFDYEQVKSFSITVKAQD-GGSPPLSTNTTVNFIIQDQNDNAPQVLYPVQTGGSLVAEMVPRSAEVGYLVTKVVAVDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTVRQVTDKDAVKQKL----TVVV--EDNGQPSRSATVNINVAVAD--SFP 666          
BLAST of Protocadherin-1 vs. Ensembl Cavefish
Match: pcdh1g9 (protocadherin 1 gamma 9 [Source:ZFIN;Acc:ZDB-GENE-050609-5])

HSP 1 Score: 214.542 bits (545), Expect = 6.988e-57
Identity = 190/672 (28.27%), Postives = 308/672 (45.83%), Query Frame = 2
Query:  239 VKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLDFKGHLLVNKRIDREFLCPNVDKIDDCQLEL-MIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFS---LTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKD--KTHSLNYHLDP------SVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQ----VRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWI--RLLNHS----FEIDKYKCNL-FVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVED 2185
             +Y + EE    + IGN+ +D   +  R        ++ T      +     KG+L+V +RIDRE LC    +   C     +I   P    +V + ++DINDN PKFPT    +K+ E+   G + PL +A+D D+   G+Q+Y L  + PF   ++        + +V+ + LD E        L L A DGG+P +     + I V D NDN PI +QT     +KE+  IG+ +   NA DAD G+ G++++ +  A     K  F +N  TGE+ L+ +L+ +  S ++L + A D   +G  S  C++ I V DEN+++P + L    S TI E+SP G  V ++   D D   NG V C +  N    + L  S        + L+T  + DRE +  + I I   D G P   S +   V + D+N+ PP F    Y  FI+E+     A++ +KA D D      ++Y LD       SV+    I+ + G++  I  FD E +  +   V   D     +   ++                 PV TG               G+L+ E+  +  D  Y   +V  +++V V S   +W+  +L   +    FE+      +  V+   D++ + K KL +++ D G+P RS +  I V V D
Sbjct:   41 AQYSIPEEMPEGSFIGNVAKDLGIDINRLISGK--ARVVTKGGRQYVALNRDKGNLVVKERIDREELC---KQTTPCSFSFDLIIENPIQLHRVIVEVQDINDNAPKFPTVSVNLKIIENTPSGTRFPLDSAVDMDVGANGIQNYALNPANPFKLEIHNHADGNKRVEIVLQQDLDRE--ERHELKLILAALDGGSPKKSGTVHINISVLDVNDNAPICNQTLYKVQVKENALIGTHLTTVNAVDADGGVNGQVSYSIGQANEAARK-GFEVNSGTGEITLLQTLDFEKESSYLLYITAMD---IGSLSDTCKVMIDVVDENDNSPTIQLMSF-SHTIAEDSPLGNTVAVINVEDADFGKNGDVQCKINDNIPFKIELTVSD------YFALITDDLLDRENIAEYNITILVSDQGIPALHSNKTLTVKISDVNDNPPVFMAEKYKTFINENNSPGVAVLTVKASDADWGPNARMSYFLDDSDVMGNSVSSFISINSDNGVIHAIRSFDYEQMKSFTFNVTARDGGSPPLSSQVVVNIMVQDQNDNAPQVLYPVQTG---------------GSLVTEIVPRSADVGY---LVTKVVAVDVDSGQNAWLSYKLQKATDRALFEVGPQNGEIRTVRQVTDKDAV-KQKLIVVVEDNGLPSRSAVVNINVAVAD 675          

HSP 2 Score: 108.612 bits (270), Expect = 1.783e-23
Identity = 163/666 (24.47%), Postives = 290/666 (43.54%), Query Frame = 2
Query:  731 LVVLKKLDFENISHRY----FNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTG-ELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDKFQIDINKGILKNIVH---FDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIREN----VQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSP--IWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESGTYYLK--IQATDNGSPPRFSDVTIITVKIS------TAEKTNYLIKNSQISFTLIVVTSLASFSI--CVALMVGI-ILMWRKS 2653
            LVV +++D E +  +     F+  LI  +   P+Q    ++ +EV D NDN P F        I E+TP G+   + +A D D G  G  N+ L PA   K +++ + + N   E+VL   L+ +   +  L + A D  G    S    + I V D N++API +      + + EN+  G H+  V A D D   NG+V+  + + +         ++   EI   L+ T  F++E    + + I+  D G+       + +V   D N+  P+    ++S  I+ED  + + +  I   D D   + +     + N  F+I++       ++     DRE I +Y + + V+DQ    + +  T         ++    M    +  I EN    V +LT       ++  D D   NA +   L    V+ N +S    +N    +      +    S D EQ+  +  N+   D G P  S+  ++ +MV+D+NDN+P  ++  Q   +     V    ++ + +  V A D+D+ +N+ +SY        +L     F +  +NG I   R + +      K  +   DNG P R S V  I V ++       +E T++   N  ++F L++  +  SF    CV +++ + I  WR+S
Sbjct:   94 LVVKERIDREELCKQTTPCSFSFDLIIEN---PIQL--HRVIVEVQDINDNAPKFPTVSVNLKIIENTPSGTRFPLDSAVDMDVGANGIQNYALNPANPFKLEIHNHADGNKRVEIVLQQDLDREERHELKLILAALD-GGSPKKSGTVHINISVLDVNDNAPICNQ-TLYKVQVKENALIGTHLTTVNAVDADGGVNGQVSYSIGQANEAARKGFEVNSGTGEIT--LLQTLDFEKE--SSYLLYITAMDIGSLSDTCKVMIDVV--DENDNSPTIQLMSFSHTIAEDSPLGNTVAVINVEDADFGKNGDVQCKINDNIPFKIELTVSDYFALITDDLLDRENIAEYNITILVSDQGIPALHSNKTLTVKISDVNDNPPVFMAEKYKTFINENNSPGVAVLT-------VKASDADWGPNARMSYFLDDSDVMGNSVSSFISINSDNGV------IHAIRSFDYEQMKSFTFNVTARDGGSPPLSSQVVVNIMVQDQNDNAPQVLYPVQTGGSLVTEIVPRSADVGYLVTKVVAVDVDSGQNAWLSYKLQKATDRAL-----FEVGPQNGEIRTVRQVTDKDAVKQKLIVVVEDNGLPSR-SAVVNINVAVADSFPEVLSEFTDFTHGNDNLTFYLVLALAAVSFLFITCVVVIISVKIYRWRQS 727          

HSP 3 Score: 97.8265 bits (242), Expect = 3.336e-20
Identity = 96/362 (26.52%), Postives = 160/362 (44.20%), Query Frame = 2
Query:  512 KVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPF-FSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKV--YFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHA-----PILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGD-----INEFPPSFYHSN 1558
            KV I + D NDN P          ++E   +GN + +    D D    G     + D+ PF   L     F+L  +    LD ENI+   +N+T++  D G P     + L ++++D NDN P+F   +   FI E+   G  +    ASDAD G   ++++ L  +    N V  + ++N + G +  I S + + +  F  +V ARD  G  P SSQ  + I VQD+N++A     P+ + G   +  +  ++  G  V  V+A D D   N  ++  L K     L      N +   + ++       ++L+      +  +D G P   +    NV+V D     ++EF   F H N
Sbjct:  342 KVMIDVVDENDNSPTIQLMSFSHTIAEDSPLGNTVAVINVEDADFGKNGDVQCKINDNIPFKIELTVSDYFAL--ITDDLLDRENIAE--YNITILVSDQGIPALHSNKTLTVKISDVNDNPPVFMAEKYKTFINENNSPGVAVLTVKASDADWGPNARMSYFLDDSDVMGNSVSSFISINSDNGVIHAIRSFDYEQMKSFTFNVTARD-GGSPPLSSQVVVNIMVQDQNDNAPQVLYPVQTGGSLVTEIVPRSADVGYLVTKVVAVDVDSGQNAWLSYKLQKATDRALFEVGPQNGEIRTVRQVTDKDAVKQKLI------VVVEDNGLPSRSAVVNINVAVADSFPEVLSEF-TDFTHGN 691          
BLAST of Protocadherin-1 vs. Ensembl Cavefish
Match: pcdh1gc5 (protocadherin 1 gamma c 5 [Source:ZFIN;Acc:ZDB-GENE-041118-16])

HSP 1 Score: 213.386 bits (542), Expect = 7.114e-57
Identity = 199/702 (28.35%), Postives = 332/702 (47.29%), Query Frame = 2
Query:  218 YNFEANVVKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFTYKIYTT----DIDSNLTKLDFKGHLLVNKRIDREFLCPNVDKIDDCQLEL-MIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPF---FSLLYRPMFSLTLVVLKKLDFEN-ISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKF-IKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHS--LNYH-LDPSVND-----KFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTG---IKQFVIREN---VQILTYGNLIGELQTQDLDNSYN-ATVVCDLLSVHVLSNHMSWI--RLLNHS----FEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQT 2230
            +N     + Y + EE    +++GNI +D   +  R  K        ++    D+D+       KG L+VN RIDRE LC    +  +C + L +I   P    +V I I+DINDN P F TKE  +K++ES A+G++ P+++A D D     ++SY+L  +E F      L        L++ K LD E  + H+   L L A DGG PV+     L+I V D+NDN P F + Q YK  ++ES  IGS +    A+D D G+ G+I +          +  FN+N ++GE+ +I  L+ + ++ +  D+ A+D+ G         + IRV DEN++ P + L    +  + EN+  G  V ++   D D  +NGKV+  + K     L     ++      Y L+T    DREL   + I I   D G+PP ++ +  NV++ D+N+  P+F  ++Y+++I E+    S+L  I ALD D  ++  L Y  +D  VND      F I+   G + ++  FD E + +  + V   D                       +P ++    +  F++ +N     ++    ++G +  Q +  S     +V  + +V   S H +WI  RL   +    F ++ +   +  K SL  ++    +L I I D G P +S    + V++ED   + PI  Y    T
Sbjct:   23 WNTVGAQIHYTIAEEVKEGSIVGNIAKDLGFDVSRVAKSKLRIASESSRQYFDVDTE------KGELIVNGRIDRETLC---GQAVNCLVPLQIIIEEPLQLHRVEIEIQDINDNAPNFHTKESVLKIAESAALGSRFPIESAEDPDSGKNSLKSYSLNSNEHFRLNVKALDGGRKVPELILDKPLDREKQLIHK---LILTALDGGDPVRSGSTLLKIVVEDNNDNEPHF-ELQIYKASVQESAGIGSNVVTIKATDMDEGINGEIQYYFAAHTPDYVRKVFNVNPDSGEITVIGKLDHEGINSYTFDICAQDK-GYPKLEGHSSVHIRVIDENDNPPEIILTSLPN-PVPENATVGTVVALINVMDLDSGENGKVSLKIPKGFPFKLKSSFENH------YSLITDSSLDRELNSEYNIEIVATDSGSPPLKTVKTINVTILDVNDNAPAFSQTSYNVYIKENNVAGSSLFSITALDSDVNNNAILTYSVVDSKVNDIPASSYFYINSENGTIYSMSSFDYEKVKRLTLIVQAKDH---------------------GSPSLSSNATLHVFILDQNDNAPSVIYPSAVMGSVSHQRMPRSAKPGHLVTKVTAVDADSGHNAWISYRLAEATDASLFSVNLHTGEVRTKRSLSEQEDSSQRLLIEIQDNGEPVQSTTVTVDVLIED-GFHEPISDYPKKST 681          

HSP 2 Score: 100.908 bits (250), Expect = 3.615e-21
Identity = 116/459 (25.27%), Postives = 197/459 (42.92%), Query Frame = 2
Query: 1163 QLTIRVQDENNHAPILSLGDRES-LTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDS---NYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKT------HSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIF--MSRDLQESGTYYLKIQATDNGSPPRFSDVTI 2503
            ++ I +QD N++AP  +   +ES L I E++  G    +  A D D   N   +  L  N+    N  ALD    + +     L+  +  DRE      ++++  D G+P      L  + V D N+  P F    Y   + E   I S ++ IKA D D+       +    H    V   F ++ + G +  I   D E I  Y   +   D+    +   ++     + + ++   ++       + EN    T G ++  +   DLD+  N  V   +           +   L  SFE + Y  +L   SSLDRE   +Y + I+ +D G P    ++ I V + D NDN+P +    +QT+Y V +         +  + A D D   N+ ++Y+ V++ VN +    YF I + NG I+   S D ++     L +QA D+GSP   S+ T+
Sbjct:  117 RVEIEIQDINDNAP--NFHTKESVLKIAESAALGSRFPIESAEDPDSGKNSLKSYSLNSNEHFRLNVKALDGGRKVPE-----LILDKPLDREKQLIHKLILTALDGGDPVRSGSTLLKIVVEDNNDNEPHFELQIYKASVQESAGIGSNVVTIKATDMDEGINGEIQYYFAAHTPDYVRKVFNVNPDSGEITVIGKLDHEGINSYTFDICAQDKGYPKLEGHSSVHIRVIDENDNPPEIILTSLPNPVPENA---TVGTVVALINVMDLDSGENGKVSLKI--------PKGFPFKLKSSFE-NHY--SLITDSSLDRELNSEYNIEIVATDSGSPPLKTVKTINVTILDVNDNAPAF----SQTSYNVYIKENNVAGSSLFSITALDSDVNNNAILTYSVVDSKVNDIPASSYFYINSENGTIYSMSSFDYEKVKRLTLIVQAKDHGSPSLSSNATL 550          

HSP 3 Score: 89.3521 bits (220), Expect = 1.406e-17
Identity = 160/675 (23.70%), Postives = 279/675 (41.33%), Query Frame = 2
Query:  731 LVVLKKLDFENISHRYFN-LTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNT-------GELVLITSLN--AKIVSKFILDVEARDENGVGPF-SSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDKFQIDINKGI---LKNIVH----------FDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQN---NQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDL--QESGTYYLKIQATDNGSPPRFSDVTIITV-------KISTAEKTNYLIKNSQISFTLIVVTSLASFSICVALMVGIILMWR 2647
            L+V  ++D E +  +  N L  +      P+Q    +++IE+ D NDN P F   ++   I ES  +GS   I +A D DSG         L + +  +  +F LN           EL+L   L+   +++ K IL       +G  P  S    L I V+D N++ P   L   ++ ++ E++  G +V  + A+D D   NG++      +  +Y+   +  N+  +     V  +  D E ++ +T  I  QD G P        ++ V D N+ PP    ++    + E+  + + +  I  +D          LD   N K  + I KG    LK+              DRE+  +Y + +  TD     + T  T     +   ++            I+EN      G+ +  +   D D + NA     +L+  V+ + ++ I   ++ F I+     ++  SS D E++ +  L +   D G P  S+   + V + D+NDN+P   Y +      ++Q  +       H +  V A D D+  N+ ISY        SL     F++    G +   R L  QE  +  L I+  DNG P + + VT+  +        IS   K +          TL ++ SLAS S+ + LM   +L+ +
Sbjct:   83 LIVNGRIDRETLCGQAVNCLVPLQIIIEEPLQL--HRVEIEIQDINDNAPNFHTKESVLKIAESAALGSRFPIESAEDPDSGK------NSLKSYSLNSNEHFRLNVKALDGGRKVPELILDKPLDREKQLIHKLILTAL----DGGDPVRSGSTLLKIVVEDNNDNEPHFELQIYKA-SVQESAGIGSNVVTIKATDMDEGINGEIQYYFAAHTPDYVR--KVFNVNPDSGEITVIGK-LDHEGINSYTFDICAQDKGYPKLEGHSSVHIRVIDENDNPPEIILTSLPNPVPENATVGTVVALINVMD----------LDSGENGKVSLKIPKGFPFKLKSSFENHYSLITDSSLDRELNSEYNIEIVATDSGSPPLKTVKTINVTILDVNDNAPAFSQTSYNVYIKENN---VAGSSLFSITALDSDVNNNA-----ILTYSVVDSKVNDIPASSY-FYINSENGTIYSMSSFDYEKVKRLTLIVQAKDHGSPSLSSNATLHVFILDQNDNAPSVIYPSAVMGSVSHQ-RMPRSAKPGHLVTKVTAVDADSGHNAWISYRLAEATDASL-----FSVNLHTGEVRTKRSLSEQEDSSQRLLIEIQDNGEPVQSTTVTVDVLIEDGFHEPISDYPKKSTDPNKKSGKITLYLIISLASVSL-LCLMTFFMLLAK 715          
BLAST of Protocadherin-1 vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 193.741 bits (491), Expect = 1.023e-50
Identity = 215/806 (26.67%), Postives = 343/806 (42.56%), Query Frame = 2
Query:  239 VKYRLKEESDINTLIGNIFEDSR-SEYMRKPKENFTYKIYTT---DIDSNLTKLDFK-GHLLV-NKRIDREFLCPNVDKIDDCQLELMIHAFPDH------WIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLT--------LVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKL-----LPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGP--FSSQCQLTIRVQDENNHAPILSLGD-----RESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDK--DKTHSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQES--GTYYLKIQATDNGSPPRFSDVTIITVKIS-TAEKTNYL 2545
            V YR+ EE      IGN   D R ++Y  +     TYK+  +   D    L +++ + G L    +++DRE LC   D  D+C +++ +   P         I+V I +EDINDN P F      + V E+   G + P+Q A D D E  GV+ Y L  S+P     +    + T        LVV K LD E    + + + L A DGG+P       L+I VTD+NDN+P+FDQ +    I E++P+G+ +   +ASD D+G   ++ ++L             K  F L+ N+G + +   LN +    + + + A D+   GP    +   +T+ V D N+++P + + D        + I E S     V ++  SD D+  NG VTC +   +  +     ++  +    Y L T    D E  + + + I   D G           + + D N+  P F    Y + + E+  I   LI + A D+  DK   + Y L P     F +D   GI+      DRE    Y   +   DQ    +    T +   +   ++          F + ENV      + +G +   D D   N  V   +L            R L   F ID     +      DREQ   Y L +  +D G P RS+   + + V D NDNSPI     + T Y+  V   T     +  V A D DA+ N+ + Y+ V  + ++L     F I    G I +   L E+  G + L ++ +D G   +   V ++ V ++ T E   Y+
Sbjct:   39 VSYRVAEELREGAFIGNPSVDLRLADYNLE----LTYKVMLSKAEDAAPPLVRVNPRTGELFAAGRKMDREALCGGQDPGDECHVDVQVGVLPVQPGPFFKLIEVRINVEDINDNAPAFAAPVLTVSVPENAPAGKRFPIQPANDPDSEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKSLDRE--ERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDK---GPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHVNLPVALITVSDPDIGANGAVTCYIYNPEVPFQLKKLTYPNQ----YLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGPDAPTMFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENV---PKHSTVGMVTVADSDEGENGRVRLSILGTDN--------RQL---FSIDPESGMIRSNVGFDREQRHYYVLEVQATDGGEPVRSSTVKVVIHVMDINDNSPIVLMPPSNTTYKF-VVPRTLPGTIVTEVSAVDNDAEINAELRYHIVGGNPHNL-----FHIDPVIGNITLMEPLTETHHGLHRLVVRVSDIGIAVQHHAVALVHVFVNETLENATYI 811          
BLAST of Protocadherin-1 vs. Ensembl Sea Lamprey
Match: si:ch211-199f5.1 (protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660])

HSP 1 Score: 182.185 bits (461), Expect = 3.145e-47
Identity = 143/491 (29.12%), Postives = 238/491 (48.47%), Query Frame = 2
Query:  230 ANVVKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLDFKGHLLVNKRIDREFLCPNVDKIDDCQLEL-MIHAFPD---HWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPF-FSLLYRPMFS--LTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFS--SQCQLTIRVQDENNHAPILSL-------GDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYR----LVTTRVFDRE-LLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTH 1639
            A  VKY L EE    TL+G + +D +      P  +F  ++   D  S +   +  G +   + IDRE  C    +   C +   ++   P      +   + + DIND+ P F   E  +++SES+A+G ++PL+ A D D+    +++Y+L+++E F  +L  R   +    LVV  +LD E      + L L A DGG P +     ++I V DSNDN+P+F QT     ++E    G+V+   NA+D D G  G++ +        + +  F L+  TG+L L   L+ ++ S++ + ++ARD   +GP S  + C++ + V+D N++AP + L       GD  ++ + E +     VG+V  SD D  +NG V C L           R H     + YR    +VT    DRE + DYF +++   D G PP  + + F V + D N+  P F+ S Y   + E+    + +  + A D D  H
Sbjct:   28 AITVKYALYEEQPAGTLVGRLSDDLQGRVAEHPSRHF--RLMRRDDFSLVHVEEADGTVSAREVIDREQQC---GQAPSCVIRFDVLCTLPRGLFQLVHAEVELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHLDENERFGLALRARTDGAKYAELVVKSRLDREQEGE--YTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARD---MGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGD--TVFVSEGAAYESFVGLVTVSDIDSAENGLVACHL-----------RGHPHFKLLPYRDDYVVVTNSSLDREQMADYF-LVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAEH 494          

HSP 2 Score: 115.546 bits (288), Expect = 2.245e-26
Identity = 122/467 (26.12%), Postives = 204/467 (43.68%), Query Frame = 2
Query: 1172 IRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLAL-DRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDK------THSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIK-QFVIRENVQIL------TYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFV--KSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTIITVKI 2518
            + + D N+HAP  +  +   + I E+   G  V +  A D D+  N      L +N+   LAL  R+   K      LV     DRE    +T+ ++  D G+PP     L  ++V D N+  P F  ++ ++ + ED    + L+ + A D D+       +S +  +D  V   FQ+D   G L      D E+  +Y + +    Q R    +        +  V D       IK  F+++     +       Y + +G +   D+D++ N  V C L             R   H F++  Y+ +  V   SSLDREQ+  Y L +  SD G P R      TV + DENDN P +    +++ Y+ ++    +    +  V A D DA+ N  I+YN V ++V       Y +I   +G I+  R  D +   +   ++QA D+G PP  ++ T ++V+I
Sbjct:  124 VELLDINDHAPDFARSEMH-VEISESVALGTRVPLEGARDLDVGGNALRAYHLDENERFGLALRARTDGAK---YAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISI----QARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHL-------------RGHPH-FKLLPYRDDYVVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRF----HRSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVPPLVTNAT-VSVRI 563          

HSP 3 Score: 100.523 bits (249), Expect = 1.187e-21
Identity = 102/400 (25.50%), Postives = 188/400 (47.00%), Query Frame = 2
Query:  365 IDSNLTKLDFKGHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFPDHWIKVFIIIEDINDNKPK------FPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLL-YRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKV--YFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVG----MVIASDGDLEDNGKVTCVLLK-NDSNYLALDRSHNMKDEIIYRLVTTRVFDREL-LDYFTIMISCQDYGNPPHRSFQLFNVSVG 1519
            +D    KL  KG L  +  ++ E+      +I     ++   + P H  KV + +EDINDN P+        ++   + VSE  A  + + L T  D D    G+ + +L    P F LL YR  +   +V    LD E ++  YF L L A DGGTP +   ++  + + D NDN P F ++     + E+   G+ +    A DAD+   G I + ++ +      V  Y ++N ++G +  +  L+ + ++     V+ARD +GV P  +   +++R+ DEN++AP+++     + T +   P    +G    +V A D D E NG+++  +++ N+ N   ++R   +  E+     +  V D        ++++  +D G+P   +     + VG
Sbjct:  298 LDPKTGKLSLKGQL--DHELNSEY------EISIQARDMGPSSIPAHC-KVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLR-GHPHFKLLPYRDDY--VVVTNSSLDREQMAD-YF-LVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARD-DGVPPLVTNATVSVRIVDENDNAPVVTHPPLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRIVQGNERNLFRINR---LGGEVFTNAAS--VTDAAASATRHSLVVMVRDRGSPALSATAAIEIRVG 677          

HSP 4 Score: 75.8702 bits (185), Expect = 4.736e-14
Identity = 138/643 (21.46%), Postives = 247/643 (38.41%), Query Frame = 2
Query:  842 QIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKL---------LPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPS------FYHSNYSIFISEDIEINS--ALIQIKALDKDKTHSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIR---EN-----VQILTY----------GNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQ--NNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR----DLQESGTYY-LKIQATDNGSPPRFSDVTIITVKISTAEKTNYLIKNSQ-ISFTLIVVTSLASFSICVALMVGIILM 2641
            ++E+ D ND+ P F +++ +  I ES  +G+ + +  A D D G      + L         L ART   K          ELV+ + L+ +   ++ L + A D  G  P S    + I V D N+++P+ +     ++T+ E++  G  +  + A+D D   NG+V   +    S   A  R     D    +L      D EL   + I I  +D G     +     V V DIN+  P             ++F+SE     S   L+ +  +D  +   +  HL    + K     +  ++      DRE +  Y + +  +D                       TP     +QF +R   EN         TY          G  +  +   D D  +N  +  +++   V    +S    +N S         ++    LD E +      +   D G+P       ++V + DENDN+P+  +    N T   V +  +  L + + +V+A D D++ N  +SY  V  +  +L     F I    G +F +     D   S T + L +   D GSP   S    I +++      +     +Q +  +++ V +L   + C   +  ++L+
Sbjct:  123 EVELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHLDENERFGLALRARTDGAKY--------AELVVKSRLDREQEGEYTLQLTAWD-GGDPPRSGTTLVRITVLDSNDNSPVFAQ-TSCNVTVREDATPGTVLLTLNATDVDEGPNGEV---VYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLRGHPHFKLLPYRDDYVVVTNSSLDREQMADYFLVLEASD---------------------GGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPS------SGAIYALRPLDYEAMTSLTFQVQARDDGVPPLVTNATVSVRIVDENDNAPVVTHPPLRNGTGV-VRLPRDAGLGYLVTVVRARDSDSEANGELSYRIVQGNERNL-----FRINRLGGEVFTNAASVTDAAASATRHSLVVMVRDRGSPA-LSATAAIEIRVGAHGDGDDGADETQPLDASMLAVMALG--AACALTLAAVVLV 716          
BLAST of Protocadherin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 176.022 bits (445), Expect = 1.298e-44
Identity = 176/679 (25.92%), Postives = 296/679 (43.59%), Query Frame = 2
Query:  533 DINDNKPK-----FPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYF-GVQSYNL-EDSEPFFSLLYRPMFS--LTLVVLKKLDFENISHRYFNLTLIACDGGTPV-QCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNY--SIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIF----------MSRDLQESGTYYLKIQATDNGSPPRFSDVTI 2503
            D+NDN P       P   +   V ES A G    L T  D D     G  S ++   +E    +L+ P       L V  +LD E I    +NLT++A D G PV +     L + V D ND+ P F  +     + E  P GS +    A DADSGL  K+ + ++   +  +  +F+++ +TG +     ++ ++ S  +L++ A+D+ G  P ++   LT+ + D N+  P+ +   +   T +ENS  G  V  V A+D DL +NG    V    D +  A  R     D +  ++ T +  DRE L+ + +++  QD G+PP  S     V VGD+N+  P FY   Y  SI  +E        +     D+    ++ Y L      +FQ++   G +   V  DRE    Y + V   D       +            +           FV+ ENV     G L+G +    LD + N T +       ++S           SF I+     +F  +++DRE+   Y+L ++ +  G+   ++   ++V+V D N+++P++    ++ +Y+V++  +  +N     V+ATD D+ KN  + Y     +      EK+        GIF          + R+ +E   Y L + A D G  P  S VT+
Sbjct:  217 DVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIP--MYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIV---SGNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQ-GAQPKTAYTSLTVTLLDVNDEPPLFTQ-TKYVATAVENSLPGLFVVSVSAADSDLGENG---TVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENV---APGTLVGSVSASTLDLNANVTYL-------IVSGDQ------RGSFSIEWSGGRIFTANAIDREEQAFYQLRVVANSGGVAGEAS---VSVLVHDVNNHAPVF----DRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGN----GGEKF--------GIFPDGQLYVRYELDRETREE--YSLTVSAMDTGVEPLSSSVTV 848          

HSP 2 Score: 141.354 bits (355), Expect = 5.230e-34
Identity = 175/674 (25.96%), Postives = 281/674 (41.69%), Query Frame = 2
Query:  515 VFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDL----EYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELL------DYFTIMISCQDYGNP-PHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVND-----KFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQE---SGTYYLKIQATDNGSP 2479
            V I + D  D  P F   +    V E++A G  +   +A   DL     Y  V      D    FS+ +       +     +D E     ++ L ++A  GG      +  + + V D N++ P+FD+      I E  P+ S  F   A+D DSG  G++ +++      +    F + F  G+L +   L+ +   ++ L V A D  GV P SS   + + V D N++ P+ +          E    G  VG V A+D D   NG VT    K   N+          D    R+ + RVFDRE L        F+  +   D G P P +      V V D+N+ PP F  S Y   +SE     + L+++ A D D+   +N  L  ++N+     KF +D + G +  +   DRE    Y + V  TD    + L  + TV + V D NDN P  T  +  +  + ++    G L+  L   D D   +  V   +++ +            + +F ID+   ++F+   LD E    Y+LN+   D G P RS+  I+ V V D NDN P +   +   +   N+   T     +I V A D DA  N  + Y+             +FTI   +G I  + ++      G + + ++ATD   P
Sbjct:  644 VTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDLNANVTYLIVSG----DQRGSFSIEWS---GGRIFTANAIDREE--QAFYQLRVVANSGGV---AGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEK---FGI-FPDGQLYVRYELDRETREEYSLTVSAMD-TGVEPLSSSVTVNVTVLDVNDNKPLFN-SSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVNF--------ELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDE--GVNGALRYAINEGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDS-GTSPLAASCTVAVQVLDENDNPPRFT--ESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNT-----------HATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTR----VITVTARDPDADVNGELHYSIARQ----FPPGAHFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIP 1267          

HSP 3 Score: 134.806 bits (338), Expect = 5.323e-32
Identity = 153/636 (24.06%), Postives = 266/636 (41.82%), Query Frame = 2
Query:  512 KVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYN-LEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQ-TQNYKFIKESTPIG----SVIFIFNASDADSGLFGKINFKLLPARTTK-NKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKND-SNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYG-NPPHRSFQLFNVS--VGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHS--LNYHL----------DPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTY----GNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQ--ATDIDAKKNSNISY 2332
            +V I +ED+NDN P F   E  ++V E+   G  +   +A D D     + +Y+ L  SE  F +      S  L   ++LD E  +   + LT+ A DG         +L + V D+NDN+P F +   ++   +++ P G    +VI    A DADSG FG++ + L P+  +      F L+  TG L +   L+ +  + ++L   A D  G    ++  +L + V D N++AP +   D  +  + E++P G  +  + A+D D   N ++   +   D     A+            +L   R  DRE   ++ +++   D   +PP R      VS  + D+N+  P+F  S  S    ED  + + +  ++A+D D   +  + Y L            +    F ++   G ++ +   DRE    Y + V   D+ R  + +  T         ++         +F  RE    +      G  +  L   D D   N  +  D+ S     +           F +D     L V   LDRE+   Y+L +   D G P RS+   + V + D ND SP ++     + Y V+   E     P++++Q  A D D   +  ++Y
Sbjct: 1501 QVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSEGAFVV---DAASGVLRASRRLDREERAS--YLLTVRASDG---THATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGG---LAATARLYVNVLDANDNAPSVQ-NDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVGNDG--------QLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFT-SPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNA-------PRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGD-----------FRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQL----SPYTVHAR-ENTQGPPVLILQVVARDDDLGSSGQVTY 2092          

HSP 4 Score: 133.65 bits (335), Expect = 1.472e-31
Identity = 131/502 (26.10%), Postives = 218/502 (43.43%), Query Frame = 2
Query:  509 IKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENI----SHRYFNLTLIACDGGTPVQC-DKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESL---TIMENSPAGEHVGMVIASDGDLEDNGKVT-CVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKT------HSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPK-YIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATV 1966
            + V + + D+NDNKP F +        E   VG+ +    A D D    G  +Y+ E  +  F L      +  +  L+  D E +        F+ +++A DGG P    D+  +Q+ V D NDN P F ++     + ES    + +    ASD D G+ G + + +           F ++ +TG++ L+ SL+ +  + + L V A D +G  P ++ C + ++V DEN++ P  +    ESL     +E++  GE +  + ASD D   +G V   ++  N     A+DRS          +   R  D E    + + +S +D G PP  S  +  V V D N+ PP+F   +    I E+I I + +I + A D D        +S+     P  +  F ID   G +      DREV    + V V  TD+        +    +TV   ++N      +    I  +      G+++G LQ  D D + NA V
Sbjct:  846 VTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVNFELDSE---TGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAI---NEGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATD-SGTSPLAASCTVAVQVLDENDNPPRFT----ESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATFAIDRSTGS-------VFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGAH--FTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTPTAILVDGLRAAAGSVVGTLQASDPDEAENAAV 1327          

HSP 5 Score: 130.568 bits (327), Expect = 1.052e-30
Identity = 164/673 (24.37%), Postives = 278/673 (41.31%), Query Frame = 2
Query:  509 IKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPI-----FDQTQNYKFIKESTPIGSVIFIFNASDADSGLF-GKINFKLLPARTTKNKVYFNLNFNTGELVLITS-LNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVT-CVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKD--KTHSLNYHLDPSV----NDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXX-PVMTGIKQFV-IRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNG 2473
            ++V + ++D NDN P F     R  V+E   VG  L        DL + G             ++ + P   + +   + LDFE  + R + L+L A DGG P    +    I++ D NDN+P               + ES   G+V  +   +DADS    G+++  ++      + V          ++ + S L+ + +  + L + A D       S+   L + V D N+HAP  +L    +  + E +PAG +V  V A D D   N K+   ++  ND  + ++D S  +       + T    DRE+     + IS QD G  P  ++    V++ D+N+ PP F  + Y     E+      ++ + A D D  +  ++ Y+ DP +     + F++D   G +  +   DRE + +Y  P+ V  Q RG+   G+T     V    ++  PV   ++ F  I EN    T       +   D D   N TV   L +                 F+++     +  + SLDRE+   Y+L +   D G  +  +  I+T+ V D  D  P +   +       NV   T +      V A+ +D   N+N++Y  V+ D         F+I    G IF +   D +E   Y L++ A   G
Sbjct:  120 LQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAAL-------RDLLHRGRGP---------LAVPFDPKTGM-VSTRQPLDFE--ARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFAL-SAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLGWFSVDESTGL-------VTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEY--PLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVT---TVTATDPDRGANGTVRYQLTAGDAA------------RFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGS----VSASTLDL--NANVTYLIVSGD-----QRGSFSIEWSGGRIFTANAIDREEQAFYQLRVVANSGG 737          

HSP 6 Score: 129.413 bits (324), Expect = 2.788e-30
Identity = 178/718 (24.79%), Postives = 297/718 (41.36%), Query Frame = 2
Query:  497 PDHWIKVFIIIEDINDNKPKFPTKE-KRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYN---LEDSEPFFSLLYRPMFS---LTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSL----GDRESLTIMENSPAGEHVGMVIASDGDLED-NGKVT-CVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQL-FNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSV---NDK--FQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHP----IILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIF--MSRDLQESGTYYLKIQATDNGSPPRFSDVTIITVKISTAEKTNYLIKNSQISFTL 2575
            P +  +V +++ D+NDN P FP      +   E  AVG Q+ L TA+D D+   GV  +    +  +E    +  RP+     L L     LD E  ++  + L + A DGG+P +  + ++ + V D+NDN P F++      + E +P+G+ +                   LL     +  +    +  TG +     L+ +   ++ L + A D  G  P S +    I++ D N++ P +          S ++ E++  G    +V  +D D    NG+++  ++  N+  +  L   H      +  L      DRE +  + + I   D G P  RS      V V D+N+  P F  S Y+  +SE     S +  + A+D D    LN  L  S+   ND   F +D + G++      DREV    ++ +   DQ      T  T++ +T+ DVND  P+ T  K   +   V+    G  +  +   D D   N TV  +        +  +  R +   F +D     +    SLDRE++++Y L +   D G P   +   +TV+V D NDN P++        Y V   A    N P    +  V ATD D   N  + Y     D         F +    G +   +S D +E   Y L++ A D G   R     I+T+ ++ A+ T         SF +
Sbjct:    3 PTYPTEVRVVVGDVNDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHAYKIVSGNEEGRLVPPRPVTKRAFLHLATTGPLDRE--ANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAAL-----------------RDLL--HRGRGPLAVPFDPKTGMVSTRQPLDFEARRQYTLSLRAAD-GGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVL---HAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADS--GLNAKLRYSIVSGNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQ-GAQPKTAYTSLTVTLLDVNDEPPLFTQTK--YVATAVENSLPGLFVVSVSAADSDLGENGTVRYNF-----DPDMPAQYREM---FRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVF--------YPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDA------ARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGH-LRARSPAIVTITVADAQDTPPTFARDDYSFVV 667          

HSP 7 Score: 129.028 bits (323), Expect = 3.880e-30
Identity = 169/686 (24.64%), Postives = 292/686 (42.57%), Query Frame = 2
Query:  512 KVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLE--DSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIK-ESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRES--LTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTH--SLNYHLD-PSVNDKFQIDINKGILKNIVHFDREVI------PKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMT-GIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTIITVKI 2518
            KV +++ D+NDN P F   +    + E+   G  +   TA D D    G   Y L   D+  F       + ++T  V  ++  +      + L + A DGG         + I V D+ D  P F +  +Y F+  E+   G+++   +AS  D  L   + + ++   +   +  F++ ++ G +    +++ +  + + L V A      G  + +  +++ V D NNHAP+    DR S  ++I E+ P       V A+D D   NG+V   + + +      ++     D  +Y        DRE  + +++ +S  D G  P  S    NV+V D+N+  P F  S+Y     E+ E+ S +  ++A D D      + Y  + P VN  F++D   G + ++  FDRE +        +   V  TD  R   L    TV + V DVNDN P     + Q  + E+   LT    +  +   D+D   N        ++    N  +        F +D     + +  SLDRE+   Y L +  +D G    +    + V V DENDN P +     ++   V+    T +   +I + A+D D   + ++ Y  V  + ++      F I    G +F++R  D +    Y L + A D G PPR S  TI+ V +
Sbjct:  539 KVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARF------QVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFAR-DDYSFVVFENVAPGTLVGSVSASTLD--LNANVTYLIV---SGDQRGSFSIEWSGGRIFTANAIDREEQAFYQLRVVANS----GGVAGEASVSVLVHDVNNHAPVF---DRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGG----EKFGIFPDGQLY---VRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVN--FELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQ---LLRVTASDVDEGVNG-------ALRYAINEGNE----GGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRF----TESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHAT-----FAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPR-SSATILVVHV 1172          

HSP 8 Score: 122.094 bits (305), Expect = 3.959e-28
Identity = 143/576 (24.83%), Postives = 262/576 (45.49%), Query Frame = 2
Query:  836 KLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMEN-SPAGEH----VGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVND-----KFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXX--XXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTIITVKIS 2521
            +++I V D NDN P+F   +    ++E+T  G VIF  +A+DAD G    + + +L    + ++  F ++  +G L     L+ +  + ++L V A D    G  ++  +L++ V+D N+++P  S     S  + E+ +P G+     +G V+A D D    G+VT  L  ++ +  A D +  +   +   L  TR  DRE    + +     D G     +     V+V D N+  PS  + + +  + ED    ++L++I A D D+   +N  L+ S++      +F +  N G L      DRE    Y + V V+D+ R      ++ V ++  +TDVNDN P  T  +  +  E+  +   G ++  +Q  D D+  N+ V   L +        +        F ++     + +   LDRE    Y L ++  D G P  ++   + V V D NDN+P  R+   +  Y+  +  +      ++ + A D D   N  + Y+  + D    +  +   +L   G + ++R  D + + +Y L ++A D G P R SD   + V +S
Sbjct: 1501 QVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVL----SGSEGAFVVDAASGVLRASRRLDREERASYLLTVRASD----GTHATDARLSVAVRDANDNSPRFSR-HAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWA-DGAFGLH-PVTGALNVTRPLDRESRACYVLRARATDGGG--LAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDE--GVNAELEFSISSGDPEGRFAVG-NDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAPEDSPV---GAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGA--GPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAP--RFPRRE--YEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDF--RLDPVL---GTLAVARPLDRERTASYELAVRARDGGGPAR-SDTASVRVTLS 2045          

HSP 9 Score: 106.686 bits (265), Expect = 2.586e-23
Identity = 114/415 (27.47%), Postives = 178/415 (42.89%), Query Frame = 2
Query:  515 VFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNL-EDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELL-DYFTIMISCQDYGNPPH-RSFQLFNVS--VGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDK---FQIDINKGILKNIVHFDRE 1735
            V + ++D+NDN P+F     +  VSES +   QL   TA D D    G   Y + E +E     +      +TL  L  LD E  +   + L + A D GT        + ++V D NDN P F ++       EST +G ++    ASD D+G  G + + ++   T      F ++ +TG + L   L+ +    + L+V A D  G  P SS   L + V+D N++ P    GD  + +IMEN P G  V  V A D D + NG++   + +          +H   D     + T    DRE+    F + +   D   P H R   L NV+  V D N+  P F      +         S +  ++A D D+  +       +  D    F++D   GI++     DRE
Sbjct:  958 VQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGKFTVDASTGQITL--LGSLDREETAS--YTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNT---HATFAIDRSTGSVFLARRLDFETQRLYRLNVSAED-GGRPPRSSATILVVHVRDFNDNPPAFLPGDVFA-SIMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPG-----AHFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTPTAILVDGLRAAAGSVVGTLQASDPDEAENAAVRYAVTGGDAAILFRLDRRTGIIETSTELDRE 1358          

HSP 10 Score: 103.99 bits (258), Expect = 1.566e-22
Identity = 129/545 (23.67%), Postives = 219/545 (40.18%), Query Frame = 2
Query:  212 HSYNFEANVVKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLDFK-----GHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDED------LEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGG--TPVQCDKQ-KLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLP------ARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALI-QIKALDKD--KTHSLNY-HLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTD 1774
            H+Y+F+  V +    +      +IG +      +    P    TY +  ++ DS+     F      G L V + +DRE     V +        +         ++++ + D NDN P         +V E    G  L   +A D+D      LE+    S +  D E  F++      S    V + LD E  S  ++NL +   D     P +     ++ + +TD NDN P F   ++     E +P+G+V+    A D DSG    + + L                 F LN  TGE+ L+  L+ +    + L V A D+ G  P +S   L + V D N++AP     + E+  I E+ P G  V  + A D D   NG++   +   D             D ++  L   R  DRE    + + +  +D G P         V++ D+N+  P+F  S Y++   E+ +    LI Q+ A D D   +  + Y     +    F +  + G +  +   DRE  P++++ +  TD
Sbjct: 1620 HAYSFD--VAEDAAPDGKTTRAVIGTVLA---GDADSGPFGEVTYALAPSE-DSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGGLAAT-----ARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEF----SISSGDPEGRFAVGNDGQLS----VARALDRERQS--FYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRS-ALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDK-GRPPLTSTATLAVTVGDANDNAPRFPRREYEA-AIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPT------GDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSPYTVHARENTQGPPVLILQVVARDDDLGSSGQVTYAAAGGNDGGAFSVSPD-GHVHLLRSLDREAQPQHVLIITATD 2133          
BLAST of Protocadherin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010725.1 (pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 gene:ENSPMAG00000009713.1 transcript:ENSPMAT00000010725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 153.68 bits (387), Expect = 3.864e-38
Identity = 193/773 (24.97%), Postives = 316/773 (40.88%), Query Frame = 2
Query:  389 DFKGHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFPD------------HWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSE-------PF-------------------FSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIF-DQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTT-KNKVYFNLNFNTGELVLITSLNAKIVSKFILDVE-----ARDENGVGPFSSQCQLTIRVQDENNHAPILSL----GD---RESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYH--------SNYSIFISEDIEINSALIQIKALDKDKT--HSLNYHL-----DPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIK-------QFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQN-NQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQ--ESGTYYLKIQATDNGS 2476
            +  G L V  R+DRE LC  +++ D C+    +H                  + V +++ DIND+ P F      + +SES AVG ++PL  A+D D     +Q Y +  +        PF                     + +R +  L     ++LD E +    + L L   DGG P       L I V D+NDN P+F D       I E + +G+ +    A+D D+G  G I +      T+   +   +++  TG   L+T  NA+ + +  + V      ARD  G    S+   +T+ + D+N++AP+  +    G+      + I+EN P+G  V ++  SD DL  +G V   L       LA        +++ + L TTR+ D E    + + +   D G P         +SV DIN+  P F +        + Y + + E+    + ++ + A D D     ++ + L       SV + F +++  G L      DRE   +Y + V   D            V +TV D NDN P   G+        QF + E   + TY   +G + T DLD   NA V  +L    V      WI         D     +     LDRE   +Y+L++   D G P  S    +++ V D NDN+P+    N N T   V   +   +   +  V A DIDA  N    Y  +  +   +     F +   +G + ++R +   + G + L ++  D G 
Sbjct:   78 ELSGELSVALRLDREALC--MEEPDACRSTGFMHTVQVAAMAKGQGSSNLRLLDVQLLVRDINDHAPAFRAPHLNVSISESEAVGRRVPLPRAIDPDAGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELR----EQLDREAVPS--YELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTG---LVTVRNAEKLDRETMPVHRLVVVARD-GGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGAELA------SPNKVQFLLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDG-GSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTY---VGTVSTSDLDEGDNARVALNL----VREAGPDWI-----GGAGDTPGGVVRTLVVLDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTNDNAPVITSPNTNDTWKHVRTFSPAGMLVGVS-VTANDIDAGDNGRPLYEIIGGNPKGI-----FLLNADSGALSLARTVSSLDEGLHRLVVRVRDRGG 813          

HSP 2 Score: 82.0333 bits (201), Expect = 6.323e-16
Identity = 138/594 (23.23%), Postives = 237/594 (39.90%), Query Frame = 2
Query:  839 LQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSG----------LFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEAR--------DENGVGP-FSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTR---VFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSF--------YHSNYSIFISEDIEINSALIQIKALDKD--KTHSLNYHLD-PSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVM---------TGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQT--AYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGI---FMSRDLQESGTYYLKIQATDNGSP 2479
            +Q+ V D ND+ P F        I ES  +G  + +  A D D+G                 +L P    ++    +      +        A +  +  LD EA          E+G  P  S    LTI V D N++AP+        + I E+S  G  V  + A+D D   NG +        +   +L     +  +    LVT R     DRE +    +++  +D G     +     V + D N+  P F        Y  +  + I E++   + ++ I   D D   + +++  L+ P+  +    +  + +LK     D E   +Y V V   D+     L+    + I+V D+NDNTPV            + +  +REN      G ++  L   D D+  N  +   L       + ++    +   F ++     L + + LDRE+  +Y+L++   D G P+R    I+ V V DENDN+P +   +N T   YQ  V  ET++   +  V  +D+D   N+ ++ N V  +    W           GG+    +  D ++   Y L ++A D+G P
Sbjct:  130 VQLLVRDINDHAPAFRAPHLNVSISESEAVGRRVPLPRAIDPDAGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSF---HTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGAELASPNKVQFLLKTTRLLDYEEAQQYNVSVLAADR-GTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGP---AGTVVLNLLATDADSGPNGAITFTL-------SELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLV-REAGPDWIGGAGDT---PGGVVRTLVVLDREDRVQYELSVRAVDSGRP 705          

HSP 3 Score: 69.3218 bits (168), Expect = 4.783e-12
Identity = 80/379 (21.11%), Postives = 157/379 (41.42%), Query Frame = 2
Query: 1418 FDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHS-NYSIFISEDIEINSALIQIKALDKDK------THSLNYHLDP-SVNDKFQIDINKGIL--KNIVHFDREVIPKYIVPVFVTD--QVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQI---LTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSS--LDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIW----RYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPR 2485
             DRE +  + +++  +D GNP      L  + V D N+  P F       + I+E  ++ ++++Q++A D D        +S +  L   +      +D   G++  +N    DRE +P + + V   D  Q+  +     T       D      V+    +++    V+I   L  G  +  +   D D   + TV   L                  +      K    +K++  LD E+  +Y ++++ +D G PK S +  + + V D NDN+P++      + +   Y+V++         ++ + ATD D+  N  I++   +         + F++  R G + ++   D ++   Y L ++A D GSP R
Sbjct:  230 LDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRL-------------EFPTGAELASPNKVQFLLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTL-SELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQR 594          

HSP 4 Score: 58.151 bits (139), Expect = 1.060e-8
Identity = 40/155 (25.81%), Postives = 75/155 (48.39%), Query Frame = 2
Query: 2051 YKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR----DLQESGTYYLKIQATDNGSPPRFSDVTI 2503
            ++  L ++  LDRE +  Y+L +   D G PK S   ++T++V D NDN+P++    +     V +T  + +   ++ ++A D DA  N  I+Y+F +  + SL  +    +    G + +      D +    + L + A D G   R + VT+
Sbjct:  220 HRALLELREQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFV---DPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSF-HTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASVTV 370          
BLAST of Protocadherin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004042.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 154.836 bits (390), Expect = 4.965e-38
Identity = 182/697 (26.11%), Postives = 288/697 (41.32%), Query Frame = 2
Query:  515 VFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGG-TPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLK--NDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDK-----FQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQ-------ESGT----YYLKIQATDNGSPPRFSDVTI-ITVKISTAEKTNYL 2545
            V +++ED NDN P+F   E R  V E   +G+ + L  A D D     + SY L   +  FS+   P  +  ++    LD E      + L + A DGG TP       L + VTD ND+ P F       +   S P G+ +F   A DAD+G  G + F L    +      F+++   G +    +L         L V   D  G  P S+   +T+R +D     P  + G R S +  E+ P G  + +V A        G V+  L    N  +  A+D            +   R  D E   ++ +++  +D G PP  ++    V V DIN+  P F  S +   + E+    + ++ + A+DKD    +N  +D S+ D      F+++ N G ++++   DRE +  Y + V  TD+        T  V I+VTD NDN+P  T I    +RE+  +   G  +  + T D D   NA +   LL   +              F I      + V   L+RE    Y + +  SD   P  +    +T++V+D NDN+P +     QTAY +     +     +  V A+D D   N  + +   +   N       F +   +G I   R L+        SG     Y   + A D G PP  SD T+ I + +  A    +L
Sbjct:   12 VTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGGDGHFSV--NPS-TGQIITTASLDREG--RESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSL----SGSASAGFSVDPRRGVIHAARALQGP-RDDLTLTVRVSD-GGAPPRSAVTTVTVRFRDAGEF-PRFAPGPR-SFSFREDQPPGTTITVVAARSS--RRAGPVSYHLASGGNLGDVFAVDPQSG-------EVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRT-IVVLTAVDKDS--GINGQVDYSIIDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDR-GSPTQHCTVKVLISVTDENDNSPRFTQIFSAHVREDAAV---GFPVLRVSTLDADEGPNAAITFSLLDPSL-------------PFSIHPSTGEITVSRRLNREDRSGYAVKVRASD---PAWTVSTDVTIVVDDVNDNAPRF----GQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTEN-------FRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFL 652          

HSP 2 Score: 117.857 bits (294), Expect = 1.029e-26
Identity = 151/679 (22.24%), Postives = 282/679 (41.53%), Query Frame = 2
Query:  500 DHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQ-LTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKT--HSLNYHL-DPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVM-TGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHP----IILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTI 2503
            D  + + I++   N N P+F  +     V+ ++  G ++   +A+D D +  G  +Y++                L L      D  +I    F++T+ A D G P    +    I VT+ N   P F        + E+ P GS +    A+D D+G+ G I + +    +      F+++  +G+++L+  L+ +    + L V A D  G     ++C  ++I V D N++ P+L+  D   + I EN+P+G  V ++ A D D   N      L   +++   L    N K  +   L T    D E    + + +   +Y +  H S    +V +  +NE+ P F    Y+  +SE   + + +  + A D+D     ++ Y L   S +  F ++ + G +      DRE      + V   +            +        ++ PV  + +    + E   + T+  ++G +   D D+           S  + S +         +F I+ +   + V S LDRE +  Y L ++  D+G P  +   ++ V +ED NDN P          + +  +A+   N P    ++ ++A D D   N    Y F     +  W   YF+ L+ +G +  +R  D ++   ++L +   D GSPP  S VT+
Sbjct:  634 DATVTINIVVP--NANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNASRRFDVDAGGFLHLRASLAGDAGSI----FSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIA---SGDGSGLFDISRASGDVLLVGELDYETEKLYNLSVCAAD--GGWQAKTECSGVSISVTDVNDNPPMLNASDYYPV-IPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEADLFVL----NQKTGV---LTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDANDPPVFSSALYHGRVSEAASVGTH--VVG-VSAHDFDSPPGWRT----FSFLIQSGNA------GRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGP----------FLLTSSAKVTENQPAGMTVLNLEAGDPDLPPNKG-PYTFQLLGSDPAW-RGYFS-LSSSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTL 1267          

HSP 3 Score: 117.087 bits (292), Expect = 1.493e-26
Identity = 164/705 (23.26%), Postives = 291/705 (41.28%), Query Frame = 2
Query:  395 KGHLLVNKRIDREFLCPNVDKIDDCQLELMIHA----FP--DHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEH-VGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRS---HNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSV---NDKFQIDINKGI---LKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESGTYYLKIQA 2461
             G + V++ +D E+             EL++ A    FP    ++K+ + + DINDN P+F +     KV E+      + + TA+D+D    G   Y++ D          P  S  +  +  LD EN++   + LT+ A D G+P Q    K+ I VTD NDN+P F Q  +   ++E   +G  +   +  DAD G    I F LL        + F+++ +TGE+ +   LN +  S + + V A D      ++    +TI V D N++AP    G             GE  V  V ASD D   NG+V   +     N+     S   H+++  + YR          L  Y + +++  D G PP  S     +++   N   P F    YS  ++  +   + ++ + A+D D+   +N  +  SV   N   + D++ G    L+  +  D   I  + V V   D+ R  + +  T +     +            +  + EN      G+ +  +   D D   N  +V       + S   S +      F+I +   ++ +   LD E    Y L++  +D G   ++    +++ V D NDN P+    +       N  + T     ++++ A D D+  N+   Y+  + + +     +   +LT  G  F+  D +   TY L ++A
Sbjct:  285 SGEVSVHRALDHEY---------QHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPP-RTIVVLTAVDKDSGINGQVDYSIIDGNIGNVFRVNPN-SGEIRSVSTLDRENVAS--YELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQIFS-AHVREDAAVGFPVLRVSTLDADEGPNAAITFSLL-----DPSLPFSIHPSTGEITVSRRLNREDRSGYAVKVRASDPA----WTVSTDVTIVVDDVNDNAP--RFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTENFRVGRDSGEIHSVR-PLRYRDPAGGGSGANLNKY-SFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDR--DVNGQIAYSVVGGNASRRFDVDAGGFLHLRASLAGDAGSI--FSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPA---GSSLARVTATDTDAGVNGAIV-----YSIASGDGSGL------FDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTT----VLVMDAVDADSPSNAVTMYSLDDGEADLFVLNQKTGVLTTQG--FL--DYETKQTYELTVRA 936          

HSP 4 Score: 102.834 bits (255), Expect = 3.920e-22
Identity = 137/589 (23.26%), Postives = 237/589 (40.24%), Query Frame = 2
Query:  515 VFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLE--DSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRE-SLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMK-DEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQ----LFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKT---HSLNYHLDPS-VNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIR-ENVQ-----ILTYGNLIGE----------LQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDN 2197
              I + + N   P+F      + + E+   G+ L   TA D D    G   Y++   D    F +      S  ++++ +LD+E  + + +NL++ A DGG   + +   + I VTD NDN P+ + +  Y  I E+ P G+ + + +A DADS       + L           F LN  TG L     L+ +    + L V A +      +S+  Q+ +++   N + P      RE +  + E++P G  VG V A+D D   +G V  +L           RS     +E    ++ +   DRE     T+ +  ++ G+   R F     L NV++ D N+ PP F  + Y   +SE   + + ++ + A D D      + ++ +        F I+ + G++      DRE +P Y + V   D                        P  TG    V+  E+V      +LT    + E          L+  D D   N        +  +L +  +W       F +      L     +DREQ  ++ L + I+D G P  ++   + + V D+NDN
Sbjct:  741 AIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDIS---RASGDVLLVGELDYE--TEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSL----DDGEADLFVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTA-QVHVQITGVNEYFPRFV--QREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGE-------SRSKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGS--IRGFDVDEVLVNVAITDAND-PPVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDM---------------------GEPPATGTTVVVVALEDVNDNGPFLLTSSAKVTENQPAGMTVLNLEAGDPDLPPNK----GPYTFQLLGSDPAW----RGYFSLSSSGL-LKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDN 1277          

HSP 5 Score: 101.293 bits (251), Expect = 9.277e-22
Identity = 81/300 (27.00%), Postives = 126/300 (42.00%), Query Frame = 2
Query:  809 GTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVN--DKFQIDINKG 1702
            G P       + + V D NDN P F   +    + E  PIGS + + NA+DAD+GL   I+++L          +F++N +TG+++   SL+ +    ++L+V A D       SS   L + V D N+H P   L          ++PAG  V  V A D D   NG +   L  + S   ++D     +  +I+     R   +   D  T+ +   D G PP  +     V   D  EF P F     S    ED    + +  + A    +   ++YHL    N  D F +D   G
Sbjct:    2 GEPRLTGTGTVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRL-----RGGDGHFSVNPSTGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRF-LNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAGFSVD----PRRGVIH---AARAL-QGPRDDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGEF-PRFAPGPRSFSFREDQPPGTTITVVAARSSRRAGPVSYHLASGGNLGDVFAVDPQSG 286          

HSP 6 Score: 85.8853 bits (211), Expect = 4.776e-17
Identity = 106/368 (28.80%), Postives = 166/368 (45.11%), Query Frame = 2
Query:  476 ELMIHAF--PD--HW--IKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNL--EDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGT--PVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDN-GKVTCVLLKNDS---NYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFP 1537
            EL + AF  PD  H+   +V + I  +N+  P+F  +E    VSES  VG  +    A D D    G   Y L  E     FS+      +  ++V  +LD E  +     L +IA + G+      D+  + + +TD+ND  P+F     +  + E+  +G+ +   +A D DS   G   F  L       +  F++N +TG +V+ + L+ + V  + L V A D  G  P +    + + ++D N++ P L      S  + EN PAG  V  + A D DL  N G  T  LL +D     Y +L  S  +K        T R  DRE    F + ++  D G+PP  S    ++SV D N+ P
Sbjct:  931 ELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVNEH---TGEIIVSSQLDREREAS--ATLRVIAKNAGSIRGFDVDEVLVNVAITDANDP-PVFSSALYHGRVSEAASVGTHVVGVSAHDFDS-PPGWRTFSFLIQSGNAGRA-FSINAHTGLIVVASPLDRESVPLYNLTVVAVDM-GEPPATGTTVVVVALEDVNDNGPFLLT---SSAKVTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSLSSSGLLK--------TARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDNP 1278          

HSP 7 Score: 58.5362 bits (140), Expect = 1.053e-8
Identity = 38/131 (29.01%), Postives = 58/131 (44.27%), Query Frame = 2
Query: 2135 GIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESG--TYYLKIQATDNGSPPRFSDVTIITVKIS 2521
            G P+ +    +TV+VEDENDN P +         +  V  +  +   + LV ATD DA  N+ ISY     D        +F++    G I  +  L   G  +Y L++ A D G  P  S    + V ++
Sbjct:    2 GEPRLTGTGTVTVLVEDENDNLPRF----GAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGGD-------GHFSVNPSTGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVT 121          
BLAST of Protocadherin-1 vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 196.438 bits (498), Expect = 9.456e-51
Identity = 187/676 (27.66%), Postives = 315/676 (46.60%), Query Frame = 2
Query:  515 VFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNL--EDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRV-FDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHS--LNYH-LDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESGTYYLKIQATDNGSPPRFS----DVTIITV 2512
            + I + DINDN P F     + +V E+   G Q+   +A D D    G   + +   + +  F++         + + K  D+EN +   ++LT+ A D G PV+ D  ++ I + D ND++P+F  +   K I EST IGS +    A+D DSG  G++ ++L+       K  FN++ N+G + + + L+ +    + L VEARD       SS  ++TI +QD N+++PI          + E+S  G  +G V A+D D   NG V   L  N ++  +++ S          L+T +   D E    + + ++ +D G P   S  +  V V D+N+ PP F  S Y+  + E++    A+  + A D D   +  ++Y  L  + N  F +D   G +   V  DRE I  Y + +   D          TTV I++ D NDN P  TG  +F I E+      G  +G+L   D D   N  V   ++S +             +SF++D     L V+S+LDRE I  Y L +  SD G P++S    I V V D NDN+P  R++  ++ +   +  + +++  ++ V+  D D   N  I+ +      ++   +    +L++        D + +  Y L + A D GSP + +     +TII V
Sbjct:  362 LLINVNDINDNPPVFSPSAYQSRVKENTPAGTQV---SATDRDSSTNGALVFGIIKGNDDGVFTIDGSTGI---ISIAKSPDYENKTR--YDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNV---KGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGG-STSRSSSTRVTIALQDINDNSPIFQ--GPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDN-TDVFSINTSTG--------LITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGEITTRVPLDRETIASYSLTINA-DDGSLVRFMAATTVNISIADENDNQPTFTGPSRFNISEDSPT---GTRVGQLTATDRDIGPNGAVTYAIISGN-----------QGNSFQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAP--RFE--KSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGSDNFTIDSTGFVLSK-----TPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINV 990          

HSP 2 Score: 196.052 bits (497), Expect = 1.310e-50
Identity = 190/675 (28.15%), Postives = 305/675 (45.19%), Query Frame = 2
Query:  518 FIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSE-PFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLK-NDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKA--LDKDKTHSLNYHL-DPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFT--ILTRNGGIFMSRDLQESGTYYLKIQATDNGSPPRFSDVTIITVKIS 2521
             I ++D+NDN P F     +  V E +AVG+ +   TA+D D+      SY+L   +  +F++  +       V+  K  F+  +   + + L A DGG+P +  +  ++IE+ D NDN P+F   Q    + E   IG+ +    ASD D+G    + +      T      F L+  TG + +  SL+ +  S + L +   D  G  P +    L I V D N++ P+ S    +S  + EN+PAG  V    A+D D   NG +   ++K ND     +D S  +       +   +  D E    + + +  +D G P         + + D+N+  P F  SNYS  I E   I S ++ + A  LD      L Y L   +V   F ID N G ++     DRE  P Y + V   D    T  + +T V I + D+NDN+P+  G   F + E+    + G+ IG++   D D+S N  V       + LS++          F I+     + +K+ LD E+  +Y + +   D G P RS++ ++ VMV+D NDN P    Q  ++ Y   V         +  V ATD D+  N  ISY+ ++ + N  +    FT  I TR     +  D +   +Y L I A D+GS  RF   T + + I+
Sbjct:  155 LITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTSYFTVDSQG------VIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNH---AFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDR-GSPPLTDTSHLLINVNDINDNPPVFSPSAYQSR-VKENTPAGTQVS---ATDRDSSTNGALVFGIIKGNDDGVFTIDGSTGI-------ISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGG-STSRSSSTRVTIALQDINDNSPIFQGPYVFRVSESS---SPGHQIGQVAATDADDSSNGDV------RYALSDNTDV-------FSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPP----QFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGEITTR-----VPLDRETIASYSLTINA-DDGSLVRFMAATTVNISIA 781          

HSP 3 Score: 178.718 bits (452), Expect = 3.289e-45
Identity = 179/727 (24.62%), Postives = 317/727 (43.60%), Query Frame = 2
Query:  398 GHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFPDH------WIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLE--DSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKD--KTHSLNYHLDPSVND--KFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENV--QILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHS---------FEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTI 2503
            G + V KR+DRE               L++ A          +    I + D+NDN P F        + E++ +G  +   TA D D       +Y L   D+  F      P   L +   + LD E+     ++L + A D G P Q     + + + D NDN+P F Q++    + E+T  GS I    ASD D+G  G++ + ++      +   F ++  TG + ++  ++ + ++ + L + A+D +GV P+ S   + I V DEN+++PI +  +  S  I E    G  V +V A+D D   N +V   +++ D++  A++  + +       L   +  +RE +  +T+ I   D G+P   S +   V V D+N+ PP F   +Y   + E+   +++++ + A D D      L Y +  S ND  +F+I+   G++      D E   +Y + V  TD                               ++  + NV  +++   ++      Q+   S           V V ++       L++S         F ID+    +     LDRE +  Y + + ++D G P  SN+  +T+ + DENDNSP +   +  ++   N +A ++ +  +    ATD D   N+ I+YN   ND         F I   +G I +++  D +   TY L IQA D+G+PP+ S +TI
Sbjct: 1049 GLISVAKRLDRETTA---------NYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKF---EVNPATGL-VTTKRPLDRED--QASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISG---NHGNAFRIDSTTGRITVVGVVDREALASYNLTISAKD-SGVPPWVSTAFVAITVADENDNSPIFA-SNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAMNGV-------LTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSI-ISGNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDS------------------------------KYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDSFGSLSYSIVGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILEN-SAPSSFSFKL---AATDADEGTNARITYNLSRNDA--------FMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITI 1705          

HSP 4 Score: 163.31 bits (412), Expect = 1.628e-40
Identity = 172/696 (24.71%), Postives = 306/696 (43.97%), Query Frame = 2
Query:  512 KVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDED--------LEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVT-CVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLN--YHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFV-----IRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHS---------FEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTIITVKI 2518
            +V I I ++NDN P F +  +   + E +A+   +    A D D        +E     S+ ++ S    S            V K+LD E  ++  + L + A + G+  +       I V D NDN P+F+     K + E+ PIG  +    A+D D G   K+ ++L    T+K    F +N  TG +     L+ +  + + L V A D +G    S+   +T+ + D N+++P  S   + +LT+ EN+  G ++  V+ASD D   NG+VT  ++  N  N   +D +         R+    V DRE L  + + IS +D G PP  S     ++V D N+  P F  +  S  I E + I S +  + A D+D+  +    Y +       F I+   G+L      +RE +P Y + +  +D+                      +P+MT  K+       + +N  +    + IG ++    +NS  +T V   L+V    + +    +L +S         F+I+     +   + LD E+  +Y L +  +D     ++N   +T+ V + ND +P +  QN    Y  +V   +  +  ++ V A+D D+    ++SY+ V            F+I  R+G I  +   D +    Y ++++ TD G+PP  S++T +T+KI
Sbjct:  982 QVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSDGTPLTFDIVEGNAGSSFKIDQSSGLIS------------VAKRLDRETTAN--YTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSK----FEVNPATGLVTTKRPLDREDQASYSLRVTAMD-HGKPSQSAVAAITLTINDLNDNSPQFSQS-KYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRIDSTTG-------RITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDR---------------------GSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVR----ENSAQSTSV---LTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDSKYTAKTN---VTIRVINLNDITPAFTQQN----YTASVRENSPTSTSVVKVSASDRDSF--GSLSYSIVGG-----KDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPP-LSNLTWVTIKI 1607          

HSP 5 Score: 161.384 bits (407), Expect = 7.352e-40
Identity = 177/662 (26.74%), Postives = 290/662 (43.81%), Query Frame = 2
Query:  515 VFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYN-LEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPIL--SLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMT-GIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPP 2482
            V ++++D+NDN P+F        V E++A G  +   TA D D    G  SY+ L  +E     + R  F+  +     LD E I+   ++LT+ A DG          + I + D NDN P F     +  I E +P G+ +    A+D D G  G + + ++      +   F L+  +G L + ++L+ + +  + L V+A D  G    S    + + V D N++AP    SL   E   I E++     V  V   D D   NG +T  L    S+   +D +          +++    D E    + + ++ +D G+P   +     +++ ++N+  PSF        I ED+ IN+ ++++ A D D T      ++ +    F+ID + G++      DRE    Y + V  T +      +      I V DVNDN PV   G     + EN+ I   G  + ++   D D   NA V  + LSV   S            FE++     +  K  LDRE    Y L +   D G P +S +  IT+ + D NDNSP    Q +Q+ Y + VT  T     I+ V A+D DA  N  ++Y+ ++ +     +   F I +  G I +    D +   +Y L I A D+G PP
Sbjct:  671 VKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDR--FTGEITTRVPLDRETIAS--YSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPSRFN-ISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNS---FQLDPRSGILSVRSTLDRETIPSYTLVVKASDA-GSPQQSITASIHVSVLDVNDNAPRFEKSLFSGE---IREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGSDNFTIDSTG--------FVLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSDGTPLTFDIVEGNAGSSFKIDQSSGLISVAKRLDRETTANYTLVVRAT-ETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPI---GQTVAKVTATDRDEGENAKVTYE-LSVGDTSK-----------FEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSP----QFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGN-----HGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPP 1287          

HSP 6 Score: 155.606 bits (392), Expect = 3.786e-38
Identity = 165/649 (25.42%), Postives = 285/649 (43.91%), Query Frame = 2
Query:  398 GHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFPDH---WIK---VFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLY--RPMFSL-----TLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDID 2305
            G + V   +DRE L             L I A       W+    V I + D NDN P F + E    + E +++G+++ + TA D D            +++ F+S++      F++      L V K+++ E +    + LT+ A D G+P+    ++L + V D NDN P+F+       ++E++   + +    A D+D G    + + ++     K    F +N  +G ++  T L+ +  S++ L+V A D      ++++  +TIRV + N+  P  +  +  + ++ ENSP    V  V ASD D   +   + V  K DS+  ++D+   +       + T  V DREL+  + I +   D GNPP  +     + + D N+  P F  S+YS  I E+   +S   ++ A D D+  +     + S ND F I  + G++      DRE    Y + +   D       +  T     +   +    + +   +  +REN    T+   +  +   D D   NA +   LLS    + H S        F +D    ++  K  LDREQ   Y L I ++D G P  S++  + + V DE+DN P  R+Q   T Y V ++        I+ V A DID
Sbjct: 1258 GRITVVGVVDREALA---------SYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRD---------EGSNAQVFYSIVRGDTSAFAINAMNGVLTVKKEINRETVPT--YTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKR---FKINSTSGVIMTTTPLDFEEKSQYGLEVTATDSK----YTAKTNVTIRVINLNDITPAFTQQNY-TASVRENSPTSTSVVKVSASDRDSFGSLSYSIVGGK-DSDKFSIDQRSGI-------ISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRNDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETH---VMRILASDADTGLNAELTFSLLS----NEHKSV-------FTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCP--RFQ--PTEYNVTISESLPRGASIVQVTARDID 1852          

HSP 7 Score: 149.443 bits (376), Expect = 3.677e-36
Identity = 165/699 (23.61%), Postives = 302/699 (43.20%), Query Frame = 2
Query:  449 VDKIDDCQLELMIHAFPDHW-------IKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSL-----TLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILS----LGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVT-CVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQD--YGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHL-DPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIF--MSRDLQESGTYYLKIQATDNGSP 2479
            +D+ D     L + A  DH          + + I D+NDN P+F   +  + V+E+ A G+ +    A D D    G  +Y++       S  +   F +      + V+  +D E ++   +NLT+ A D G P       + I V D NDN+PIF   +    I E   IGS + +  A+D D G   ++ + ++   T+     F +N   G L +   +N + V  + L + A D  G    +S  +LT+ V D N++ P+ +    +G     ++ ENS     V  V A D D+  N  +   ++  ND     ++ +  +       ++TT   D E    + + ++  D  Y    + + ++ N     +N+  P+F   NY+  + E+   +++++++ A D+D   SL+Y +     +DKF ID   GI+      DRE++  Y + V VTD     +   T      + + +++    +      I EN    ++     +L   D D   NA +  +L                N +F I      + +   LDRE    Y L I   D G P +++   I V V D ND+ P+    + + + + N   ET+    ++ + A+D D   N+ ++++ ++N+     ++  FT+    G I   +  D ++   Y L+I   D G+P
Sbjct: 1161 LDREDQASYSLRVTAM-DHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSI------ISGNHGNAFRIDSTTGRITVVGVVDREALAS--YNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSA----FAINAMNGVLTVKKEINRETVPTYTLTIRASDR-GSPMMTSDKELTVVVNDVNDNPPVFNSQSYIG-----SVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGV-------IMTTTPLDFEEKSQYGLEVTATDSKYTAKTNVTIRVIN-----LNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDSFGSLSYSIVGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSF---KLAATDADEGTNARITYNLSR--------------NDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETH----VMRILASDADTGLNAELTFSLLSNE-----HKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNP 1802          

HSP 8 Score: 146.362 bits (368), Expect = 2.852e-35
Identity = 144/581 (24.78%), Postives = 254/581 (43.72%), Query Frame = 2
Query:  743 KKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKF-IKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHS--LNYHLDPS-VNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESGT--YYLKIQATD 2467
            +K D E  S   + LT++A D        +  + I+V D NDN P F    +Y F I+E+TP   V  I  A+D DSG    I + L      +NK  F +N  TGE+  +T L+ +    + + + A D    G  ++   L I V D N++AP  +L   ++  + E+   G  V  + A D D+  N +++  L+  D++Y  +D    ++        T   FDRE    + + +  QD G+P         + + D+N+  P F  + Y+  + ED+ I +A++ + A DKD  ++  L Y       N  F +D   G++      D E    Y + + VTD+    +   +  +       ++         Q  ++EN    T      ++   D D+S N  +V  ++  +            +  F ID     + +  S D E   +Y L +   D G+P + +   +T+ +ED ND+SP++   N    Y   +   T +   ++ V ATD+D+     + Y  ++ +V     +  F I   +G I +S +L    T  Y L+++A D
Sbjct:   26 RKFDRE--SESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEF-PLNSYVFNIRENTPAAQVA-IVTATDRDSGTNAAITYSLFSG---ENK--FMMNSKTGEIRTVTPLDHETKDSYTMRISAFD----GKHTTFVPL-ITVDDVNDNAPFFALSVYKT-GVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTSYFTVDSQGVIR--------TKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGT------QVSATDRDSSTNGALVFGIIKGN-----------DDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSN----YSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNV-----KGAFNIDANSGSIRVSSELDRETTPSYSLQVEARD 557          

HSP 9 Score: 144.821 bits (364), Expect = 8.249e-35
Identity = 163/663 (24.59%), Postives = 291/663 (43.89%), Query Frame = 2
Query:  515 VFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDE------DLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVN-DKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVN-NDVNSLWYEKYFTILTRNGGIFMSRDLQESGTYYLKIQATDNGSP 2479
            V I I D+NDN+P F + +    V E +A+G  +   TA D+      DL Y    S+   ++   F+L      +  + V + LDFE  S   + L L   D G+P   D   L I V D NDN P+F  +     +KE+TP G+ +   +A+D DS   G + F ++      +   F ++ +TG + +  S + +  +++ L V+ARD  GV       Q+TI ++D N+H+P+ S  +  S  I E++  G  V  V A+D D    G++   L+  +     +  + N+ D     +  +   DRE    +++ +  +D G+    S     +++ DIN+  P  +   Y   +SE       + Q+ A D D + + +     S N D F I+ + G++      D E   +Y+V V   D    +  + T    +     ++       +    + EN   L  G  +  +   D D+  N  +   +LS +            N +F +D++   +  +  LDRE I  Y L I   D  + +      + + + DENDN P +   +     + N++ ++     +  + ATD D   N  ++Y  ++ N  NS   +    IL+    +  + D +   +Y L ++A+D GSP
Sbjct:  257 VEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRY----SFTSGNTNHAFTL---DAVTGVVTVSRSLDFEQRSS--YALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGTQV---SATDRDSSTNGALVFGIIKG---NDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDR-GVPVKYDTAQVTIFIEDVNDHSPVFSPSNY-SKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGN-----VKGAFNI-DANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSP-IFQGPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGEN---LAAGVAVCYVTATDADSGANGKISYSILSGN-----------ENMAFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPS-----RFNISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNSFQLDPRSGILS----VRSTLDRETIPSYTLVVKASDAGSP 872          

HSP 10 Score: 135.961 bits (341), Expect = 4.773e-32
Identity = 174/671 (25.93%), Postives = 298/671 (44.41%), Query Frame = 2
Query:  512 KVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMF-----SLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESL---TIMENSPAGEHVGMVIASDGDLEDNGKVT-CVLLKNDSNYLALDRSHNMKDEIIYRLVTTRV-FDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIF-ISEDIEINSALIQIKALDKD--KTHSLNYH-LDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGS 2476
            +V I IED+ND+ P F       ++ ES  +G+ +   TA D D    G   Y L       S   +  F     S ++ V  +LD E      ++L + A DGG+  +    ++ I + D NDN+PIF     ++  + S+P G  I    A+DAD    G + + L     + N   F++N +TG + L T L+ +  +++++ V A+D  G    SS   + + V D N++ P  +    +SL   T+ EN  AG  V  V A+D D   NGK++  +L  N++   A+DR      EI     TTRV  DRE +  +++ I+  D       +    N+S+ D N+  P+F  +  S F ISED    + + Q+ A D+D     ++ Y  +  +  + FQ+D   GIL      DRE IP Y + V  +D          +     +   ++       +    IRE+  + +    + +++ +D D   N  +         LS   S       +F ID     +  K+ LD E    Y+L +   D G P +S    + + + + NDN P +       A   ++  +  +N  ++ + ATD D      ++++ V  +  S      F I   +G I +++  D + +  Y L ++AT+ GS
Sbjct:  463 QVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRL------ISGNVKGAFNIDANSGSIRVSSELDRETTPS--YSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGPYVFRVSESSSP-GHQIGQVAATDADDSSNGDVRYAL-----SDNTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKD-GGTPSRSSLTVVKVMVDDVNDNPPQFA----KSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDR---FTGEI-----TTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTF--TGPSRFNISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNSFQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHS---TVLQVKVEDKDEGSNGAITLS------LSGEGS------DNFTIDSTGF-VLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFV----SPAQVTSIPEDVAINTHVVKLNATDSDGTP---LTFDIVEGNAGS-----SFKIDQSSGLISVAKRLDRETTANYTLVVRATETGS 1076          

HSP 11 Score: 124.02 bits (310), Expect = 1.979e-28
Identity = 178/682 (26.10%), Postives = 296/682 (43.40%), Query Frame = 2
Query:  515 VFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGG----TPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPF-SSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVT-TRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKT--HSLNYHLDPSVNDK-FQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTG---IKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTIITVKI 2518
            V I ++D NDN P+FP       + E+     Q+ + TA D D       +Y+L   E  F +  +   +  +  +  LD E  +   + + + A DG      P+        I V D NDN P F  +     + E   +GS++    A D D G+  ++++ L+   T+    YF ++    + V+ T       +K    V  R ++G  P  S Q  + I + D N++ P+ S   + + ++ E+   G  +  V ASD D  +N  +       ++N       H    + +  +VT +R  D E    + + +S  D G+PP        ++V DIN+ PP F  S Y   + E+     A  Q+ A D+D +   +L + +    +D  F ID + GI+      D E   +Y + V   D+    +   T  V I + DVND++PV +     KQ  I E+  I   G+ +  +   DLD+     +   L+S +V             +F ID    ++ V S LDRE    Y L +   D G   RS+   +T+ ++D NDNSPI+     Q  Y   V+  ++  H I  V ATD D   N ++ Y   +N          F+I T  G I +    D ++   Y + + A D G+P R S +T++ V +
Sbjct:   56 VVIDVKDENDNAPEFPLNSYVFNIRENTPAA-QVAIVTATDRDSGTNAAITYSLFSGENKFMMNSK---TGEIRTVTPLDHE--TKDSYTMRISAFDGKHTTFVPL--------ITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTS----YFTVD---SQGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSA-QYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTN-------HAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTP---AGTQVSATDRDSSTNGALVFGIIKGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDR-GVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQ--IPESTVI---GSTVVTVTATDLDSGPRGRLEYRLISGNV-----------KGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIF-----QGPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDN-------TDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSR-SSLTVVKVMV 675          
BLAST of Protocadherin-1 vs. Ensembl Nematostella
Match: EDO35412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK9])

HSP 1 Score: 172.94 bits (437), Expect = 1.887e-43
Identity = 194/766 (25.33%), Postives = 325/766 (42.43%), Query Frame = 2
Query:  245 YRLKEESDINTLIGNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLDFKGHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLE--DSEPFFSLLYR--PMFSLTLVVLKK-LDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSL-------GDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEII--YRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKT--HSLNYHLDPSVNDK--FQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHP---IILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGI--FMSRDLQESGTYYLKIQATDNG 2473
            + ++EE    T +G +  D  S +   PK+ F +   T             G +    RIDRE             L+L      +  I V + ++DINDN+P+FPT    +++ ES+ V    P+ TA D D    G   Y +   D+   FSL     P  S   V+ KK LD E  +  ++ L + A D GTP       + I + D ND+ P+F Q      I E+T  G  I   +A+D DSG  G I + +       N + F+L+ +TG +    +L+ ++ + +  +V A D  GV   +    +TI V D N+++P L +       GD+   +  ENS    ++  ++ +D D   N +    +   D            K E +  Y +   +  DREL+ ++ + ++  D G P   +     + V D+N+  P+F  + Y+  ISE  +  S ++Q+ A D D+    +++Y +    ND   FQ+D   G++      DRE +    + +   D         TT     +   ++    M    +  I E   I   G  + ++   D+D+  N  +  ++ S     N +         FE++     L+ KS LDRE    Y   ++  D G P+  +   + + + D NDN+P++        Y V   A    N P   ++ V ATD D   N+ ISY+ +  + N       F+I +  G I    S D +    + L I A D G
Sbjct:   14 FHVQEEQPPGTYVGKV--DGASAFEGSPKQ-FGFNSNT-------------GVISTTARIDRETTT-------QISLQLRTLNPSNQPISVQVQVDDINDNEPRFPTLYYTLRIRESMDVNTTNPINTATDPDAGNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKKPLDRE--TTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSI-FDLDSSTGVIRTKQNLDFEVKNSYTFNVIASD-GGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRS--ENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGC-------FKVEFLGFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGG-NDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASI---GATVLQVSATDVDSGDNGRITYEISSSDAQVNGL---------FELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVF--------YPVEYFASIMENEPPGKLLQVTATDADEGTNAVISYDIIGGNNNG-----NFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGG 717          

HSP 2 Score: 145.206 bits (365), Expect = 6.690e-35
Identity = 153/601 (25.46%), Postives = 269/601 (44.76%), Query Frame = 2
Query:  743 KKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKV-YFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLD---PSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGEL--QTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQES--GTYYLKIQATDNGSPPRFSDVTI-ITVKI 2518
            K LD E +   ++NLTL   D G P +     + I+VTD NDN+P F        I E    GS +   NA+D D G  G +++ +    T  N + +F ++F +G +     L+ + VS   + + A+D +G  P +    +T+ + D N++ P   +      TI E +  G  V  V A+D D  DNG++T  +  +D+    L    N +  +++   T    DRE    ++  +  +D+G+P   S     +++ DIN+  P FY   Y   I E+ E    L+Q+ A D D+  +     D    + N  F ID + G++  +   D EV   + + +   D                +   ++    +  +  F + ENV     G L+G +   T+D + S         +S  ++S   + + L++ +  I K      +   +DRE+  +Y L +I     +   S    + + V D NDN+P    Q + ++  V++     +   +    A D+DA KN  + Y   +N    LW      I + +G I ++R L +     Y +++ A+D+GSPP+ S +TI IT+ I
Sbjct:  381 KPLDRELVP--FYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSI----TGGNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQD-HGSAPKTGSTTVTVTIIDGNDNKPRF-MKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGL-FELNTQTGVLW---TKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMEN-EPPGKLLQVTATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVP---KGTLVGRVYATTKDKNGS---------ISYAIVSGDPTNLFLVDSTGGIIK------INGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAP----QFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAEGLLW------INSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHITLSI 940          

HSP 3 Score: 111.694 bits (278), Expect = 1.009e-24
Identity = 156/680 (22.94%), Postives = 278/680 (40.88%), Query Frame = 2
Query:  497 PDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLE--DSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIF-DQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSK------FILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKD--KTHSLNYHL-DPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQI----DKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESGT-YYLKIQATDNGSPPR 2485
            P H      I   IN + PKF        V  S  +  Q     A+D+D    G   Y++   + E  F +       +   +L+ L         ++L + A DGG P       + I + DSND+  +F + T  +   + S+P G+++    A   D      I + L+ + +     +F ++  +G++     L+ + + K      +I+  EA   N       +  + + V D N++AP+ S     ++T+ E S  G  V  + A D D  DN K    L+        +D+     +     L  ++  DRE    + +++   D  N    S     ++VGD N+  P F  S+Y++ I+ED  I S +I + A DKD  +   + Y + + ++   F ++   G L      D E    Y + +   D     + +        +   ++     T      +RENV     G  +G     D D   NA +   + S           +  + +F ++   C +   +++D E +    D ++L ++ +D G PK S  + ITV V DENDNSP +              A ++LN  ++ + A D D   N  ++Y+ ++ +        YF +    G + M   + ++ T Y L IQA+D G P R
Sbjct:  927 PQHSTMTIHITLSIN-HPPKFTLSSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQGNEEGLFGIFPGGKLYIRKSLLQAL------KGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSP-GTLVGTLVAHALDHSRTKDIVYSLISSES-----HFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAM-YNDTTIKRDKAIVIVTVTDLNDNAPVFSRA-VYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSG----TGMDKF--FINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNT---GFPVGRCTASDRDTGTNAHIAFSMYS-----------QTPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGF-------VSPPAAAAGSSLN--VMTITAEDPDRNSNGKVTYSIISGN------NGYFNLHPSTGQLQMIHQIPDNPTIYQLTIQASDGGQPSR 1556          

HSP 4 Score: 107.457 bits (267), Expect = 2.223e-23
Identity = 132/520 (25.38%), Postives = 211/520 (40.58%), Query Frame = 2
Query:  212 HSYNFEANVVKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLDFKGHLLVNKRIDREFLCPNVDK-IDDCQLELMIHAFPDHWIK-----VFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMF--------SLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELL----DYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDKFQIDINKGILKNI 1717
            H   F  N  ++ + E S   TL+G +   +      K   +  Y + +++  S+       G +    R+DRE L  N    +   Q E M   + D  IK     V + + D+NDN P F      I VSE    G+ +    AMD D           ++++ F+SL+             +  L + K LD E  S   +NL + A D          K++I V DSND  P+F ++     I E   IGS++   NASD D G  G I + +           F++   TG L++  SL+ +    + L + A+D +G+ P SS   +T+ V D N++AP+       +LT+ EN   G  VG   ASD D   N  +        S Y          +     + T    D E +    D F +++   D G+P   + +   V V D N+  P F     +   S    +N   I  +  D++    + Y +    N  F +  + G L+ I
Sbjct: 1046 HRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTK---DIVYSLISSE--SHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAM---YNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDAD---------EGDNAKFFYSLVSGTGMDKFFINSSTGELHLSKTLDRETTSS--YNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNL---AAMFDVESATGRLIVAKSLDFETTQLYELTITAQD-HGLIPLSSTVNVTVNVLDVNDNAPLFPT-QPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAF------SMYSQTPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPPAAAAGS---SLNVMTITAEDPDRNSNGKVTYSIISGNNGYFNLHPSTGQLQMI 1532          

HSP 5 Score: 96.2857 bits (238), Expect = 5.373e-20
Identity = 183/765 (23.92%), Postives = 325/765 (42.48%), Query Frame = 2
Query:  338 FTYKIYTTDIDSN-LTKLDFK-GHLLVNKRIDRE---FLCPNVDKIDDCQLELMIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNL--EDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKF-IKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVI----ASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLD----YFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKD--KTHSLNYHLDPSVNDKFQIDINKG----ILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDK--------YKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTI-ITVKISTAEK 2533
             TY+I ++D   N L +L+ + G L    ++DRE        V   D    +LM        +KV + I DINDN P F   E    + E+   G  L + TA D D     V SY++   ++   FS+      +  +  L  LD E     +F+L + A DGG         + + V +  DN P+F   + Y F + E+ P G+++    A+  D    G I++ ++    T     F ++   G + +   ++ +  ++++L V AR    V P S+Q  + I V D N++AP  S     + +++ +      VG V+    A D D   NG V   L  N    L ++ +       + +L       R+L D     +T+ +   D G+PP  S    ++++  IN  PP F  S+Y   +     ++     + A+D+D  K   L Y + P  N++    I  G    I K+++   + +   Y + V  TD    +               +  +  +    +F + EN    + G L+G L    LD+S    +V  L+S     +H          F +D     +  +  LDRE++ K         +   + +D  I  + +  I+ V V D NDN+P++    ++  Y + V+  +    P+  ++A D D   N+   Y+     V+    +K+F I +  G + +S+  D + + +Y L ++ATD  +   +S   I ITV  S  ++
Sbjct:  565 ITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLM------SSVKVELTISDINDNAPVFYPVEYFASIMENEPPGKLLQV-TATDADEGTNAVISYDIIGGNNNGNFSI---DSSTGVISTLASLDHE--VEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVF-LYEMYNFTVYENVPKGTLVGRVYATTKDKN--GSISYAIVSGDPTN---LFLVDSTGGIIKINGDMDREEKAQYLLAVIAR-VGTVKPLSAQATVNIEVLDRNDNAPQFS-----TSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAEGLLWINSTSG-----VIKLA------RKLTDGDETQYTVQVLASDSGSPPQHSTMTIHITL-SINH-PPKFTLSSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSI-PQGNEEGLFGIFPGGKLYIRKSLL---QALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENS---SPGTLVGTLVAHALDHSRTKDIVYSLISSE---SH----------FAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTI--KRDKAIVIVTVTDLNDNAPVF----SRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSL----VSGTGMDKFF-INSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQR 1261          
BLAST of Protocadherin-1 vs. Ensembl Nematostella
Match: EDO40470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S751])

HSP 1 Score: 168.703 bits (426), Expect = 4.274e-42
Identity = 198/757 (26.16%), Postives = 338/757 (44.65%), Query Frame = 2
Query:  245 YRLKEESDINTLIGNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLDFKGHLLVNKRIDRE---FLCPNVDKIDDCQLELMIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRP--MFSL-----TLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDK---THSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIP-KRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATD 2467
            + ++E S   ++IG++   SR    +       Y I   + D N+  ++  G L +   +D E    L   V   D     L  +A       V I + DINDN P+F +    +++ E   +G+     +  D D    G  S         FSLL  P  +F+L      L + K +D+ N S R + L + A DGG+P +     L+++V D ND +P+F        + E+TP  S I    A+D DSG  G+I++       T     F L  N G++ + + L+ + + ++ L V A D +G    SS   + + V D N++ P        +  + EN P   ++G V ASD D   NG VT       + ++         D+   ++ T++V DRE    +   I   D G+ P        V V D+N+  P F  + YS+ ++ED+ + S+L+ + A D D+      + Y +       F ++   G+L  +   DREV  ++I+ V  +D+     L   T + I V DVNDN PV   I +   +   + L  G+++  +   D D   N  V   +++ +            + +F+I++    +    +LD E  ++Y L +  +D+G   ++++ +++T+ VED NDN P +      T    NV   TN    +  ++A D D+  NS I Y      ++S     +F I +  G I  +   D +E   Y LK++ATD
Sbjct:  710 FTIQEHSQALSVIGHVHAISRD---KGTNAEVVYSISKGNTD-NIVLINSTGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYA------NVTIAVIDINDNSPQFNSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVS---------FSLLSNPGTLFNLDSNTGALSLTKLIDYGN-SARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSK---FGLR-NGGKIFIKSKLDREDIEEYNLKVIAID-HGTPRRSSSADVKVIVDDVNDNNPHFQQASY-AFFVKENEPVATYLGAVSASDSDEGSNGHVTYRFDTQVAQFIV--------DKQTGKITTSQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGPK-AFSLNQVTGVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVF--INETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNT-----------DGTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTN----VTTIKAHDDDSGLNSRIWYT-----IDSQSPRAHFKINSETGLIQTTHPIDREEISEYSLKVRATD 1409          

HSP 2 Score: 166.392 bits (420), Expect = 2.403e-41
Identity = 194/759 (25.56%), Postives = 338/759 (44.53%), Query Frame = 2
Query:  320 RKPKENFTYKIYTTDIDSNLTKLDFKGHLLVNKRIDREFLCPNV------DKIDDCQLELMIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQ-CDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQ------CQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHS--LNYHLDPSVN-DKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQES--GTYYLKIQATDNGSPPRFSDVTIITVKISTAEKTNY 2542
            + P  + TY I       +L ++   G L +   +DRE    ++      DK  +  LE + +        + I + D+NDN P F  +     V E + +G+ +    A+D D    G   Y + +     +        + +  L+ LDFE +++RY  L + A D G   Q    Q + I V D+NDN P FD+     +I E+ PI + +    A D DSGL  +I + +    +   + +F +N  TG +     ++ + +S++ L V A D+     F+ Q        L I +QD N++AP      R    +ME+ P    V  + A D D    G V   ++  D+   +LD    +K  ++ +L+ +   D E +  +T+ IS  D G+PP  S+QLFNV V D+N+ PP F    +   +SE+    ++++++ A D+D   +  L Y +   V  DKF ID + G++      DRE    Y + V  T       ++ T+     +   ++    ++ +    + EN    +   LI  L  QDLD   N  V+  ++S +            + +F I +    L   + LDRE    Y+L++   D+  P  +    IT+ +ED+NDN P+++    Q+ Y   ++  T     I+ + A+D D+  N NI Y   N+          ++I +R G ++ +   + S    Y     A D G  P+ +   I+ V+I   +K N+
Sbjct: 1149 QGPNSDITYMIVAGPKAFSLNQV--TGVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITY--------IEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTDGTFKINETTGV-ISTLRALDFE-VTNRYV-LRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTI---DSQSPRAHFKINSETGLIQTTHPIDREEISEYSLKVRATDQ----AFTEQDRLYNTATLKIIIQDLNDNAP--KFVSRNLTYVMEDEPFNFQVTSITALDPDTGQGGNVEYRIVSPDTGKFSLD----LKTGVL-KLIGS--LDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMDKFSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISPVVTLKVPEN----SPARLIYTLTVQDLDYGNNTKVLYSIMSGNT-----------DGAFTIGRSTGELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQ----QSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSNDTYG------VYSIDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMA---IVPVRIKIEDKNNH 1850          

HSP 3 Score: 145.591 bits (366), Expect = 5.074e-35
Identity = 182/690 (26.38%), Postives = 306/690 (44.35%), Query Frame = 2
Query:  512 KVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRP-MFSL-----TLVVLKKLDFENISHRYFNLTLIACD-GGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLT--IMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVS-----VGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLN--YHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILV---QATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTIITVKI 2518
            +V +I+ D+ND  PKF   +  + V+E + VG+ L    A D+D +          +S+  + ++  P  FSL      L ++  LD E ++HR+  L ++A D GG         ++I V D NDN P+F     +K + E  PIGSV+    A D+D G  GK+ +K++   T      F +N  TG +  + +L+ ++ ++++L V A D       +S   +TI V+D N++ P     D+  +   I EN P   +V  + A D D   N ++   +   DS      R+H   +     + TT   DRE +  +++ +   D         +L+N +     + D+N+  P F   N + ++ ED   N  +  I ALD D     N  Y +      KF +D+  G+LK I   D E +P+Y + +  TD +    LT      + V DVNDN P  T  +   I    +    G  + ++   D D+  NA +   +          S + +    F IDK+   +   S LDRE+ D Y L +  + +  P R +   + + V D NDN P +            VT +   N P  L+      D+D   N+ + Y+ ++ + +       FTI    G +  +   D +   +Y L +QA D  +PP ++    IT+ I
Sbjct: 1104 QVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQG--------PNSDITYMIVAGPKAFSLNQVTGVLTLVSPLDRE-VTHRHI-LHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTDGT---FKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTF---DKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTI---DSQS---PRAHFKINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQD--RLYNTATLKIIIQDLNDNAPKFVSRNLT-YVMEDEPFNFQVTSITALDPDTGQGGNVEYRIVSPDTGKFSLDLKTGVLKLIGSLDYEDVPQYTLHISATD-LGSPPLTSYQLFNVVVVDVNDNPPEFT--RDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSI---------PSGVEM--DKFSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKF--------ISPVVTLKVPENSPARLIYTLTVQDLDYGNNTKVLYSIMSGNTDGA-----FTIGRSTGELSTTTKLDRETKASYQLSVQAKDI-TPPYYTAFANITIFI 1740          

HSP 4 Score: 144.436 bits (363), Expect = 1.345e-34
Identity = 167/718 (23.26%), Postives = 302/718 (42.06%), Query Frame = 2
Query:  386 LDFKGHLLVNKRI-DREFLCPNVDKIDDCQLELMIHAFPDHWIKVFIIIEDINDNKPKF--PTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEP--FFSLLYR-----PMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPIL----SLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKD--KTHSLNYHLDPSVNDK-----FQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESGTYYLKIQATDNGS 2476
            L++   ++  K + DRE       K+    L ++  + P     V + ++D+NDN P F   T  K +          +L    A+D D      QSY +        F L+ +      +++  +V    +  +      + L + A DGG P      +L I V D+NDN P F        I E+  +G+ I   +ASD D G   +I + +     +  +  F ++  TG +V    L+ +    +++ V+A D+      SS   + I V D N++ P++    +LG   S  + EN+  G  V  V  SD D   NG+V   L   D  Y ++ +   + DE I  +   +  DRE  D+F +   C D G+PP  + + F ++VGD+N+  P F    Y   + E+  +N+ +  + A+D+D      L Y +  +   +     F ID + G++      DRE IP+ ++ V V D+    +    + +       +++           + EN      G+ + +L  QD D   N+ ++  +L+              N  F +D  K  +    +LD E    Y   +  +D G   RS    + V + D NDN P++    + ++Y V     T +   I  ++A D D+ K +   +     + + ++      ++T      + R+ Q++  Y L ++A D G 
Sbjct:    7 LEYNAGVITTKTVLDRE-------KVSAYNLTIVEFSTPPKSYTVLVYVQDLNDNSPSFVRGTSAKLVVFENDKDFRQKL---IAVDSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSI--ETHSDPQAIFGIHPTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGG--SYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDG-YFSM-KFDVLNDESI--IAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSP---SGSPVVQLLAQDPDIGENSLILYSILT-------------PNTPFFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGG--GRSCNATVHVSLTDLNDNQPVF----DPSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNADEVFSVDGSGLITL--AKLLDRETQDN--YLLTVKAVDGGG 680          

HSP 5 Score: 137.887 bits (346), Expect = 1.411e-32
Identity = 174/685 (25.40%), Postives = 295/685 (43.07%), Query Frame = 2
Query:  515 VFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLE--DSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKF-IKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIM--ENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDY------FTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHS--LNYHLDPSVN-DKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKK-NSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESGT--YYLKIQATDNGSPPRFSDVTIITVKI 2518
            V + + D+NDN+P F      ++  E+  +G  +    A+D D   F +  + +E  +++  FS+    + +L     K LD E  +   + LT+ A DGG     +K  + I V D ND  PIF + + Y F I+E +   SVI   +A   D G   ++ + +     T N V  N   +TG L L + ++ + +    L V+A+D+ G  P      +TI V D N+++P     +  S+ +   E++P G     V   D D    G+V+  LL N      LD +            T  +   +L+DY      +T+ +  QD G+PP  S  +  + V D+N++ P F + +Y+  + E    +S +I++ A D D   +  ++Y  D  V+  KF +  N G +      DRE I +Y + V   D       +      I     ++N         F ++EN  + TY   +G +   D D   N          HV     + +      F +DK    +     LDRE    Y  +I+ +D G   R +   +TV+V D ND SP  ++  N+  Y V V  +  +   ++ + ATD D +  NS+I+Y  V          K F++    G + +   L    T  + L + A+D G       +T I + +
Sbjct:  585 VHVSLTDLNDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNADEVFSVDGSGLITLA----KLLDRE--TQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAE-YNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGN-TDNIVLIN---STGTLYLQSEVDHEKIPSLYLTVQAKDK-GTPPLFGYANVTIAVIDINDNSPQF---NSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNPGTLFNLDSN------------TGALSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFGLR-NGGKIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATY---LGAVSASDSDEGSNG---------HVTYRFDTQV----AQFIVDKQTGKITTSQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSP--KFSKNK--YSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAG-------PKAFSLNQVTGVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINV 1214          

HSP 6 Score: 134.035 bits (336), Expect = 1.869e-31
Identity = 163/669 (24.36%), Postives = 287/669 (42.90%), Query Frame = 2
Query:  527 IEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSL----TLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLED-NGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDY-GNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDK--THSLNYHL-DPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFV-IRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHS----FEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRS---NMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESGTYYLKIQATDNGSPP 2482
            + D+ND  P F        V E+    + +    A D D    G  SY       F S +    F L     + +  KLD E+I    +NL +IA D GTP +     +++ V D NDNNP F Q     F+KE+ P+ + +   +ASD+D G  G + ++            F ++  TG++     L+ +  + ++  + A D  G  P   + Q+T+ V+D N+ +P  S  ++ S+T+ E+ P G  +  +IA+D D +  N  +T +++     +          +++   L      DRE+     + +   D  GN    +     ++V D+N+  P F +      + E + I S +  + A+D D+     + Y + + + +  F+I+   G++  +   D EV  +Y++ V  TD  +    T    V I V D NDN P          I ENV I T    +  ++  D D+  N+ +               W  + + S    F+I+     +     +DRE+I +Y L +  +D    ++    N   + ++++D NDN+P  ++ +    Y   V  +   N  +  + A D D  +  N+ Y  V+ D      +    +L   G    S D ++   Y L I ATD GSPP
Sbjct:  902 VVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISY------AFDSKVDTSKFGLRNGGKIFIKSKLDREDIEE--YNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYRF-----DTQVAQFIVDKQTGKITTSQVLDREAKASYVFSIVATD-GGSSPRVDKTQVTVIVRDVNDCSPKFS-KNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGPKAF--------SLNQVTGVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTDGTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTN---VTTIKAHDDDSGLNSRI---------------WYTIDSQSPRAHFKINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAP--KFVSRNLTY---VMEDEPFNFQVTSITALDPDTGQGGNVEYRIVSPDTGKFSLDLKTGVLKLIG----SLDYEDVPQYTLHISATDLGSPP 1520          

HSP 7 Score: 117.087 bits (292), Expect = 2.546e-26
Identity = 104/389 (26.74%), Postives = 178/389 (45.76%), Query Frame = 2
Query:  473 LELMIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEY-FGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRE--LLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKD 1630
            ++ M    P     V++ I  I   +PKF       KV E+  +G  +      D       G  SYN+E+S  +F +  R   S  + V K LD+E  + R F L + A D   P +  +  + I V+D ND  P+F Q+       E  P+G+++   +A+D DSG  G++ F +   ++  +K  F ++  TG +    +L+ + +    + V A DE G  P  +   +TIRV D N++ P+  +     + ++EN P    +  + A+D D   N +++  ++      L L       D+    L T   FD E   +  +++ I   D GNPP  S     V+V D +E+ PSF   +Y   +  + +I   + Q+ A D+D
Sbjct: 2278 VQAMDQGVPPQRALVYVRI--IITREPKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIENSN-YFRIGQR---SGVISVNKPLDYE--TKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAI---QSGDDKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDE-GSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQGLFL------IDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSFNRMDYKFDVPGNAKIGDFVGQVTATDRD 2648          

HSP 8 Score: 116.701 bits (291), Expect = 4.122e-26
Identity = 169/681 (24.82%), Postives = 288/681 (42.29%), Query Frame = 2
Query:  521 IIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQS------YNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQ--DENNHAPILSLGDRESLTI--MENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSN-YLALDRSHNMKDEIIYRLVT-TRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLN--YHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGG-IFMSR--DLQESGTYYLKIQATDNGSPPRFS--DVTII 2506
            I + D+ND  PKF       +V E+  V   + +  A+D+D   FG  S       N  +S  +         S  +     LD E I      LT++  D G+P   D   + + +TDSNDN+P F+Q+     + E++P GS +    A D D G    I + +L    T N  +F L+   G +    +L+ ++ S +   V A D  G       C  T+ V   D N++ P+    D  S ++   EN+  G+ +  + A D D         ++ + +++   ++D S          L+T  ++ DRE  D + + +   D G     +  + N++V D+N+ PP F  + Y+  I E  +  S +  + A+ +DK  +    Y +     D   +  + G L      D E IP   + V   D+    +          +   +++    +      + E+  I   G+    +   D D+      V   +S  +LSN  +   L +++  +   K   +  S+        Y L +   D G P RS+  ++ + V D ND SP++       +Y  +V   T  +  II V ATD+D+ +N  ISY F     +S      F +  RNGG IF+    D ++   Y LK+ A D+G+P R S  DV +I
Sbjct:  377 INVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQD---FGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVV--LTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSIL----TPNTPFF-LDPRKGLVTNSRTLDHEVQSSYTFQVAATDGGG-----RSCNATVHVSLTDLNDNQPVF---DPSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNADEVFSVDGSG---------LITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGNTDNIVLINSTGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQFNSSSILVRLPEDTPI---GHTFYTVSVFDADSG-----VLGRVSFSLLSNPGTLFNLDSNTGALSLTKLIDYGNSAR------SYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVF----GNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAF-----DSKVDTSKFGL--RNGGKIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVI 1005          

HSP 9 Score: 114.005 bits (284), Expect = 2.882e-25
Identity = 173/709 (24.40%), Postives = 302/709 (42.60%), Query Frame = 2
Query:  515 VFIIIEDINDNKPKFPTKE-KRIKVSESIAVGNQLP---LQTAMDEDLEYFGVQSYNLEDS---EPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIF--NASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLAL--------DRSHNMK----------DEIIYRL-------VTTRVFDRELLDYF-TIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSL---NYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNH----SFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWY-EKYFTILTRNGGIFMSRDLQESGTYY--LKIQATDNGSPPRFSDVTII 2506
            V I+I +I D+ P+F  +   R+ + E+  VG+ +     + + D  + Y  + S N   +   +PF  ++       ++     LD+E  S + F L L+A   G         L I V D NDN+P F  +     + E T      F+    A+D DSG  GK+ + +    T      F ++  TGE+     L+ +  + F L +   D +G+ P S+ CQ+ + V D N++ P+        + I E++  G  V  V+A+D D E   ++T  L    +  +A+        D   N +          D+I Y++          R  D  + D F  I +   D G PP R+     V V  I    P F   +Y   + E+  + ++++ ++  D      L   +Y+++ S  + F+I    G++      D E   ++++ V   D            VYI V+DVND  PV  G   ++ + + + +  G ++  +   D D+  N  V               W  + +     SF ID+    +  + +LD E I  + +++  +D G P       +T+ V D NDN P++R         V V     LN  +  + ATD D+  N+ +S+  +      L+  +K+   LT N    ++ D + +  Y   L I+ATD G+PP  S++TII
Sbjct: 1948 VQIVIGNIQDDPPRFLNQTPARVSIPENSKVGSYITTVRARASSDAQVTY-SIISGNKGRAFYVDPFTGVI-------SVASADALDYE--STKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIW---TGNEAGVFTIDSTTGEITTAKLLDRETTASFDLVIRGTD-SGIPPKSTNCQVKVVVTDLNDNPPLFD--PLSEVNIREDTRTGAVVTSVVATDTDKE--SRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRAL----VYVRIIITREPKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIENS--NYFRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDT-APSKPVRVPVYINVSDVNDEKPVF-GQSGYMAQWS-EGIPVGTIVVNVSAADKDSGANGRV---------------WFAIQSGDDKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPN---DVQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQGLFLIDKFSGWLTTN----ITFDYENTAVYQYSLTIKATDAGNPPLSSNITII 2607          

HSP 10 Score: 113.62 bits (283), Expect = 3.300e-25
Identity = 136/506 (26.88%), Postives = 219/506 (43.28%), Query Frame = 2
Query: 1037 NLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVT-CVLLKNDSNYLALDRSHNMKDEIIYRLV---TTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKT------HSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVM----TGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDL--QESGTYYLKIQATDNGSPPRFSDVTII 2506
            +L +N G +   T L+ + VS + L +    E    P S    + + VQD N+++P    G    L + EN    +    +IA D D   N   +  ++  N  N   L    +   ++   LV   ++   DRE LD + + IS  D GNP +  F   +++V D N+  P F + +YS  I E+I++ ++++Q+ A DKD        +S+  H DP     F I    G++ N V  D E    Y++ V   D+     L+ +  V I V DVNDN PV+    T    + + EN  I   G  +  +   D D+  N  V   L                +  F++   +  + V  SLDRE  D + L  +  D G P R+  +   + V D ND +P +    ++  Y+  V     +N  + +V A D D   NS + Y   N    S  Y  +F I   +G I  + DL  ++     L +   D GSPP   + ++I
Sbjct:    6 DLEYNAGVITTKTVLDREKVSAYNLTIV---EFSTPPKS--YTVLVYVQDLNDNSPSFVRGTSAKLVVFENDK--DFRQKLIAVDSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQA--IFGIHPTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATI---GTQVARVSVSDADSGKNGEVNVTL---------EGGDGYFSMKFDVLNDESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKF----DRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANT-TESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVI 485          

HSP 11 Score: 107.457 bits (267), Expect = 2.521e-23
Identity = 134/600 (22.33%), Postives = 251/600 (41.83%), Query Frame = 2
Query:  776 YFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGP--FSSQCQLTIRVQDENNHAPILSLGDRESL---TIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLN----YHLDPSVNDK--FQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFV-IRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSS--LDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHP--IILVQATDIDAKKNSNISYNFVNNDVNSLWY---EKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTIITV 2512
            YF LT+ A     P +     ++I V D NDN P F        + E++P   +I+     D D G   K+ + ++   T      F +  +TGEL   T L+ +  + + L V+A+D   + P  +++   +TI ++D+N++ P+     ++SL   TI E +P G  +  + ASD D   NG +   L  +     ++D     +  I+Y         ++  ++F I    +D G  P  +     + + D N   P F  + Y + I  +   ++ +  + A D D   S N    Y LD S N    F ++ N G ++    F      ++ + +   D     +        +     +D    +      V I EN ++ +Y   +    + D   +Y+           ++S +         +F +D +   + V S+  LD E    ++L+++ +  G    +   I+ + V D NDNSP +   N        +  +T    P  ++ V ATD+D+  N  ++Y        S+W       FTI +  G I  ++  D + + ++ L I+ TD+G PP+ ++  +  V
Sbjct: 1612 YF-LTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISPVVTLKVPENSP-ARLIYTLTVQDLDYGNNTKVLYSIMSGNTDG---AFTIGRSTGELSTTTKLDRETKASYQLSVQAKD---ITPPYYTAFANITIFIEDQNDNPPVF----QQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSNDTYGVYSIDS----RTGIVYSAARFETSIKQEYNFFCI---AKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSLFVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIPENSKVGSYITTVRARASSDAQVTYS-----------IISGNKG------RAFYVDPFTGVISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSN----MLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTY--------SIWTGNEAGVFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVV 2163          

HSP 12 Score: 103.99 bits (258), Expect = 3.207e-22
Identity = 177/724 (24.45%), Postives = 295/724 (40.75%), Query Frame = 2
Query:  341 TYKI-YTTDIDSNLTKLDFKGHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQ---CDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKN-DSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSA-LIQIKALD-KDKTHSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTY-GNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQE--SGTYYLKIQATDNGSPP 2482
            T+KI  TT + S L  LDF+   + N+ + R        K      +L           V I +ED NDN+P F        + E++ +   +    A D+D        Y ++   P           L +     +D E IS   ++L + A D     Q    +   L+I + D NDN P F  ++N  ++ E  P    +    A D D+G  G + ++++   T K    F+L+  TG L LI SL+ + V ++ L + A D  G  P +S  QL   V  + N  P     D    T+ EN P G  V  V A D D   N ++T  +    + +  ++D+   +       +VT  + DRE  D + + +       P   S     ++V D N+ PP F     ++ + E+        + ++ LD  + T  L   +  + +  F I  + G L      DRE    Y + V   D +     T    + I + D NDN PV    +Q +    +  LT  G  I  L   D D+  N  +V      + LSN    +      + ID     ++  +  +     +Y    I  D G   +  +  + + +ED+N+++P    Q  +T Y+V++   T+ +  + +V ATD D  K++N    +  +D  S      F + +  G +  S        G + L I A D+GSPP
Sbjct: 1271 TFKINETTGVISTLRALDFE---VTNRYVLRVSATDMGKKQQKTSYQL-----------VTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQSPRAHFKINSETGL-IQTTHPIDREEISE--YSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKF-VSRNLTYVMEDEPFNFQVTSITALDPDTGQGGNVEYRIVSPDTGK----FSLDLKTGVLKLIGSLDYEDVPQYTLHISATDL-GSPPLTS-YQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMDKFSIDKHSGL-------IVTNSILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISPVVTLKVPENSPARLIYTLTVQDLDYGNNTKVLYSIMSGNTDGAFTIGRSTGELSTTTKLDRETKASYQLSVQAKD-ITPPYYTAFANITIFIEDQNDNPPVF---QQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIV------YTLSNDTYGV------YSIDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAP----QFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDD--SKNSTSLFVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPP 1941          

HSP 13 Score: 98.2117 bits (243), Expect = 1.562e-20
Identity = 177/763 (23.20%), Postives = 308/763 (40.37%), Query Frame = 2
Query:  335 NFTYKIYTTDIDSNLTKLDFKGHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYF--GVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIF-DQTQNYKFIKESTPIGSVIFIFNA---SDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITS--LNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPA--GEHVGMVIASDGDLEDNGKVT-CVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDKFQI------DINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENV---QILTYGNLIGELQTQDLDNSY------NATVVCDLLSVHVLSN-------HMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESG--TYYLKIQATDNGSPPRFSDVTIITVKI 2518
            N TY +Y+  IDS    +        + + +  F C   D+  D ++ +         + V I IED N++ P+F      + +  + +    + + TA D D +    G  +Y L+DS+   SL    + S T  V     F N       L +IA D G+P       +QI + +  D+ P F +QT     I E++ +GS I    A   SDA      ++ + ++     K + ++   F TG + + ++  L+ +    F L + A  +  V   +    L I V D N+++P     +  +  + E++ A     V  V A+D D   NGKVT  +   N++    +D +          + T ++ DRE    F ++I   D G PP  +     V V D+N+ PP  +     + I ED    + +  + A D DK   L Y+L  +      I      D + G    I         KY  P+  +DQ+   I   T  +    T           I    + + V   + L Y  +I   + +    SY      NA +   +L+V V  N        +S+    ++ F I +    + V   LD E   ++ L +   D   P +     + + V D ND  P++     Q+ Y    +    +   ++ V A D D+  N  + +   + D      +  F I  + G I   R L      T+++ ++ATD GSPP  +DV+ +T+++
Sbjct: 1791 NDTYGVYS--IDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMAI---------VPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSLFV--VESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIPENSKVGSYITTVRARASSDA------QVTYSIISGN--KGRAFYVDPF-TGVISVASADALDYESTKNFRLHLVATPQGWVS-LNGYMILDINVIDRNDNSPAFHPSNMLA-QLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGVFTIDSTTG-------EITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPP-LFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQI---------KYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIITREPKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIENSNYFRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVF----GQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGD-----DKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVS-VTIRV 2502          

HSP 14 Score: 83.5741 bits (205), Expect = 4.717e-16
Identity = 167/686 (24.34%), Postives = 279/686 (40.67%), Query Frame = 2
Query:  473 LELMIHAFPDHWIKV--FIIIE----DINDNKPKFPTKEKRIKVSESI-AVGNQLPLQ-TAMDEDLEYFGVQSYNL--EDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQ----------------------------NYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFI-LDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDR-SHNMKDEIIYR-------LVTTRVFDRELLDYFTIMISCQDYGNP--PHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDK-THSLNYHLDPSVNDK--FQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPV--MTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDRE--QIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSL 2362
              L + A P  W+ +  ++I++    D NDN P F       +++E   A   +  ++ TA D D    G  +Y++   +    F++      +  +   K LD E  +   F+L +   D G P +    ++++ VTD NDN P+FD                                Y     STP G  I   +A+D DSG   +I +      T  +++ + ++ +TG +    +++ +I   FI + V+A D+ GV P  +   + I +  E         G      + EN+  G                  V  V + +++  L L R S+N+++   +R       +   +  D E    F +++S  D   P  P R     NVS  D+N+  P F  S Y    SE I + + ++ + A DKD   +   +    S +DK  F ID   G+++     D E I  + V V  TD+     +    +V I V D+NDN PV  + G     + EN   L   + + E+   D D+  NA      LS  V+      +      F IDK+   L    + D E   + +Y L I  +D G P  S+   I V V DE++  P +    N+  Y+ +V     +   +  V ATD D+     + + F N   N+L
Sbjct: 2033 FRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGVFTI---DSTTGEITTAKLLDRETTAS--FDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTP-GIAILRVSATDQDSGSNAQIKYSF--PITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQ-GVPPQRALVYVRIIITREPKFELPSYFG-----KVPENAMMGT----------------SVLTVRVTDNAAGLPLGRISYNIENSNYFRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVS--DVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDE-GSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLEN---LPLNSRLYEINATDRDSGANAR-----LSFTVIGGTGQGL------FLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSF----NRMDYKFDVPGNAKIGDFVGQVTATDRDSGDQGRVFFVFYNPTSNAL 2667          

HSP 15 Score: 62.7734 bits (151), Expect = 9.735e-10
Identity = 104/486 (21.40%), Postives = 186/486 (38.27%), Query Frame = 2
Query:  344 YKIYTTDIDSNLTKLDFKGHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLE-DSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADS--GLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVT-CVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSV-----NDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTD 1774
            Y I + + D   T     G L    ++DRE        +   Q + +   +   +  + I IED NDN P F        +SE    G  +   TA D+D    G   Y L  D+   +S+  R     T +V     FE    + +N   IA D G   +     ++I++ D N++ P F +T     I  +T   +++ +  A+DAD+     GK+ ++L  ++ + +   F +  NTG +      +     +  L + A D +G  P      + I + +  +  P         ++I ENS  G ++  V A       + +VT  ++  N      +D         +  + +    D E    F + +     G      + + +++V D N+  P+F+ SN    ++ED         +K    D     N  +  S+        F ID   G +      DRE    + + +  TD
Sbjct: 1682 YSIMSGNTDGAFTIGRSTGELSTTTKLDRETKASYQLSV---QAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSNDTYGVYSIDSR-----TGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTS--LFVVESNTGSVRTSAGFSNPPQGRHALYIIAED-HGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIPENSKVGSYITTVRAR---ASSDAQVTYSIISGNKGRAFYVDPFTG-----VISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGVFTIDSTTGEITTAKLLDRETTASFDLVIRGTD 2148          
BLAST of Protocadherin-1 vs. Ensembl Nematostella
Match: EDO41767 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3G3])

HSP 1 Score: 155.221 bits (391), Expect = 7.881e-38
Identity = 169/680 (24.85%), Postives = 293/680 (43.09%), Query Frame = 2
Query:  515 VFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSL---TLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESL---TIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKT--HSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFV-NNDVNSLWYEKYFTILTRNGGIFMSRDL--QESGTYYLKIQATDNGSPPRFSDVTIITVKIS 2521
            V + + DIND  PKF +      + E+I +G+++    A D D    G+ +Y L   +     L +  F +   T  +  +   +      F   + A D GT        ++  V D ND  P F Q++    +KE   IG  +    A+D D  L  ++ + +L   +   +  F +   TG + +  SL+ + V  + L++ A D    G F+S  Q+ I ++D N++ PI +    +S+    I EN+P G  V  V A+D D+  N ++T  +        A+D++  M + +          DRE   ++  M+S  D G      +   ++ + D+N+  P F  S+Y   + ED  +   L+Q+KA D D      L Y L       F I+   GI+      +RE+   Y + V V D     + +  T     +   +        I    + E+  I   GN +  ++    ++S       D+++  +L    S +      F ID+    + V   LD E    Y L +  SD G P   +   + + V D NDN P +    ++  Y   V   + L   ++ V ATD D+  N+ I Y+    ND       K F I+   G I +S D+  +E  +Y LK++A D G PP+ +D T++ ++++
Sbjct: 2742 VVVQVLDINDVTPKFVSDPYLASIPENIDIGSKVLRVFAEDLDSGSNGMVTYALVSKDK----LVKEKFDIDQHTGWITTRGALDREKQPSFEFQVRATDNGTTRLTSLTTVRAIVLDVNDTPPKFSQSEFMASVKEDALIGQSVTTITATDED--LNTELYYFIL---SGDPQARFGIERKTGVIFVHGSLDRESVGSYDLNISASD----GLFTSFAQMKIDIEDANDNPPICT----QSIYVEHIKENTPLGSTVLTVGATDADVGVNAELTYSVFGQGFGTFAVDKNGKMTNLV--------ELDRETRPFYNFMVSAADIGG--QACYSNISIHLDDVNDNRPLFSQSSYFTAVYEDAPLKKVLLQVKADDADVGVNRKLTYSLVTDAGGTFTIETGTGIISLEKPLNRELKENYTLNVEVMDGGTPPLSSIATVQIKVLNINDVPPEFSHSIYHGNVSEDAPI---GNEVVRVRAVSRESSN------DVITYAILRGADSGL------FSIDRKNGTIHVNRKLDYETTKLYTLTVEASDAGPPVLRSTSYVRISVTDSNDNGPEF----SEKRYSAKVDENSALGTFVLQVFATDRDSGTNAQIKYSIAEGNDA------KKFKIVEETGVIKVSGDIDREEVASYRLKVRAQDQGLPPQVAD-TVVDIEVT 3368          

HSP 2 Score: 154.836 bits (390), Expect = 9.497e-38
Identity = 165/686 (24.05%), Postives = 304/686 (44.31%), Query Frame = 2
Query:  515 VFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLE---YFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNT------GELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYH--LDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNL-NHPIILVQATDIDAKKN-SNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQES-GTYYLKIQATDNGSPPRFSDVTIITVKISTAE 2530
            V  I+ D+ND  PKF   E    V E   +G  +   TA DEDL    Y+ + S    D +  F +  +   +  + V   LD E++    ++L + A DG   +     +++I++ D+NDN PI  Q+   + IKE+TP+GS +    A+DAD G+  ++ + +           F   F T      G++  +  L+ +    +   V A D  G   +S+   ++I + D N++ P+ S     +  + E++P  + +  V A D D+  N K+T  L+ +      ++    +       +   +  +REL + +T+ +   D G PP  S     + V +IN+ PP F HS Y   +SED  I + +++++A+ ++ ++ +  +  L  + +  F ID   G +      D E    Y + V  +D     + + +          ++            + EN  +   G  + ++   D D+  NA +   +       N     +++  +  I        V   +DRE++  Y+L +   D G+P +    ++ + V D NDNSP +   N  T     V +E++L N  +I ++  D DA  N +   +  ++ D +          L  NG I    D+  S G Y L++   DNG PP+ ++V+ ITVKI+ ++
Sbjct: 2849 VRAIVLDVNDTPPKFSQSEFMASVKEDALIGQSVTTITATDEDLNTELYYFILS---GDPQARFGIERK---TGVIFVHGSLDRESVGS--YDLNISASDG---LFTSFAQMKIDIEDANDNPPICTQSIYVEHIKENTPLGSTVLTVGATDADVGVNAELTYSV-----------FGQGFGTFAVDKNGKMTNLVELDRETRPFYNFMVSAADIGGQACYSN---ISIHLDDVNDNRPLFSQSSYFT-AVYEDAPLKKVLLQVKADDADVGVNRKLTYSLVTDAGGTFTIETGTGI-------ISLEKPLNRELKENYTLNVEVMDGGTPPLSSIATVQIKVLNINDVPPEFSHSIYHGNVSEDAPIGNEVVRVRAVSRESSNDVITYAILRGADSGLFSIDRKNGTIHVNRKLDYETTKLYTLTVEASDAGPPVLRSTSYVRISVTDSNDNGPEFSEKRYSAKVDENSAL---GTFVLQVFATDRDSGTNAQIKYSIAE----GNDAKKFKIVEETGVIK-------VSGDIDREEVASYRLKVRAQDQGLPPQVADTVVDIEVTDVNDNSPEFSSTNLTT-----VLSESSLPNAAVIHLRPHDRDALGNGAPYQFTLISGDASRFK-------LHSNGLITKIGDVSHSDGQYRLRVLVADNGHPPQSTEVS-ITVKIAESK 3474          

HSP 3 Score: 112.464 bits (280), Expect = 8.517e-25
Identity = 159/655 (24.27%), Postives = 279/655 (42.60%), Query Frame = 2
Query:  539 NDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVL--------LKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESGTYYLKIQATDNGSP 2479
            N + P F + ++ I +SES  +   +    A DED  Y G+  Y++ + +   S+    MF+  L V   LD E IS    N++ + C  G   +     L +++TD ND +P+FD+T     + E+  +G  +   +ASD D G  G I ++++     K    F +N  +G + +   L+ +    + ++++A D +          + + + D N+++PI+    + ++T+ E+      V  + ASD D    G++   L        + + S  + L +  + + +  Y L T RV D+     FT +    +  +    S      S G I E             I+E+  + + +I  KA D+D  +     +D +  DKF ID + G ++     D EV   Y + V   D     + T    +   V   ++           V+ EN   L  G+ + ++  +D D+  +      LL   +   +        ++F ID     +     LDRE   +YKL +  SD G P  S     TV + DENDN P   ++  Q    V     T+ +  +  V ATD D   N+++ Y+    +      +  F I +R+G IF +  L +  +Y L I A DNG P
Sbjct:  680 NRHHPVFRSHDQNIHISESTPIATVVSQFMATDEDKGYNGLVLYSIVEGD-VDSVFNINMFTGELTVAMPLDRETISSYTLNISAVDC--GKHRKSAYTILNVKITDVNDCSPVFDKTVYEVTLPENITVGQTVTHVHASDKDQGTNGFITYQIVNDFGGK----FRVNRISGVVSVGDYLDYEEQEMYKIEIQAMDSSVDNQKVGSTHVIVTLLDINDNSPIVKP-KKFNVTVQEDLLVNAVVTSIHASDPDSGPGGEIEFSLPESTRKFNIDSKSGVIRLRQRLDFEQKSTYNL-TVRVTDKGSPALFTDVEVVVNVLDVNENSLAPV-FSGGRILE-----------TSINENSPVGTVVISPKATDQDSWYLKYAIIDGTGVDKFIIDPDTGAIRTAGELDHEVADHYWLTVQAKDGESYPLYTNIPVLINIVDLNDEAPYFAPSTYYPVLAEN---LPSGSSVVQVTAKDPDSGGS------LLRYTITKGNE------QNNFVIDPQSGLITTLRPLDREFKSEYKLTVSASDGGTPPVSTDVTFTVKITDENDNQP--EFKEKQYVVGVFARQATSKSFGLYQVVATDEDIGSNADLRYSITKGN-----RDNKFIIDSRSGEIFTNVSLVDGESYDLTIVAEDNGLP 1291          

HSP 4 Score: 106.301 bits (264), Expect = 5.329e-23
Identity = 151/675 (22.37%), Postives = 294/675 (43.56%), Query Frame = 2
Query:  512 KVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDED------LEYF-----GVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIK-ALDKDKTHSLNYHLDPSVND----KFQIDINKGILKNIVHFDREVIPKYIV----PVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFM--SRDLQESGTYYLKIQATDN 2470
            +V +++ D NDN P+F        +  S + G  +    A D D      L Y      G Q + + DS+     L R      +V +K+        + + L +   D    V     K+++ + D+ND++PIF +        E+ P G+ + + +A+D DSG +  + + +      +    F ++ ++G L      + +  S+ I+ V  R  +G G F   C + + + DEN++ PI  L + ++ TI  +   G  V M  ASD D   N  +T V++ + +  +    + N    +I     +R  + +  ++F ++   +D GNP  RS     ++V + +     F  S Y + + E+ E+   +  +   +       ++Y +    ND    KF +D + G ++ I   D E+  +Y++     V   +Q+  T++         VT    + P +  I      EN+ I   G+ +  +  +DLD+  N  V   L+S           +L+   F+ID++   +  + +LDRE+   ++  +  +D G  + +++  +  +V D ND  P +    +Q+ +  +V  +  +   +  + ATD D   N+ + Y  ++ D      +  F I  + G IF+  S D +  G+Y L I A+D 
Sbjct: 2327 RVRVVLMDANDNAPRFDKSMYAASILGSASPGQFVTRILATDPDEGDAKKLRYSITGGQGRQHFQI-DSQSGVITLSR------VVGIKQ-------GKVYGLDVEVSDS---VHVSTSKVRVIIGDTNDHSPIFSEDVYKVSFNENYPEGTFVTMVSATDLDSGNYAHLTYSIDSVDAMRK---FRIDADSGMLYSRLMFDRENSSQAIMSVPIRATDGGGRFGF-CVVEVHLIDENDNQPIFELKNYDT-TISRSVTMGTPVLMTSASDPDASSNAALTYVIVGHQTPPVF---TINAATGVIQ---VSREPEVKSYNFFVLV---KDGGNPLLRSIASVKITVLERDARILHFGKSKYDVTVGENAEMGQIVTGLNLVVPGGNPVDVDYRIIKGNNDNNDRKFGVD-STGRVRVIGRLDYEIRNRYVMIVEANVSAINQIARTVVVVQVLDINDVTPKFVSDPYLASIP-----ENIDI---GSKVLRVFAEDLDSGSNGMVTYALVSKD---------KLVKEKFDIDQHTGWITTRGALDREKQPSFEFQVRATDNGTTRLTSLTTVRAIVLDVNDTPPKF----SQSEFMASVKEDALIGQSVTTITATDEDL--NTELYYFILSGDP-----QARFGIERKTGVIFVHGSLDRESVGSYDLNISASDG 2941          

HSP 5 Score: 105.531 bits (262), Expect = 1.149e-22
Identity = 169/677 (24.96%), Postives = 283/677 (41.80%), Query Frame = 2
Query:  515 VFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNN--PIFDQTQNYKF-IKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNY--SIFISEDIEINSALIQIKALDKD--KTHSLNYHLDPSVND-KFQIDINKG-ILKNIVHFDREVIPKYIVPVFVTDQV--RXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFV--IRENVQILTYGNLIGELQTQDLDN-SYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISD----LGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPR 2485
            V + + DINDN P    K+  + V E + V   +    A D D    G   ++L +S   F++  +   S  + + ++LDFE  S   +NLT+   D G+P      ++ + V D N+N+  P+F   +  +  I E++P+G+V+    A+D DS     + + ++          F ++ +TG +     L+ ++   + L V+A+D     P  +   + I + D N+ AP  +      + + EN P+G  V  V A D D   +     +   N+ N   +D    +       + T R  DRE    + + +S  D G PP  +   F V + D N+  P F    Y   +F  +    +  L Q+ A D+D      L Y +     D KF ID   G I  N+   D E    Y + +   D    + +  T      I     + N PV    KQ+   I+E+ +I ++  +IG  +  D D  +YN              NH        + F ID+Y   + V  SLDRE+   Y L +  +D      +P       +T+ + D NDNSP    Q  +  Y+ +V   +++   +  V+  D DA  N  + Y  V            F I + +G I   +  D +    + L I+A+D G P R
Sbjct:  882 VIVTLLDINDNSPIVKPKKFNVTVQEDLLVNAVVTSIHASDPDSGPGGEIEFSLPESTRKFNIDSK---SGVIRLRQRLDFEQKS--TYNLTVRVTDKGSPALFTDVEVVVNVLDVNENSLAPVFSGGRILETSINENSPVGTVVISPKATDQDSWY---LKYAIIDGTGVDK---FIIDPDTGAIRTAGELDHEVADHYWLTVQAKDGESY-PLYTNIPVLINIVDLNDEAPYFAPSTYYPV-LAENLPSGSSVVQVTAKDPDSGGSLLRYTITKGNEQNNFVIDPQSGL-------ITTLRPLDREFKSEYKLTVSASDGGTPPVSTDVTFTVKITDENDNQPEFKEKQYVVGVFARQATSKSFGLYQVVATDEDIGSNADLRYSITKGNRDNKFIIDSRSGEIFTNVSLVDGE---SYDLTIVAEDNGLPKLSTSTNVLIDVIQGNKPSKNAPVFWN-KQYSADIQEDKRINSFVLIIGA-EDPDFDQITYNIAS----------GNH-------GNKFTIDRYGGFITVAHSLDREEKSFYSLRVEATDGYNTASVP-------VTINILDVNDNSP----QPARREYRAHVAENSDVGTLVTTVK--DPDAGVNGEVEYCIVQ--TAKAESASLFKIESHSGRILTVKPLDYETMQEHVLTIKASDRGIPKR 1501          

HSP 6 Score: 104.76 bits (260), Expect = 1.827e-22
Identity = 181/734 (24.66%), Postives = 299/734 (40.74%), Query Frame = 2
Query:  344 YKIYTTDIDSNLTKLDFKGHLLVNKRIDREFLCP---NVDKIDDCQLELMIHAFPDHWIKVFII----IEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQ-----IEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNH-APILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMK---DEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDK--FQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNL-IGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSL-DREQIDKYKLNIIISDLGIPKRS---NMEIITVMVEDENDNSPI-WRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFV-NNDVNSLWYEKYFTILTRNGGIFMSRDLQESGTYYLKIQATDN 2470
            Y I   D+DS      F G L V   +DRE +     N+  +D C           H    + I    I D+ND  P F      + + E+I VG  +    A D+D    G  +Y + +   F         S  + V   LD+E      + + + A D       D QK+      + + D NDN+PI    +    ++E   + +V+   +ASD DSG  G+I F  LP  T K    FN++  +G + L   L+ +  S + L V   D+     F+    +   +    N  AP+ S G     +I ENSP G  V    A+D D           LK    Y  +D +   K   D     + T    D E+ D++ + +  +D  + P  +     +++ D+N+  P F  S Y   ++E++   S+++Q+ A D D   SL  +     N++  F ID   G++  +   DRE   +Y + V  +D     + T  T       + ++        KQ+V+    +  T  +  + ++   D D   NA    DL       N        ++ F ID     +F   SL D E    Y L I+  D G+PK S   N+ I  +     + N+P+ W  Q     Y  ++  +  +N  ++++ A D D  +   I+YN    N  N    ++Y   +T    +  S D +E   Y L+++ATD 
Sbjct:  723 YSIVEGDVDSVFNINMFTGELTVAMPLDRETISSYTLNISAVD-CG---------KHRKSAYTILNVKITDVNDCSPVFDKTVYEVTLPENITVGQTVTHVHASDKDQGTNGFITYQIVND--FGGKFRVNRISGVVSVGDYLDYEE--QEMYKIEIQAMDS----SVDNQKVGSTHVIVTLLDINDNSPIVKPKKFNVTVQEDLLVNAVVTSIHASDPDSGPGGEIEFS-LPESTRK----FNIDSKSGVIRLRQRLDFEQKSTYNLTVRVTDKGSPALFTDVEVVVNVLDVNENSLAPVFSGGRILETSINENSPVGTVVISPKATDQD--------SWYLK----YAIIDGTGVDKFIIDPDTGAIRTAGELDHEVADHYWLTVQAKDGESYPLYTNIPVLINIVDLNDEAPYFAPSTYYPVLAENLPSGSSVVQVTAKDPDSGGSLLRYTITKGNEQNNFVIDPQSGLITTLRPLDREFKSEYKLTVSASDGGTPPVSTDVTFTVKITDENDNQPEFKE--KQYVVGVFARQATSKSFGLYQVVATDEDIGSNA----DLRYSITKGNR-------DNKFIIDSRSGEIFTNVSLVDGES---YDLTIVAEDNGLPKLSTSTNVLIDVIQGNKPSKNAPVFWNKQ-----YSADIQEDKRINSFVLIIGAEDPDFDQ---ITYNIASGNHGNKFTIDRYGGFIT----VAHSLDREEKSFYSLRVEATDG 1393          

HSP 7 Score: 94.7449 bits (234), Expect = 2.111e-19
Identity = 159/657 (24.20%), Postives = 276/657 (42.01%), Query Frame = 2
Query:  617 PLQTAMDEDLEYFGVQSYNLED-------SEPFFSLLYRPMFSLTLVVLK---KLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSL-NAKIVSKFILDVEARDENGVGPFSSQ-CQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIAS----DGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEI-IYRLVTTRVFDRELLDY-FTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLN-YHLDPSVND--KFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGI----------KQFVIRENV-QILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQ--IDKYKLNIIISDLGIPKRSNMEIITVM-VEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDID---AKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQE-SGTYYLKIQATDN 2470
            P+ T +  DL+  GV S N  D        +  FS+  R +     + +K   +L+ E+++   + L ++  D  T    D+ K+ I V DSNDN PIF + +  K I E  P+ + I    A DAD G  G I +      T+     F +N  +G + +   L N+  + +  +    R      P SS+ CQL + VQ  N  +P  S+      T ++N   G   G+V A+    D D   NG +  V + + +    LD + ++K     Y +   +  DREL  + + + ++  D G P      +  V+V D N+  P F  S Y   +SE   I++ ++++ A DKD   + N  ++    N+  KF+I+   G +      D E   ++ + V   D V               +      PV+  I          K    R+++ + LT G  +  +  +DLD+  N  V              S   L    FEI+     +   ++LDR+    +   L +  SD G P R   E +  M V++ NDN+P+ +       ++ N+  + N    +++   T ID   + K+ ++ Y     +       K F++  + G +  +R L+     + L I+ATD 
Sbjct:   10 PIGTPVKCDLK-MGVYSKNHVDFIIISGNEQGMFSVDSRQVSDFNFMDIKTSKRLNRESVAS--YELNVVVQDKRTKRTLDRTKVNITVDDSNDNRPIFLKKKYLKTIPEDIPMHTSIARIEAVDADVGPNGLIYYSFKEKTTS-----FAINPISGVVSVAQKLSNSARIHRLTVVARDRALPPSKPKSSRNCQLIVNVQAVNQFSPEFSV-----KTQLQNVSEGTS-GIVYATLGIIDKDKGSNGDIDRVEITSGN----LDGAFSIKSSPNDYAVQVIKPLDRELAPFGYNVTLTAYDKGTPVRNGSYVLRVNVLDENDNNPEFNQSRYITNLSELAPIHTPVLRVLATDKDAGSNGNIMYVITRGNELGKFEINSKTGQIYTKGDLDYESRQRFDLTVAALDGV------------PLQSRKISTVPVVVNILDANDHDPEFKAPEYRKDLYEDLTPGTSVFTVSAEDLDSGGNGKV------------RYSLANLRPVPFEIEPDTGIIRTTTNLDRDTGLPEFINLQVRASDFGTPLRRETETLVKMRVKEMNDNAPVLK------QFKCNILVDRNAPVGVLITTVTAIDIDISDKDQSLMYKSTFGNTG-----KAFSLDPKTGELRTARSLRGLQREFTLIIKATDG 613          

HSP 8 Score: 92.4337 bits (228), Expect = 9.006e-19
Identity = 142/601 (23.63%), Postives = 262/601 (43.59%), Query Frame = 2
Query:  737 VLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNY-LALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKT--HSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQF-VIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTIITVKIS 2521
            V+ +LD+E I +RY  + ++  +     Q  +  + ++V D ND  P F        I E+  IGS +    A D DSG  G + + L+ ++    K  F+++ +TG +    +L+ +    F   V A D NG    +S   +   V D N+  P  S  +  + ++ E++  G+ V  + A+D DL  N ++   +L  D      ++R    K  +I+        DRE +  + + IS  D       SF    + + D N+ PP    S Y   I E+  + S ++ + A D D      L Y +       F +D N G + N+V  DRE  P Y    F+            + + I + DVNDN P+ +    F  + E+  +     ++ +++  D D   N  +              S +     +F I+     + ++  L+RE  + Y LN+ + D G P  S++  + + V + ND  P + +    + Y  NV+ +  + + ++ V+A   ++  N  I+Y  +    + L     F+I  +NG I ++R  D + +  Y L ++A+D G PP     + + + ++
Sbjct: 2711 VIGRLDYE-IRNRY--VMIVEANVSAINQIARTVVVVQVLDINDVTPKFVSDPYLASIPENIDIGSKVLRVFAEDLDSGSNGMVTYALV-SKDKLVKEKFDIDQHTGWITTRGALDREKQPSFEFQVRATD-NGTTRLTSLTTVRAIVLDVNDTPPKFSQSEFMA-SVKEDALIGQSVTTITATDEDL--NTELYYFILSGDPQARFGIER----KTGVIF---VHGSLDRESVGSYDLNISASD---GLFTSFAQMKIDIEDANDNPPICTQSIYVEHIKENTPLGSTVLTVGATDADVGVNAELTYSVFGQGFGTFAVDKN-GKMTNLVELDRETRPFY---NFMVSAADIGGQACYSNISIHLDDVNDNRPLFSQSSYFTAVYEDAPLK---KVLLQVKADDADVGVNRKLT------------YSLVTDAGGTFTIETGTGIISLEKPLNRELKENYTLNVEVMDGGTPPLSSIATVQIKVLNINDVPPEFSH----SIYHGNVSEDAPIGNEVVRVRAVSRES-SNDVITYAILRGADSGL-----FSIDRKNGTIHVNRKLDYETTKLYTLTVEASDAG-PPVLRSTSYVRISVT 3263          

HSP 9 Score: 91.2781 bits (225), Expect = 2.375e-18
Identity = 159/684 (23.25%), Postives = 281/684 (41.08%), Query Frame = 2
Query:  539 NDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDED------LEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDS-NYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTH--SLNY----HLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGN-----LIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSW-IRLL-------NHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFM--SRDLQESGTYYLKIQATDNGSPPRFSDVTII 2506
            ND  P F        +SES  V   +    A+D D      + YF +Q  N+     FF +  +   S  + V K LD+E  S     + ++A D G P    + ++++ + D+NDN P FD++     I  S   G  +    A+D D G   K+ + +      + + +F ++  +G + L   +  K    + LDVE  D   V    S  ++ + + D N+H+PI S  D   ++  EN P G  V MV A+D D  +   +T  +   D+     +D    M       L +  +FDRE      + +  +         F +  V + D N+  P F   NY   IS  + + + ++   A D D +   +L Y    H  P V   F I+   G+++  V  + EV   Y   V V D     + +                  +  +K  V+  + +IL +G       +GE       N+    +V  L  V    N +    R++       +  F +D     + V   LD E  ++Y + I+ +++    +    ++ V V D ND +P +        Y  ++    ++   ++ V A D+D+  N  ++Y  V+ D   L  EK F I    G I    + D ++  ++  +++ATDNG+  R + +T +
Sbjct: 2230 NDVAPAFNRSLYLATISESTPVDTAVVTVKAIDGDSGINKEINYF-IQ--NVSRVGAFFKIDKK---SGVVFVAKSLDYE--SRVVHEMIIVAADEGKPSLTGETRVRVVLMDANDNAPRFDKSMYAASILGSASPGQFVTRILATDPDEGDAKKLRYSITGG---QGRQHFQIDSQSGVITLSRVVGIKQGKVYGLDVEVSDSVHV----STSKVRVIIGDTNDHSPIFSE-DVYKVSFNENYPEGTFVTMVSATDLDSGNYAHLTYSIDSVDAMRKFRIDADSGM-------LYSRLMFDRENSSQAIMSVPIRATDGGGRFGFCVVEVHLIDENDNQPIFELKNYDTTISRSVTMGTPVLMTSASDPDASSNAALTYVIVGHQTPPV---FTINAATGVIQ--VSREPEV-KSYNFFVLVKDGGNPLLRS------------------IASVKITVLERDARILHFGKSKYDVTVGE-------NAEMGQIVTGLNLVVPGGNPVDVDYRIIKGNNDNNDRKFGVDS-TGRVRVIGRLDYEIRNRYVM-IVEANVSAINQIARTVVVVQVLDINDVTPKFV----SDPYLASIPENIDIGSKVLRVFAEDLDSGSNGMVTYALVSKD--KLVKEK-FDIDQHTGWITTRGALDREKQPSFEFQVRATDNGT-TRLTSLTTV 2849          

HSP 10 Score: 89.3521 bits (220), Expect = 8.484e-18
Identity = 165/736 (22.42%), Postives = 293/736 (39.81%), Query Frame = 2
Query:  509 IKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKL-QIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNA-----SDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGP-----------------------FSSQC------QLTIRVQDE------------------NNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHS--LNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIK-QFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNS--PIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKY----------FTILTRNGGIFMSRDL--QESGTYYLKIQATDNGSPPRFSDVTII 2506
            + V + I D ND+ P+F   E R  + E +  G  +   +A D D    G   Y+L +  P       P   + +     LD +     + NL + A D GTP++ + + L ++ V + NDN P+  Q +    +  + P+G +I    A     SD D  L  K  F      T K    F+L+  TGEL    SL   +  +F L ++A D     P                        S++C         ++++ E                  N H P+    D +++ I E++P    V   +A+D D   NG V   +++ D     +D   N+ +     L      DRE +  +T+ IS  D G     ++ + NV + D+N+  P F  + Y + + E+I +   +  + A DKD+  +  + Y +      KF+++   G++    + D E    Y + +   D        G+T V +T+ D+NDN+P++   K    ++E+   L    ++  +   D D+     +   L                   F ID     + ++  LD EQ   Y L + ++D G P       + V V D N+NS  P++   +     + ++   + +   +I  +ATD D+                  WY KY          F I    G I  + +L  + +  Y+L +QA D  S P ++++ ++
Sbjct:  410 VPVVVNILDANDHDPEFKAPEYRKDLYEDLTPGTSVFTVSAEDLDSGGNGKVRYSLANLRP-VPFEIEPDTGI-IRTTTNLDRDTGLPEFINLQVRASDFGTPLRRETETLVKMRVKEMNDNAPVLKQFKCNILVDRNAPVGVLITTVTAIDIDISDKDQSLMYKSTF----GNTGK---AFSLDPKTGELRTARSLRG-LQREFTLIIKATDGIQESPDTHPVILKISIVGGRQARKLQNHVSTKCVDSPLYAKALKIKQEQKSYSSLQPLIFATAKLHNRHHPVFRSHD-QNIHISESTPIATVVSQFMATDEDKGYNGLVLYSIVEGD-----VDSVFNI-NMFTGELTVAMPLDRETISSYTLNISAVDCGKHRKSAYTILNVKITDVNDCSPVFDKTVYEVTLPENITVGQTVTHVHASDKDQGTNGFITYQIVNDFGGKFRVNRISGVVSVGDYLDYEEQEMYKIEIQAMDSSVDNQKVGSTHVIVTLLDINDNSPIVKPKKFNVTVQED---LLVNAVVTSIHASDPDSGPGGEIEFSLPES-------------TRKFNIDSKSGVIRLRQRLDFEQKSTYNLTVRVTDKGSPALFTDVEVVVNVLDVNENSLAPVF---SGGRILETSINENSPVGTVVISPKATDQDS------------------WYLKYAIIDGTGVDKFIIDPDTGAIRTAGELDHEVADHYWLTVQAKDGESYPLYTNIPVL 1091          

HSP 11 Score: 87.8113 bits (216), Expect = 2.275e-17
Identity = 108/416 (25.96%), Postives = 181/416 (43.51%), Query Frame = 2
Query:  512 KVFIIIEDINDNKPKFPTKEKRIKVSESI-----AVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKV-YFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQ----CQLTIRVQDENNHAPILSLGD-RESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQ-LFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALD---KDKTHSLNYHLD-PSVNDKFQIDINKGILK 1711
            ++ + ++ +N   P+F  K +   VSE       A    +      + D++   + S NL+ +   FS+   P     + V+K LD E ++   +N+TL A D GTPV+     L++ V D NDNNP F+Q++    + E  PI + +    A+D D+G  G I + +    T  N++  F +N  TG++     L+ +   +F L V A D  GV P  S+      + + + D N+H P     + R+ L   E+   G  V  V A D D   NGKV   L         ++      D  I R  T    D  L ++  + +   D+G P  R  + L  + V ++N+  P       +I +  +  +   +  + A+D    DK  SL Y     +    F +D   G L+
Sbjct:  196 QLIVNVQAVNQFSPEFSVKTQLQNVSEGTSGIVYATLGIIDKDKGSNGDIDRVEITSGNLDGA---FSIKSSPN-DYAVQVIKPLDRE-LAPFGYNVTLTAYDKGTPVRNGSYVLRVNVLDENDNNPEFNQSRYITNLSELAPIHTPVLRVLATDKDAGSNGNIMYVI----TRGNELGKFEINSKTGQIYTKGDLDYESRQRFDLTVAALD--GV-PLQSRKISTVPVVVNILDANDHDPEFKAPEYRKDL--YEDLTPGTSVFTVSAEDLDSGGNGKVRYSLANLRPVPFEIE-----PDTGIIRTTTNLDRDTGLPEFINLQVRASDFGTPLRRETETLVKMRVKEMNDNAPVLKQFKCNILVDRNAPVGVLITTVTAIDIDISDKDQSLMYKSTFGNTGKAFSLDPKTGELR 592          

HSP 12 Score: 86.2705 bits (212), Expect = 7.160e-17
Identity = 183/769 (23.80%), Postives = 305/769 (39.66%), Query Frame = 2
Query:  521 IIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQ--TAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSND---NNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRE-SLTIMENSPAGEHVGMVIASDGDLEDNGKVT-CVL--LKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDK-DKTHS-LNYHL-DPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFV-IRENVQILTYGNLIGEL---QTQDLDNSYNATVVCDLLSVH--VLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIW---RYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSP--PRFSDVTIITVKI---------STAEKTNYLIKNSQISFTLIVVT---SLASFSICVAL----------MVGII------LMWRKSYPIQL 2668
            + I D NDN+P+F  K+  + V    A      L    A DED+       Y++         +           +  +D E+     ++LT++A D G P       + I+V   N    N P+F   Q    I+E   I S + I  A D D   F +I + +       NK  F ++   G + +  SL+ +  S + L VEA D    G  ++   +TI + D N+++P      RE    + ENS  G  V  V   D D   NG+V  C++   K +S  L    SH+       R++T +  D E +    + I   D G P   +     VSV D+N+  P F    +   +    +  +A++++ A DK D T+S L Y +   + N    +D N G++K +      ++ +Y + V  TD                        P+ T +   V +R  V+   +     E+   +    D +    V   +L V+  V      W       F + +    +  K S D E++   KL I  +       S + I+T  ++D+NDN PI+   R   + T      TA  +     ++  ATD D   +  ++Y  V      +     F+I    G I  ++  D + +  Y  KI+ TD+G+P    F+DV I    I         ST   T YL   +    T++  T   S A+ +  +A           + G++      L+ R +Y I+L
Sbjct: 1196 VKITDENDNQPEFKEKQYVVGVFARQATSKSFGLYQVVATDEDIGSNADLRYSITKGNRDNKFIIDSRSGEIFTNVSLVDGES-----YDLTIVAEDNGLPKLSTSTNVLIDVIQGNKPSKNAPVFWNKQYSADIQEDKRINSFVLIIGAEDPD---FDQITYNIASG-NHGNK--FTIDRYGGFITVAHSLDREEKSFYSLRVEATD----GYNTASVPVTINILDVNDNSP--QPARREYRAHVAENSDVGTLVTTV--KDPDAGVNGEVEYCIVQTAKAESASLFKIESHSG------RILTVKPLDYETMQEHVLTIKASDRGIPKRETLFSVVVSVDDVNDHKPEFLSPLFESEVDVSAKAGTAILRVIATDKDDGTNSKLKYSIVSGNTNKSLSVDQNSGVVK-VAGRLSTLVHQYALKVQSTDG--------------------GEPPLKTQVDVKVKVRGIVKNFAFEKPKYEVSLPENSPPDQAIATVVYNGILPVYEIVPGRSPCW-----RDFTVQRQSGVIISKKSFDAEEVTHCKLEIRANSTDGQHSSTLVIVT--IQDKNDNQPIFEHARITGHVTEGSPQGTAVLDHKGSQLVAVATDQDISGD-KLTYEIVETSARDV-----FSIHPATGAITTAKVLDYEVTPQYAFKIKVTDSGNPRLSAFADVKIHVTDINDIAPVFSASTYHATVYLPSYAGTRVTMVTATDGDSAANLTFSLARQDTELFAVNPLTGVVTVSNAALLRRDTYTIKL 1905          

HSP 13 Score: 78.9518 bits (193), Expect = 1.365e-14
Identity = 109/435 (25.06%), Postives = 192/435 (44.14%), Query Frame = 2
Query:  722 SLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASD-----ADSGLFG-KINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELL--DYFTIMISCQDYGNPPHRSFQLF--NVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHL-DPSVNDKFQIDINKGILKNIVHFD--REVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQI-LTYGNLIGELQTQDLDNSYNATVVCDLLS 1984
            S  ++  K  D E ++H    +   + DG    Q     + + + D NDN PIF+  +    + E +P G+ +     S       D  + G K+ ++++    T  +  F+++  TG +     L+ ++  ++   ++  D +G    S+   + I V D N+ AP+ S     + T+   S AG  V MV A+DGD   N  +T  L + D+   A++         +  +VT  V +  LL  D +TI ++  D  +  H   ++   N+   D+      F   NYS  + E + ++S L+ ++AL      ++ Y + +PS  + F I  + G++     FD  RE I  Y V V   D            V++ V D NDN PV      F++   +Q+ +  G +IG+ Q  D D   NA +  DL+ 
Sbjct: 1674 SGVIISKKSFDAEEVTHCKLEIRANSTDG----QHSSTLVIVTIQDKNDNQPIFEHARITGHVTEGSPQGTAVLDHKGSQLVAVATDQDISGDKLTYEIV---ETSARDVFSIHPATGAITTAKVLDYEVTPQYAFKIKVTD-SGNPRLSAFADVKIHVTDINDIAPVFSASTYHA-TVYLPSYAGTRVTMVTATDGDSAAN--LTFSLARQDTELFAVNP--------LTGVVT--VSNAALLRRDTYTIKLTVSDGNHTAHARVRIRCENLPSSDLQ-----FSRKNYSASVREGVSVDSELVTVRALGYPIGSTITYTIINPS--ELFHIVPSTGVMSIRAGFDLDRESIDAYQVIVQARDD-SVPPNVAQAAVHVQVIDRNDNQPVFINSPYFIV---LQLGVAQGTIIGQAQATDADIGSNANLRYDLIG 2076          

HSP 14 Score: 77.7962 bits (190), Expect = 2.866e-14
Identity = 115/550 (20.91%), Postives = 218/550 (39.64%), Query Frame = 2
Query:  992 FKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAG----EHVG---MVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDKFQIDINKGI--LKNIVHFDREVIPKYIVPVFVTD-------QVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR---DLQESGTYYLKIQATDNGSPPRFSDVTIITVKISTAEKTNYLIKNSQISFTLIVV 2584
            ++++P R+   +  F +   +G ++   S +A+ V+   L++ A   +G     S   + + +QD+N++ PI     R +  + E SP G    +H G   + +A+D D+  +     ++  +  +  ++  +          + T +V D E+   +   I   D GNP   +F    + V DIN+  P F  S Y   +       + +  + A D D   +L + L     + F ++   G+  + N     R+    Y + + V+D       +VR       ++           + V  G+   V  E V +   G  IG   T  + N        +L  +   +  MS    +   F++D             RE ID Y++ +   D  +P       + V V D NDN P++         Q+ V   T +       QATD D   N+N+ Y+ +  D        YF+I  + G + + R   D++    + L ++ATD      F    ++ +K+   E   +     Q+SF+ ++ 
Sbjct: 1655 YEIVPGRSPCWR-DFTVQRQSGVIISKKSFDAEEVTHCKLEIRANSTDGQ---HSSTLVIVTIQDKNDNQPIFEHA-RITGHVTEGSPQGTAVLDHKGSQLVAVATDQDISGDKLTYEIVETSARDVFSIHPATGA-------ITTAKVLDYEVTPQYAFKIKVTDSGNPRLSAFADVKIHVTDINDIAPVFSASTYHATVYLPSYAGTRVTMVTATDGDSAANLTFSLARQDTELFAVNPLTGVVTVSNAALLRRDT---YTIKLTVSDGNHTAHARVRIRCENLPSSDLQFSRKNYSAS-VREGVS--VDSELVTVRALGYPIGSTITYTIINP------SELFHIVPSTGVMS----IRAGFDLD-------------RESIDAYQVIVQARDDSVPPNVAQAAVHVQVIDRNDNQPVFINSPYFIVLQLGVAQGTIIGQ----AQATDADIGSNANLRYDLIGGD------PGYFSISRKTGEVVVRRTLDDVKVPRLFTLMVEATDG----LFRTEAVVKIKVVDKETPVF----DQLSFSKVLA 2145          

HSP 15 Score: 76.6406 bits (187), Expect = 5.720e-14
Identity = 91/377 (24.14%), Postives = 173/377 (45.89%), Query Frame = 2
Query:  515 VFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEP-FFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGK-VTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLD-YFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFIS-EDIEINSALI-QIKALDKD 1630
            V I + +IND  P+F        VSE   +GN++    A+  +     +    L  ++   FS+  +   + T+ V +KLD+E  + + + LT+ A D G PV      ++I VTDSNDN P F + +    + E++ +G+ +    A+D DSG   +I + +      K    F +   TG + +   ++ + V+ + L V A+D+ G+ P  +   + I V D N+++P  S  +  ++ + E+S     V  +   D D   NG      L+  D++   L  +           + T++ D    D  + + +   D G+PP  +     V + +    PP+ +    +++++     +N  +I ++KA DKD
Sbjct: 3154 VQIKVLNINDVPPEFSHSIYHGNVSEDAPIGNEVVRVRAVSRESSNDVITYAILRGADSGLFSIDRK---NGTIHVNRKLDYE--TTKLYTLTVEASDAGPPVLRSTSYVRISVTDSNDNGPEFSEKRYSAKVDENSALGTFVLQVFATDRDSGTNAQIKYSIAEGNDAKK---FKIVEETGVIKVSGDIDREEVASYRLKVRAQDQ-GLPPQVADTVVDIEVTDVNDNSPEFSSTNLTTV-LSESSLPNAAVIHLRPHDRDALGNGAPYQFTLISGDASRFKLHSNG----------LITKIGDVSHSDGQYRLRVLVADNGHPPQSTEVSITVKIAESKTHPPNVHP--LTVYVNLYGSNLNGGVIGRVKATDKD 3508          

HSP 16 Score: 76.6406 bits (187), Expect = 6.770e-14
Identity = 115/501 (22.95%), Postives = 207/501 (41.32%), Query Frame = 2
Query:  332 ENFTYKIYTTDIDSNLTKLDFKGHLLVNKRIDRE---FLCPNVDKIDDCQLELMIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPL----QTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYR----LVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIK-------ALDKD-KTHSLNYHL-DPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTD 1774
            +  TY I + +  +  T   + G + V   +DRE   F    V+  D          +    + V I I D+NDN P+   +E R  V+E+  VG  +         ++ ++EY  VQ+   E +    SL      S  ++ +K LD+E +      LT+ A D G P +     + + V D ND+ P F        +  S   G+ I    A+D D G   K+ + ++   T K+    +++ N+G +V +    + +V ++ L V++ D  G  P  +Q  + ++V+    +        +  +++ ENSP  + +  V+        NG +           +   RS   +D  + R    +++ + FD E + +  + I           S  L  V++ D N+  P F H+  +  ++E     +A++  K       A D+D     L Y + + S  D F I    G +      D EV P+Y   + VTD
Sbjct: 1346 DQITYNIASGNHGNKFTIDRYGGFITVAHSLDREEKSFYSLRVEATD---------GYNTASVPVTINILDVNDNSPQPARREYRAHVAENSDVGTLVTTVKDPDAGVNGEVEYCIVQTAKAESA----SLFKIESHSGRILTVKPLDYETMQEHV--LTIKASDRGIPKRETLFSVVVSVDDVNDHKPEFLSPLFESEVDVSAKAGTAILRVIATDKDDGTNSKLKYSIVSGNTNKS---LSVDQNSG-VVKVAGRLSTLVHQYALKVQSTD-GGEPPLKTQVDVKVKVRGIVKNFAFEK--PKYEVSLPENSPPDQAIATVVY-------NGILPVY-------EIVPGRSPCWRDFTVQRQSGVIISKKSFDAEEVTHCKLEIRANSTDG--QHSSTLVIVTIQDKNDNQPIFEHARITGHVTEGSPQGTAVLDHKGSQLVAVATDQDISGDKLTYEIVETSARDVFSIHPATGAITTAKVLDYEVTPQYAFKIKVTD 1808          

HSP 17 Score: 73.9442 bits (180), Expect = 4.583e-13
Identity = 91/383 (23.76%), Postives = 172/383 (44.91%), Query Frame = 2
Query:  668 YNLEDSEPF--FSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLN--AKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRE--SLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNY-HLDPSVND-----KFQIDINKGILKNIVHFDREVIPKYI--VPVFVTD 1774
            Y++   +P   FS+ ++   +  + ++  LD+E  +   + L + A D  T    D           ND  P F+++     I ESTP+ + +    A D DSG+  +IN+ +     ++   +F ++  +G + +  SL+  +++V + I  + A DE G    + + ++ + + D N++AP     D+   + +I+ ++  G+ V  ++A+D D  D  K+   +           R H   D     +  +RV   +    + + +   D     H S     V +GD N+  P F    Y +  +E+    + +  + A D D   S NY HL  S++      KF+ID + G+L + + FDRE   + I  VP+  TD
Sbjct: 2169 YSITGGDPVNQFSIDFK---TGVVTLVSSLDYE--TRTKYKLVVRATDARTSSHSDVAVDVTVTD-VNDVAPAFNRSLYLATISESTPVDTAVVTVKAIDGDSGINKEINYFI--QNVSRVGAFFKIDKKSGVVFVAKSLDYESRVVHEMI--IVAADE-GKPSLTGETRVRVVLMDANDNAPRF---DKSMYAASILGSASPGQFVTRILATDPDEGDAKKLRYSITGGQG------RQHFQIDSQSGVITLSRVVGIKQGKVYGLDVEVSD---SVHVSTSKVRVIIGDTNDHSPIFSEDVYKVSFNENYPEGTFVTMVSATDLD---SGNYAHLTYSIDSVDAMRKFRIDADSGMLYSRLMFDRENSSQAIMSVPIRATD 2525          

HSP 18 Score: 73.1738 bits (178), Expect = 8.127e-13
Identity = 95/406 (23.40%), Postives = 184/406 (45.32%), Query Frame = 2
Query:  512 KVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSL-NAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLT--IMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKT--HSLNYHLD--PSVNDKFQIDINKGIL 1708
            +V I  E++  +  +F  K     V E ++V ++L    A+   +      +Y + +    F ++  P   + + +    D +  S   + + + A D   P    +  + ++V D NDN P+F  +  +  ++     G++I    A+DAD G    + + L+      +  YF+++  TGE+V+  +L + K+   F L VEA D    G F ++  + I+V D+    P+    D+ S +  + E++P G  V  V A   +    G +  +   +  N  ++D     K  ++  LV++   D E    + +++   D     H S    +V+V D+N+  P+F  S Y   ISE   +++A++ +KA+D D      +NY +     V   F+ID   G++
Sbjct: 1917 RVRIRCENLPSSDLQFSRKNYSASVREGVSVDSELVTVRALGYPIG--STITYTIINPSELFHIV--PSTGV-MSIRAGFDLDRESIDAYQVIVQARDDSVPPNVAQAAVHVQVIDRNDNQPVFINSPYFIVLQLGVAQGTIIGQAQATDADIGSNANLRYDLIGG----DPGYFSISRKTGEVVVRRTLDDVKVPRLFTLMVEATD----GLFRTEAVVKIKVVDK--ETPVF---DQLSFSKVLAEDTPIGSEVTSVTARSPN--GAGILYSITGGDPVNQFSID----FKTGVV-TLVSS--LDYETRTKYKLVVRATDARTSSH-SDVAVDVTVTDVNDVAPAFNRSLYLATISESTPVDTAVVTVKAIDGDSGINKEINYFIQNVSRVGAFFKIDKKSGVV 2294          

HSP 19 Score: 70.4774 bits (171), Expect = 4.309e-12
Identity = 157/704 (22.30%), Postives = 284/704 (40.34%), Query Frame = 2
Query:  446 NVDKIDDCQLELMIHAFPDHWIKVFII--IEDINDNKPKFPTKEKRIKVSES----IAV----GNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSL-----TLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSK--FILDVEARDENGVGPFSSQCQLTIRVQDENNHAPIL-------SLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSP 2479
            + +++  C+LE+  ++         +I  I+D NDN+P F        V+E      AV    G+QL +  A D+D+    +    +E S        R +FS+      +   K LD+E      F + +   D G P       ++I VTD ND  P+F  +  +  +   +  G+ + +  A+D DS     + F L  AR  ++   F +N  TG   ++T  NA ++ +  + + +   D N            +R++ EN  +  L       S   RE +++         +G  I S         +T  ++     +  +  +  M     + L      DRE +D + +++  +D   PP+ +    +V V D N+  P F +S Y I +   +   + + Q +A D D   + N   D    D     I++   + +V   R  +    VP   T  V  T     T   + +  V+  TPV      F      ++L     IG   T     S N   +   ++     N           F ID     + + SSLD E   KYKL +  +D      S++ +   + +  ND +P +    N++ Y   ++  T ++  ++ V+A D D+  N  I+Y F+ N V+ +    +F I  ++G +F+++  D +    + + I A D G P
Sbjct: 1684 DAEEVTHCKLEIRANSTDGQHSSTLVIVTIQDKNDNQPIFEHARITGHVTEGSPQGTAVLDHKGSQL-VAVATDQDISGDKLTYEIVETSA-------RDVFSIHPATGAITTAKVLDYEVTPQYAFKIKV--TDSGNPRLSAFADVKIHVTDINDIAPVFSASTYHATVYLPSYAGTRVTMVTATDGDSA--ANLTFSL--AR--QDTELFAVNPLTG---VVTVSNAALLRRDTYTIKLTVSDGN------HTAHARVRIRCENLPSSDLQFSRKNYSASVREGVSVDSELVTVRALGYPIGS--------TITYTIINPSELFHIVPSTGVMSIRAGFDL------DRESIDAYQVIVQARDDSVPPNVAQAAVHVQVIDRNDNQPVFINSPYFIVLQLGVAQGTIIGQAQATDADIGSNANLRYDLIGGDPGYFSISRKTGEVVV---RRTLDDVKVPRLFTLMVEATDGLFRTEAVVKIKVVDKETPV------FDQLSFSKVLAEDTPIGSEVTSVTARSPNGAGILYSITGGDPVNQ----------FSIDFKTGVVTLVSSLDYETRTKYKLVVRATDARTSSHSDVAVDVTVTD-VNDVAPAF----NRSLYLATISESTPVDTAVVTVKAIDGDSGINKEINY-FIQN-VSRVG--AFFKIDKKSGVVFVAKSLDYESRVVHEMIIVAADEGKP 2320          

HSP 20 Score: 62.003 bits (149), Expect = 2.016e-9
Identity = 94/433 (21.71%), Postives = 179/433 (41.34%), Query Frame = 2
Query:  509 IKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNY--KFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDEN---NHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTC-VLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDK----FQIDINKGILKNIVHFDREVIPKYIVPVFVTDQ 1777
            I V I I D+ND  P F        ++E++  G+ +   TA D D     +  Y +       + +  P   L +  L+ LD E  S   + LT+ A DGGTP         +++TD NDN P F + Q     F +++T     ++   A+D D G    + + +       NK  F ++  +GE+    SL       + L + A D NG+   S+   + I V   N    +AP+     + S  I E+      V ++ A D D +   ++T  +   N  N   +DR           +      DRE   ++++ +   D  N    +     +++ D+N+  P      Y   ++E+ ++ + +  +K  D      + Y +  +   +    F+I+ + G +  +   D E + ++++ +  +D+
Sbjct: 1088 IPVLINIVDLNDEAPYFAPSTYYPVLAENLPSGSSVVQVTAKDPD-SGGSLLRYTITKGNEQNNFVIDPQSGL-ITTLRPLDREFKSE--YKLTVSASDGGTPPVSTDVTFTVKITDENDNQPEFKEKQYVVGVFARQATSKSFGLYQVVATDEDIGSNADLRYSITKG-NRDNK--FIIDSRSGEIFTNVSLVDG--ESYDLTIVAED-NGLPKLSTSTNVLIDVIQGNKPSKNAPVF-WNKQYSADIQEDKRINSFVLIIGAEDPDFD---QITYNIASGNHGNKFTIDRYGGF-------ITVAHSLDREEKSFYSLRVEATDGYN---TASVPVTINILDVNDNSPQPARREYRAHVAENSDVGTLVTTVKDPDAGVNGEVEYCIVQTAKAESASLFKIESHSGRILTVKPLDYETMQEHVLTIKASDR 1496          

HSP 21 Score: 60.077 bits (144), Expect = 7.885e-9
Identity = 100/427 (23.42%), Postives = 170/427 (39.81%), Query Frame = 2
Query: 1325 VLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKD-KTHSLNYHLDPSVNDKFQIDINKGILK--------------NIVHFDREVIP---------KYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVK--SSLDREQID-KYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDL--QESGTYYLKIQATDNGSPPRFSDVTIITVKI 2518
            ++  N+    ++D S  + D     + T++  +RE +  + + +  QD            N++V D N+  P F    Y   I EDI +++++ +I+A+D D   + L Y+        F I+   G++                +V  DR + P         + IV V   +Q                      +P  +   Q    +NV   T G +   L   D D   N     D+  V + S +      L+ +F I     +  V+    LDRE     Y + +   D G P R+   ++ V V DENDN+P +    NQ+ Y  N++    ++ P++ V ATD DA  N NI Y       N L     F I ++ G I+   DL  +    + L + A D G P +   ++ + V +
Sbjct:   33 IISGNEQGMFSVD-SRQVSDFNFMDIKTSKRLNRESVASYELNVVVQDKRTKRTLDRTKVNITVDDSNDNRPIFLKKKYLKTIPEDIPMHTSIARIEAVDADVGPNGLIYYSFKEKTTSFAINPISGVVSVAQKLSNSARIHRLTVVARDRALPPSKPKSSRNCQLIVNVQAVNQF---------------------SPEFSVKTQL---QNVSEGTSGIVYATLGIIDKDKGSNG----DIDRVEITSGN------LDGAFSIKSSPNDYAVQVIKPLDRELAPFGYNVTLTAYDKGTPVRNGSYVLRVNVLDENDNNPEF----NQSRYITNLSELAPIHTPVLRVLATDKDAGSNGNIMYVITRG--NELG---KFEINSKTGQIYTKGDLDYESRQRFDLTVAALD-GVPLQSRKISTVPVVV 414          
BLAST of Protocadherin-1 vs. Ensembl Nematostella
Match: EDO33360 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSF3])

HSP 1 Score: 145.976 bits (367), Expect = 4.566e-37
Identity = 121/427 (28.34%), Postives = 209/427 (48.95%), Query Frame = 2
Query:  521 IIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQK--LQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSN-YLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQ--LFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHS---LNYH-LDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTD 1774
            I I DINDN+PKFP    +I+++E       +    A D D        Y++ ++    +    P   + L   ++LD E ++   + LT+   D G P+    Q   + I V D NDN P+FDQ      I E+  +G+ I + NA D D G+  +I + L  A  +K    F++N  TG++ +  +++ +  S +  +V A D  G    +    + I + D N++ P   L  R  + ++EN   G  V  + ASD D   NGKV   +L+ +S+   ++D++  +       + T +  D E +  +T++I   D G+PP  S Q  + +VSV +IN+  P F    YS  I E+  +   +++++A D+D  +S   L Y  L+ + N  F +D + G+L+     DRE + +Y + + V D
Sbjct:    1 ISILDINDNRPKFPQPYNKIEITEGTRESTMILTLQATDADSGMNAKLVYSILNTTSNGTFTVDPHTGV-LRTSQRLDRETVTE--YTLTITVHDSGDPMLNAAQPAIVSITVLDENDNVPVFDQEVYSVSIPENITVGAHILLLNARDKDEGVNAEIRYFLKDAIVSKR---FSMNDTTGQITIKQAVDYEERSSYSFEVFASD-GGEARLTGSSSVRITIIDVNDNRPYF-LPTRYYVQLVENVAIGTTVTQLTASDLDSSLNGKVLFSILEGNSDGKFSIDQNTGV-------VTTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQPGMLHVSVVNINDNSPVFSQKIYSASIDENTTVGHVILRVQATDRDHVNSSSILVYSILNTTSNGTFTVDPHTGVLRTSQRLDRETVTEYTLTITVHD 412          

HSP 2 Score: 108.997 bits (271), Expect = 6.727e-25
Identity = 117/441 (26.53%), Postives = 197/441 (44.67%), Query Frame = 2
Query:  338 FTYKIYTTDIDSNLTKLDFKGHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFPDHWIK------VFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLT-----LVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQ--CQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMK---DEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVG--DINEFPPSFYHSNYSIFISEDIEINSALI 1606
              Y I  T  +   T     G L  ++R+DRE        + +  L + +H   D  +       V I + D NDN P F  +   + + E+I VG  + L  A D+D        Y L+D+      +    FS+      + + + +D+E  S   F +   A DGG         ++I + D NDN P F  T+ Y  + E+  IG+ +    ASD DS L GK+ F +L   +      F+++ NTG +    SL+ + V+++ L ++A D  G  P +S     L + V + N+++P+ S     S +I EN+  G  +  V A+D D  ++  +          Y  L+ + N     D     L T++  DRE +  +T+ I+  D G+P   + Q   VS+   D N+  P F    YS+ I E+I + + ++
Sbjct:   48 LVYSILNTTSNGTFTVDPHTGVLRTSQRLDRE-------TVTEYTLTITVHDSGDPMLNAAQPAIVSITVLDENDNVPVFDQEVYSVSIPENITVGAHILLLNARDKDEGVNAEIRYFLKDA------IVSKRFSMNDTTGQITIKQAVDYEERSSYSFEV--FASDGGEARLTGSSSVRITIIDVNDNRPYFLPTRYYVQLVENVAIGTTVTQLTASDLDSSLNGKVLFSILEGNSDGK---FSIDQNTGVVTTNKSLDYEDVTEYTLVIQATD-CGDPPLNSSQPGMLHVSVVNINDNSPVFS-QKIYSASIDENTTVGHVILRVQATDRDHVNSSSILV--------YSILNTTSNGTFTVDPHTGVLRTSQRLDRETVTEYTLTITVHDSGDPMLNAAQTATVSITVLDENDNVPVFDQEVYSVSIPENITVGAHIL 460          

HSP 3 Score: 108.997 bits (271), Expect = 7.169e-25
Identity = 129/482 (26.76%), Postives = 227/482 (47.10%), Query Frame = 2
Query:  845 IEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQ---LTIRVQDENNHAPILSLGDRE--SLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYH-----LDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTD-QVRXXXXXXXXXXXXXXXXXXXXXPVMT-GIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIP--KRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNV 2248
            I + D NDN P F Q  N   I E T   ++I    A+DADSG+  K+ + +L   TT N   F ++ +TG L     L+ + V+++ L +   D     P  +  Q   ++I V DEN++ P+    D+E  S++I EN   G H+ ++ A D D   N ++    LK+      + +  +M D    ++   +  D E    ++  +   D G           +++ D+N+  P F  + Y + + E++ I + + Q+ A D D   SLN       L+ + + KF ID N G++      D E + +Y + +  TD        +    ++++V ++NDN+PV +  I    I EN    T G++I  +Q  D D+  +++++     V+ + N  S     N +F +D +   L     LDRE + +Y L I + D G P    +    +++ V DENDN P++    +Q  Y V++
Sbjct:    1 ISILDINDNRPKFPQPYNKIEITEGTRESTMILTLQATDADSGMNAKLVYSIL--NTTSNGT-FTVDPHTGVLRTSQRLDRETVTEYTLTITVHDSGD--PMLNAAQPAIVSITVLDENDNVPVF---DQEVYSVSIPENITVGAHILLLNARDKDEGVNAEIRY-FLKD----AIVSKRFSMND-TTGQITIKQAVDYEERSSYSFEVFASDGGEARLTGSSSVRITIIDVNDNRPYFLPTRYYVQLVENVAIGTTVTQLTASDLDS--SLNGKVLFSILEGNSDGKFSIDQNTGVVTTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQPGMLHVSVVNINDNSPVFSQKIYSASIDENT---TVGHVILRVQATDRDHVNSSSIL-----VYSILNTTS-----NGTFTVDPHTGVLRTSQRLDRETVTEYTLTITVHDSGDPMLNAAQTATVSITVLDENDNVPVF----DQEVYSVSI 449          

HSP 4 Score: 67.3958 bits (163), Expect = 1.973e-11
Identity = 60/202 (29.70%), Postives = 95/202 (47.03%), Query Frame = 2
Query: 1880 RENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIP--KRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNG 2473
            RE+  ILT       LQ  D D+  NA +V  +L      N  S     N +F +D +   L     LDRE + +Y L I + D G P    +   I+++ V DENDN P++    +Q  Y V++     +   I+L+ A D D   N+ I Y F+ + + S    K F++    G I + +  D +E  +Y  ++ A+D G
Sbjct:   27 RESTMILT-------LQATDADSGMNAKLVYSIL------NTTS-----NGTFTVDPHTGVLRTSQRLDRETVTEYTLTITVHDSGDPMLNAAQPAIVSITVLDENDNVPVF----DQEVYSVSIPENITVGAHILLLNARDKDEGVNAEIRY-FLKDAIVS----KRFSMNDTTGQITIKQAVDYEERSSYSFEVFASDGG 201          

HSP 5 Score: 63.1586 bits (152), Expect = 4.219e-10
Identity = 73/344 (21.22%), Postives = 137/344 (39.83%), Query Frame = 2
Query: 1508 VSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDK--THSLNYH-LDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQI-------------LTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFM---SRDLQESGTYYLKIQATDNGSPP 2482
            +S+ DIN+  P F      I I+E    ++ ++ ++A D D      L Y  L+ + N  F +D + G+L+     DRE + +Y + + V D                   +N   P +  I      +NV +             +T G  I  L  +D D   NA +            +     +++  F ++     + +K ++D E+   Y   +  SD G  + +    + + + D NDN P +      T Y V +     +   +  + A+D+D+  N  + ++ +  + +  +       + +N G+     S D ++   Y L IQATD G PP
Sbjct:    1 ISILDINDNRPKFPQPYNKIEITEGTRESTMILTLQATDADSGMNAKLVYSILNTTSNGTFTVDPHTGVLRTSQRLDRETVTEYTLTITVHDS--------------GDPMLNAAQPAIVSITVLDENDNVPVFDQEVYSVSIPENITVGAHILLLNARDKDEGVNAEI-----------RYFLKDAIVSKRFSMNDTTGQITIKQAVDYEERSSYSFEVFASDGGEARLTGSSSVRITIIDVNDNRPYFL----PTRYYVQLVENVAIGTTVTQLTASDLDSSLNGKVLFSILEGNSDGKFS------IDQNTGVVTTNKSLDYEDVTEYTLVIQATDCGDPP 309          
BLAST of Protocadherin-1 vs. Ensembl Medaka
Match: ENSORLT00000041785.1 (protocadherin gamma-C5 [Source:NCBI gene;Acc:101169865])

HSP 1 Score: 232.261 bits (591), Expect = 3.322e-62
Identity = 191/694 (27.52%), Postives = 330/694 (47.55%), Query Frame = 2
Query:  206 WMHSYNFEANV---VKYRLKEESDINTLIGNIFED------SRSEYMRKPKENFTYKIYTTDIDSNLTKLDFKGHLLVNKRIDREFLCPNVDKIDDCQLEL-MIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFS----LTLVVLKKLDFENI-SHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKA--LDKDKTHSLNYHL------DPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIREN----VQILTYGNLIGELQTQDLDNSYNAT-VVCDLLSVHVLSNHMSWI--RLLNHS----FEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVED 2185
            W H +   + +    +Y + EE    +++GN+ +D        SE   +       + ++ D          +G LLVN RIDRE LC    +   C L L ++   P    KV + I DINDN P FP+ EK ++++ES A G + PL TA+D D+    V+SY L   + +FSL  + M        LV+ K LD E + +H+   LT+ A DGG P +    ++ I V D+NDN P+F++      + E++   S++    A D+D G+ G++ +   P         F +N ++GE+ LI +L+ +  S + +DV A D+ G       C + I V D N++AP + L  + + ++ EN+P+G  V ++ A D D  DNGKVT  + K+    L    S N      Y L+T+R  DRE    +++ I+  D G+PP  + ++ +V++ D+N+ PP F   +Y++++ E+    S L  + A  LD  +   ++Y +      D SV+    ++   G + ++  FD E +  + + V   DQ   ++ +  T                  +  F++ +N      I      +G L  Q +  S  A  +V  + +V   S H +WI  RL   +    F +  Y   +  K ++  +     +L + I D G P +S    +++++ED
Sbjct:   35 WHHFFLLWSTIDAQTRYSIPEEVKHGSVVGNLAKDLGLTLTEISERALRVASESGEQYFSVDAG--------RGELLVNDRIDREALC---RQSASCVLTLQVVIDKPLQLFKVEVEIIDINDNSPVFPSSEKNLQIAESTAAGTRFPLDTALDLDVGVNSVRSYTLSKDD-YFSLNVKDMAGGRKNPELVLSKTLDREKMPTHQ---LTITAVDGGNPNKSGISQINIYVLDNNDNFPVFEKNVYKVTLSENSEKSSIVLKLAAKDSDDGVNGEVEYSFGPQTPDAVLSVFGINKDSGEIRLIGNLDFETTSSYEIDVSATDK-GTPKMEGHCSVHIEVLDVNDNAPYIFLTSQPN-SVPENAPSGTVVALISARDLDSGDNGKVTLQVPKSSPFKLKASFSDN------YALITSRALDRETFSEYSVEITATDLGSPPLSNKKMISVTITDVNDNPPVFTQRSYNVYLKENGVPGSILFSVSASDLDSSENAKISYSILDSKVQDVSVSSYVYMNSENGSIYSMHSFDYEKLKVFEIHVQAKDQGSPSLSSNAT------------------VHVFILDQNDNAPAVIYPSSAALGSLSHQRMPRSAKAGHLVTKVTAVDADSGHNAWISYRLAEATDASLFTVSLYTGEVRTKRAVSEQDDSSQRLILEIKDDGEPLQSATVTVSILLED 687          

HSP 2 Score: 121.709 bits (304), Expect = 2.038e-27
Identity = 135/541 (24.95%), Postives = 236/541 (43.62%), Query Frame = 2
Query:  965 DSGL-FGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQ---------------DENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYR----LVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKT--HSLNYHLDPSVNDK----FQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFM--SRDLQESGTYYLKIQATDNGSPPRFSDVTI 2503
            D GL   +I+ + L   +   + YF+++   GEL++    N +I           D   +   S+ C LT++V                D N+++P+    ++ +L I E++ AG    +  A D D+  N   +  L K+D  Y +L    N+KD    R    LV ++  DRE +    + I+  D GNP        N+ V D N+  P F  + Y + +SE+ E +S ++++ A D D      + Y   P   D     F I+ + G ++ I + D E    Y + V  TD+    +    +     +   ++   +    +   + EN      G ++  +  +DLD+  N  V   +               L  SF  D Y   L    +LDRE   +Y + I  +DLG P  SN ++I+V + D NDN P++     Q +Y V +         +  V A+D+D+ +N+ ISY+ +++ V  +    Y  + + NG I+   S D ++   + + +QA D GSP   S+ T+
Sbjct:   69 DLGLTLTEISERALRVASESGEQYFSVDAGRGELLV----NDRI-----------DREALCRQSASCVLTLQVVIDKPLQLFKVEVEIIDINDNSPVFPSSEK-NLQIAESTAAGTRFPLDTALDLDVGVNSVRSYTLSKDD--YFSL----NVKDMAGGRKNPELVLSKTLDREKMPTHQLTITAVDGGNPNKSGISQINIYVLDNNDNFPVFEKNVYKVTLSENSEKSSIVLKLAAKDSDDGVNGEVEYSFGPQTPDAVLSVFGINKDSGEIRLIGNLDFETTSSYEIDVSATDKGTPKMEGHCSVHIEVLDVNDNAPYIFLTSQPNSVPENAP---SGTVVALISARDLDSGDNGKVTLQVPKSSPFK--------LKASFS-DNYA--LITSRALDRETFSEYSVEITATDLGSPPLSNKKMISVTITDVNDNPPVF----TQRSYNVYLKENGVPGSILFSVSASDLDSSENAKISYSILDSKVQDVSVSSYVYMNSENGSIYSMHSFDYEKLKVFEIHVQAKDQGSPSLSSNATV 569          

HSP 3 Score: 93.2041 bits (230), Expect = 1.204e-18
Identity = 160/633 (25.28%), Postives = 277/633 (43.76%), Query Frame = 2
Query:  836 KLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFN-------TGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQ-CQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKT----------HSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFV-IRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVN---VTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDL--QESGTYYLKIQATDNGSPPRFSDVTI-ITVKISTAEKTNYLI--KNSQIS-----FTLIVVTSLASFSICVALMVGIIL 2638
            K+++E+ D NDN+P+F  ++    I EST  G+   +  A D D G+    ++ L     +K+  YF+LN           ELVL  +L+ + +    L + A D  G  P  S   Q+ I V D N++ P+    +   +T+ ENS     V  + A D D   NG+V         + +      N KD    RL+     D E    + I +S  D G P        ++ V D+N+  P  + ++    + E+    + +  I A D D             S  + L  S +D + +  ++ +       DRE   +Y V +  TD +    L+    + +T+TDVNDN PV T     V ++EN      G+++  +   DLD+S NA +   +L   V    +S    +N          +++   S D E++  +++++   D G P  S+   + V + D+NDN+P   Y ++     ++   +       H +  V A D D+  N+ ISY        SL     FT+    G +   R +  Q+  +  L ++  D+G P + + VT+ I ++ +  E  + L   K S+ S      TL ++ SLAS S+ ++L+  +IL
Sbjct:  136 KVEVEIIDINDNSPVFPSSEKNLQIAESTAAGTRFPLDTALDLDVGVNSVRSYTL-----SKDD-YFSLNVKDMAGGRKNPELVLSKTLDREKMPTHQLTITAVD--GGNPNKSGISQINIYVLDNNDNFPVFE-KNVYKVTLSENSEKSSIVLKLAAKDSDDGVNGEVEYSFGPQTPDAVLSVFGIN-KDSGEIRLIGN--LDFETTSSYEIDVSATDKGTPKMEGHCSVHIEVLDVNDNAPYIFLTSQPNSVPENAPSGTVVALISARDLDSGDNGKVTLQVPKSSPFKLKASFSDNYALITSRAL-------DRETFSEYSVEITATD-LGSPPLSNKKMISVTITDVNDNPPVFTQRSYNVYLKENG---VPGSILFSVSASDLDSSENAKISYSILDSKVQDVSVSSYVYMNSE------NGSIYSMHSFDYEKLKVFEIHVQAKDQGSPSLSSNATVHVFILDQNDNAPAVIYPSSAALGSLSHQRMPRSAKAGHLVTKVTAVDADSGHNAWISYRLAEATDASL-----FTVSLYTGEVRTKRAVSEQDDSSQRLILEIKDDGEPLQSATVTVSILLEDALHEPISELRHHKASEPSKKTGRITLYLILSLASVSV-LSLLTFVIL 733          
BLAST of Protocadherin-1 vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 213.772 bits (543), Expect = 2.360e-56
Identity = 225/852 (26.41%), Postives = 376/852 (44.13%), Query Frame = 2
Query:  245 YRLKEESDINTLIGNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLDFK-GHLLVNK-RIDREFL--CPNVDKIDDCQLE-------LMIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNL---EDSEPFFSLLY---RPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLT-------IMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKT--HSLNYHL--DPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDL--QESGTYYLKIQATDNGSPPRFSDVTI---ITVKISTAEKTNYLIKNS-------------QISFTL----IVVTSLASFSICVALMVGIILMWRK 2650
            YR++EE   NTLIG++  D        P     YK+   ++ +   ++D K G +   +  IDRE L  C ++ K   C LE       L+ +  P   I+  I ++DINDN P+FP     I V E+  +G    +  A D D E  GV  Y L    D+   F L     R      L+VL  LD E      ++LT+ A DGG P +  +  L++ VTD+NDN+P F+       + E++P+G  +    A D+D G  G+I + L  A     K+   ++  TG + +   L+ + ++     V ARD+ G  P SS+  +TI V D+N++AP + +     +T       I E+ P G  V +V  SD D  +N  VTCV+  +    L         ++  Y L TT   D E +  + + I   D GNP   S     V V D+N+  P F  + + +  +E+ +    ++ + A D D      L Y++  D  +   F+ID N G +K     DRE   +Y   V   D+         T V   +   +++   M     F + EN+  L+    +G +   D+D   NA V            H+S +      F +      +    S DRE+   Y   +   D G P RS+   +T+ V DENDN P+    +N +  Q++  A  + +  + +V+A D+D+  N+++ ++    +   L     F I   +G I +++++  +  G + L ++ +D G PPR +   +   +   IS       L+ +S             + SF      I+  SLA  +  V L++ ++ +  +
Sbjct:   26 YRVQEEQPPNTLIGSLAAD-----HGLPDSGHLYKL---EVGAPYLRVDGKTGDIFTTEIPIDRETLRDCRSLVKGKPCYLEFEVSVTDLLQNPSP-RLIEGRIEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRE--LKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPKL-LRIDRTTGIIYVKGPLDREEINSLSFYVVARDK-GPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLS---PVGMVTVLDMDKGENAHV------------HLS-VEPDGGKFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVVTKPSNSSFRQLSPVASPDSH--VDVVEAEDLDSGPNADLVFSIAGGNPYQL-----FRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYVNETISNVSLVEALVGHSLYTPLDRDIAGDPESSFAAQRSNILFGSLAGVAGVVILILAVVFIRHR 841          
BLAST of Protocadherin-1 vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 214.927 bits (546), Expect = 2.669e-56
Identity = 225/852 (26.41%), Postives = 376/852 (44.13%), Query Frame = 2
Query:  245 YRLKEESDINTLIGNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLDFK-GHLLVNK-RIDREFL--CPNVDKIDDCQLE-------LMIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNL---EDSEPFFSLLY---RPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLT-------IMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKT--HSLNYHL--DPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDL--QESGTYYLKIQATDNGSPPRFSDVTI---ITVKISTAEKTNYLIKNS-------------QISFTL----IVVTSLASFSICVALMVGIILMWRK 2650
            YR++EE   NTLIG++  D        P     YK+   ++ +   ++D K G +   +  IDRE L  C ++ K   C LE       L+ +  P   I+  I ++DINDN P+FP     I V E+  +G    +  A D D E  GV  Y L    D+   F L     R      L+VL  LD E      ++LT+ A DGG P +  +  L++ VTD+NDN+P F+       + E++P+G  +    A D+D G  G+I + L  A     K+   ++  TG + +   L+ + ++     V ARD+ G  P SS+  +TI V D+N++AP + +     +T       I E+ P G  V +V  SD D  +N  VTCV+  +    L         ++  Y L TT   D E +  + + I   D GNP   S     V V D+N+  P F  + + +  +E+ +    ++ + A D D      L Y++  D  +   F+ID N G +K     DRE   +Y   V   D+         T V   +   +++   M     F + EN+  L+    +G +   D+D   NA V            H+S +      F +      +    S DRE+   Y   +   D G P RS+   +T+ V DENDN P+    +N +  Q++  A  + +  + +V+A D+D+  N+++ ++    +   L     F I   +G I +++++  +  G + L ++ +D G PPR +   +   +   IS       L+ +S             + SF      I+  SLA  +  V L++ ++ +  +
Sbjct:  103 YRVQEEQPPNTLIGSLAAD-----HGLPDSGHLYKL---EVGAPYLRVDGKTGDIFTTEIPIDRETLRDCRSLVKGKPCYLEFEVSVTDLLQNPSP-RLIEGRIEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRE--LKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPKL-LRIDRTTGIIYVKGPLDREEINSLSFYVVARDK-GPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLS---PVGMVTVLDMDKGENAHV------------HLS-VEPDGGKFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVVTKPSNSSFRQLSPVASPDSH--VDVVEAEDLDSGPNADLVFSIAGGNPYQL-----FRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYVNETISNVSLVEALVGHSLYTPLDRDIAGDPESSFAAQRSNILFGSLAGVAGVVILILAVVFIRHR 918          
BLAST of Protocadherin-1 vs. Ensembl Medaka
Match: ENSORLT00000033522.1 (pep primary_assembly:ASM223467v1:10:15043367:15050905:-1 gene:ENSORLG00000030492.1 transcript:ENSORLT00000033522.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 212.231 bits (539), Expect = 2.696e-56
Identity = 162/533 (30.39%), Postives = 274/533 (51.41%), Query Frame = 2
Query:  221 NFEANVVKYRLKEESDINTLIGNIFED---SRSEYMRKPKENFTYKIYTTDIDSNLTKLDFK-GHLLVNKRIDREFLCPNVDKIDDCQL--ELMIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPF-FSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKD--KTHSLNYHL------DPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTD 1774
            N EA  + Y + EE    +++GNI +D      E+  +       +I T   D +   LD K G+ +  KRIDRE LC    +   C L  EL++ + P     + ++I+DINDN P FP    ++++ ES   G +  +  A D D+    V+ Y+LE +E F  S          LV+ K+LD E    +   L L A DGG+P +     + + V D+NDN P+F ++     ++E++P+ + +   +ASDAD G+ G+I ++     + K +  F+L   TGE+ +  ++N + +SK+ + +EA+D  G    SS+ ++ I + D N++AP++ +    S +I EN+P G  VG++   D D + NG+V C +  N    L      ++K+   Y +V+T   DREL+  + I IS  D G+PP  S +  ++SV DIN+ PP F   +YS ++SE+ +  S L  + A D D  +  ++ Y L         V+    ++ + G++  +  FD E +  + V V   D
Sbjct:   20 NIEAADLSYTIPEEMRPGSIVGNIPKDLGLGLGEFFERKA-----RIDTGGKDHHFCDLDLKTGNFVTKKRIDREELC---GEKKSCVLRFELVLES-PLELHHISLLIQDINDNSPNFPEDVVKLEIRESADGGARYRVNEAHDSDIGQNTVREYSLEKNEHFVLSTTNAGNKYGELVLDKELDREE--QQELKLLLTAVDGGSPQRSGTVVIHVTVLDANDNAPVFSESVYTANLQENSPLNTPVIRVSASDADDGINGEITYEF-SRLSDKTQNIFSLAEKTGEITVTGNINYEELSKYEVMIEAKDGYG---LSSEAKVIIDITDVNDNAPVIIVKSLSS-SIPENAPPGTEVGIINVQDRDSDKNGQVRCSIQGNAPFKLV----PSIKN--YYSVVSTGQLDRELVSDYNITISATDEGSPPLSSSKTVHLSVADINDNPPVFEEQSYSAYVSENNQAGSTLCSVSARDPDWRQNGTVIYSLLAAEVNGAPVSSYVSVNGDTGLIHAVRSFDYEQLRSFQVQVMARD 530          

HSP 2 Score: 96.2857 bits (238), Expect = 1.059e-19
Identity = 134/539 (24.86%), Postives = 240/539 (44.53%), Query Frame = 2
Query:  212 HSYNFEANVVKYRLKEESDINTLI-------GNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLDFKGHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFP------DHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNL----EDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKIN--------FKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDR--SHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYH--SNYSIFISEDI----EINSALIQIKALDKDKTHS--LNYHL----DPSVNDKFQIDINKGILK 1711
            +S NF  +VVK  ++E +D             +I +++  EY  +  E+F   + TT+  +        G L+++K +DRE         +  +L+L++ A           + + + + D NDN P F        + E+  +   +   +A D D    G  +Y      + ++  FSL  +   +  + V   +++E +S   + + + A DG       + K+ I++TD NDN P+         I E+ P G+ + I N  D DS   G++         FKL+P  + KN  Y+++  +TG+L      + ++VS + + + A DE G  P SS   + + V D N++ P+       S  + EN+ AG  +  V A D D   NG V   LL  + N   +    S N    +I+ +   R FD E L  F + +  +D G+PP  S    +V + D+N+  P   +     S F++E +       S + ++ A+D D   +  L+YH+    DP +   F I ++ G ++
Sbjct:  125 NSPNFPEDVVKLEIRESADGGARYRVNEAHDSDIGQNTVREYSLEKNEHFV--LSTTNAGNKY------GELVLDKELDRE---------EQQELKLLLTAVDGGSPQRSGTVVIHVTVLDANDNAPVFSESVYTANLQENSPLNTPVIRVSASDADDGINGEITYEFSRLSDKTQNIFSLAEK---TGEITVTGNINYEELSK--YEVMIEAKDGYG--LSSEAKVIIDITDVNDNAPVIIVKSLSSSIPENAPPGTEVGIINVQDRDSDKNGQVRCSIQGNAPFKLVP--SIKN--YYSV-VSTGQL------DRELVSDYNITISATDE-GSPPLSSSKTVHLSVADINDNPPVFE-EQSYSAYVSENNQAGSTLCSVSARDPDWRQNGTVIYSLLAAEVNGAPVSSYVSVNGDTGLIHAV---RSFDYEQLRSFQVQVMARDNGSPPLSSNVSVSVFISDVNDNSPQILYPAPEGSSFMTELVPKAAHGGSLVSKVIAVDADSGQNAWLSYHIVKSTDPGL---FTIGLHSGEIR 620          

HSP 3 Score: 91.6633 bits (226), Expect = 2.816e-18
Identity = 118/459 (25.71%), Postives = 199/459 (43.36%), Query Frame = 2
Query: 1163 QLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKT--HSLNY---HLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFV--IRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSS---LDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTI 2503
             +++ +QD N+++P     D   L I E++  G    +  A D D+  N      L KN+   L+   + N   E    LV  +  DRE      ++++  D G+P      + +V+V D N+  P F  S Y+  + E+  +N+ +I++ A D D      + Y    L     + F +    G +    + + E + KY V +   D      L+    V I +TDVNDN PV+  +K     I EN      G  +G +  QD D+  N  V C +                N  F++     N +   S   LDRE +  Y + I  +D G P  S+ + + + V D NDN P++  Q    +Y   V+        +  V A D D ++N  + Y+ +  +VN      Y ++    G I   R  D ++  ++ +++ A DNGSPP  S+V++
Sbjct:  114 HISLLIQDINDNSPNFP-EDVVKLEIRESADGGARYRVNEAHDSDIGQNTVREYSLEKNEHFVLSTTNAGNKYGE----LVLDKELDREEQQELKLLLTAVDGGSPQRSGTVVIHVTVLDANDNAPVFSESVYTANLQENSPLNTPVIRVSASDADDGINGEITYEFSRLSDKTQNIFSLAEKTGEITVTGNINYEELSKYEVMIEAKDG---YGLSSEAKVIIDITDVNDNAPVII-VKSLSSSIPENAPP---GTEVGIINVQDRDSDKNGQVRCSIQG--------------NAPFKLVPSIKNYYSVVSTGQLDRELVSDYNITISATDEGSPPLSSSKTVHLSVADINDNPPVFEEQ----SYSAYVSENNQAGSTLCSVSARDPDWRQNGTVIYSLLAAEVNGAPVSSYVSVNGDTGLIHAVRSFDYEQLRSFQVQVMARDNGSPPLSSNVSV 542          

HSP 4 Score: 80.1073 bits (196), Expect = 9.883e-15
Identity = 144/638 (22.57%), Postives = 266/638 (41.69%), Query Frame = 2
Query:  839 LQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYF----NLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESL---TIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKD--EIIYRLVTTRVFDRELLDYFTIMISCQD-YGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINS--ALIQIKALDKDKTHSLN--------YHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQ-TAYQVNVTAETNLNHPII-LVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESGTYY--LKIQATDNGSPPRFSDVTIITV------KISTAEKTNYLIKNSQI-SFTLIVVTSLASFSICVALMVGIILMWRKSYP 2659
            + + + D NDN+P F +      I+ES   G+   +  A D+D G      + L      KN+ +     N     GELVL   L+ +   +  L + A D  G    S    + + V D N++AP+ S    ES+    + ENSP    V  V ASD D   NG++T    +        D++ N+    E    +  T   + E L  + +MI  +D YG     S     + + D+N+  P     + S  I E+    +   +I ++  D DK   +         + L PS+ + + + ++ G        DRE++  Y + +  TD+    + +  T         ++            + EN Q    G+ +  +  +D D   N TV+  LL+  V    +S    +N    +      +    S D EQ+  +++ ++  D G P  S+   ++V + D NDNSP   Y   + +++   +  +      ++  V A D D+ +N+ +SY+ V +    L     FTI   +G I   RD+ +S +    L +   DNG P   +   +  +      ++   +  +Y  KNS++ S+ +I +  +++F +   +++  +   R+  P
Sbjct:  115 ISLLIQDINDNSPNFPEDVVKLEIRESADGGARYRVNEAHDSDIGQNTVREYSL-----EKNEHFVLSTTNAGNKYGELVLDKELDREEQQELKLLLTAVD-GGSPQRSGTVVIHVTVLDANDNAPVFS----ESVYTANLQENSPLNTPVIRVSASDADDGINGEITYEFSR------LSDKTQNIFSLAEKTGEITVTGNINYEELSKYEVMIEAKDGYG---LSSEAKVIIDITDVNDNAPVIIVKSLSSSIPENAPPGTEVGIINVQDRDSDKNGQVRCSIQGNAPFKLVPSIKNYYSV-VSTG------QLDRELVSDYNITISATDEGSPPLSSSKTVHLSVADINDNPPVFEEQSYSAYVSENNQA---GSTLCSVSARDPDWRQNGTVIYSLLAAEVNGAPVSSYVSVNGDTGL------IHAVRSFDYEQLRSFQVQVMARDNGSPPLSSNVSVSVFISDVNDNSPQILYPAPEGSSFMTELVPKAAHGGSLVSKVIAVDADSGQNAWLSYHIVKSTDPGL-----FTIGLHSGEIRTQRDISQSDSMKQNLIVAVKDNGQPSLSATCAMYLLISDNLAEVPELKDISYDEKNSKLTSYLIIALVCVSTFFLTFIIIILGVRFCRRRKP 712          
BLAST of Protocadherin-1 vs. Ensembl Medaka
Match: ENSORLT00000035950.1 (pep primary_assembly:ASM223467v1:10:15034655:15043263:-1 gene:ENSORLG00000024469.1 transcript:ENSORLT00000035950.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 210.69 bits (535), Expect = 8.188e-56
Identity = 167/530 (31.51%), Postives = 273/530 (51.51%), Query Frame = 2
Query:  239 VKYRLKEESDINTLIGNIFED---SRSEYMRKPKENFTYKIYTTDIDSNLTKLDFK-GHLLVNKRIDREFLCPNVDKIDDCQL--ELMIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFS---LTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTT-KNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKD--KTHSLNYHL------DPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTD 1774
            + Y + EE    +++GNI +D      E+  +       +I T   D +   LD K G+ +  KRIDRE LC   +K+  C L  EL++ + P     + ++I+DINDN P FP    ++++SES+  G +  +  A D D+    V+ Y+LE +E F   +         + L++ K+LD E    +  N  L A DGG   +     +++ V D+NDN P+F+QT     + E+  I +V+    A+DAD G+ G++ ++   +R T K K  F+LN  TGE+ +I  L+ +   K+ + + A+D  G+   SS  +L I V D N++API+ L    S  I EN+P G  VG++   D D + NG+V C +  N    L      ++K+   Y +V+T   DREL+  + I IS  D G+PP  SF+  ++SV DIN+ PP F   +YS ++SE+ +  S L  + A D D  +  ++ Y L         V+    ++ + G++  +  FD E +  + V V   D
Sbjct:   55 LSYTIPEEMRPGSIVGNIPKDLGLGLGEFFERKA-----RIDTGGKDHHFCDLDLKTGNFVTKKRIDREELCG--EKMS-CVLRFELVLES-PLELHHISLLIQDINDNSPNFPEDVVKLEISESVGRGARYRVNEAHDSDIGQNTVREYSLEKNEHFVLSVQDDTDGSKKIELILDKELDREK--EQDLNFALFAIDGGNLQRSGSVTIKVTVLDANDNAPLFNQTFYKASLPENAQIDTVVAAVKATDADEGVNGEVTYEF--SRITEKAKKVFSLNSKTGEIRVIGPLDFETDPKYEMRIYAKDGYGL---SSDTKLMIDVTDVNDNAPIIYLKSIMS-AIPENAPPGTEVGIINVQDRDSDKNGQVRCSIQANAPFKLV----PSIKN--YYSVVSTGQLDRELVSDYNITISATDEGSPPLSSFKTVHLSVADINDNPPVFEEQSYSAYVSENNQAGSTLCSVSARDPDWRQNGTVIYSLLAAEVNGAPVSSYVSVNGDTGLIHAVRPFDYEQLRSFQVQVMARD 561          

HSP 2 Score: 95.9005 bits (237), Expect = 1.328e-19
Identity = 137/520 (26.35%), Postives = 231/520 (44.42%), Query Frame = 2
Query:  239 VKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLDFKGHLLVNKRIDREF---LCPNVDKIDDCQLELMIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNL----EDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKIN--------FKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDR--SHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYH--SNYSIFISEDI----EINSALIQIKALDKDKTHS--LNYHL----DPSVNDKFQIDINKGILK 1711
             +YR+ E  D      +I +++  EY  +  E+F   +     D++ +K   K  L+++K +DRE    L   +  ID   L+          + + + + D NDN P F     +  + E+  +   +    A D D    G  +Y      E ++  FSL  +   +  + V+  LDFE  +   + + + A DG         KL I+VTD NDN PI         I E+ P G+ + I N  D DS   G++         FKL+P  + KN  Y+++  +TG+L      + ++VS + + + A DE G  P SS   + + V D N++ P+       S  + EN+ AG  +  V A D D   NG V   LL  + N   +    S N    +I+ +   R FD E L  F + +  +D G+PP  S    +V + D+N+  P   +     S F++E +       S + ++ A+D D   +  L+YH+    DP +   F I ++ G ++
Sbjct:  175 ARYRVNEAHD-----SDIGQNTVREYSLEKNEHFVLSVQD---DTDGSK---KIELILDKELDREKEQDLNFALFAIDGGNLQR------SGSVTIKVTVLDANDNAPLFNQTFYKASLPENAQIDTVVAAVKATDADEGVNGEVTYEFSRITEKAKKVFSLNSK---TGEIRVIGPLDFE--TDPKYEMRIYAKDGYG--LSSDTKLMIDVTDVNDNAPIIYLKSIMSAIPENAPPGTEVGIINVQDRDSDKNGQVRCSIQANAPFKLVP--SIKN--YYSV-VSTGQL------DRELVSDYNITISATDE-GSPPLSSFKTVHLSVADINDNPPVFE-EQSYSAYVSENNQAGSTLCSVSARDPDWRQNGTVIYSLLAAEVNGAPVSSYVSVNGDTGLIHAV---RPFDYEQLRSFQVQVMARDNGSPPLSSNVSVSVFISDVNDNSPQILYPAPEGSSFMTELVPKAAHGGSLVSKVIAVDADSGQNAWLSYHIVKSTDPGL---FTIGLHSGEIR 651          

HSP 3 Score: 87.4261 bits (215), Expect = 5.840e-17
Identity = 116/459 (25.27%), Postives = 198/459 (43.14%), Query Frame = 2
Query: 1163 QLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKT--HSLNY---HLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFV--IRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSS---LDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSR--DLQESGTYYLKIQATDNGSPPRFSDVTI 2503
             +++ +QD N+++P     D   L I E+   G    +  A D D+  N      L KN+   L++    +   +I   L+  +  DRE        +   D GN          V+V D N+  P F  + Y   + E+ +I++ +  +KA D D+     + Y    +       F ++   G ++ I   D E  PKY + ++  D      L+  T + I VTDVNDN P++  +K  +  I EN      G  +G +  QD D+  N  V C + +              N  F++     N +   S   LDRE +  Y + I  +D G P  S+ + + + V D NDN P++  Q    +Y   V+        +  V A D D ++N  + Y+ +  +VN      Y ++    G I   R  D ++  ++ +++ A DNGSPP  S+V++
Sbjct:  143 HISLLIQDINDNSPNFP-EDVVKLEISESVGRGARYRVNEAHDSDIGQNTVREYSLEKNEHFVLSVQDDTDGSKKI--ELILDKELDREKEQDLNFALFAIDGGNLQRSGSVTIKVTVLDANDNAPLFNQTFYKASLPENAQIDTVVAAVKATDADEGVNGEVTYEFSRITEKAKKVFSLNSKTGEIRVIGPLDFETDPKYEMRIYAKDG---YGLSSDTKLMIDVTDVNDNAPIIY-LKSIMSAIPENAPP---GTEVGIINVQDRDSDKNGQVRCSIQA--------------NAPFKLVPSIKNYYSVVSTGQLDRELVSDYNITISATDEGSPPLSSFKTVHLSVADINDNPPVFEEQ----SYSAYVSENNQAGSTLCSVSARDPDWRQNGTVIYSLLAAEVNGAPVSSYVSVNGDTGLIHAVRPFDYEQLRSFQVQVMARDNGSPPLSSNVSV 573          

HSP 4 Score: 57.7658 bits (138), Expect = 6.753e-8
Identity = 109/525 (20.76%), Postives = 218/525 (41.52%), Query Frame = 2
Query: 1151 SSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQD-YGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINS--ALIQIKALDKDKTHSLN--------YHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQ-TAYQVNVTAETNLNHPII-LVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESGTYY--LKIQATDNGSPPRFSDVTIITV------KISTAEKTNYLIKNSQI-SFTLIVVTSLASFSICVALMVGIILMWRKSYP 2659
            S    + + V D N++AP+ +    ++ ++ EN+     V  V A+D D   NG+VT    +       +   ++   EI  R++     D E    + + I  +D YG     S     + V D+N+  P  Y  +    I E+    +   +I ++  D DK   +         + L PS+ + + + ++ G        DRE++  Y + +  TD+    + +  T         ++            + EN Q    G+ +  +  +D D   N TV+  LL+  V    +S    +N    +      +      D EQ+  +++ ++  D G P  S+   ++V + D NDNSP   Y   + +++   +  +      ++  V A D D+ +N+ +SY+ V +    L     FTI   +G I   RD+ +S +    L +   DNG P   +   +  +      ++   +  +Y  KNS++ S+ +I +  +++F +   +++  +   R+  P
Sbjct:  248 SGSVTIKVTVLDANDNAPLFNQTFYKA-SLPENAQIDTVVAAVKATDADEGVNGEVTYEFSRITEKAKKVFSLNSKTGEI--RVIGP--LDFETDPKYEMRIYAKDGYG---LSSDTKLMIDVTDVNDNAPIIYLKSIMSAIPENAPPGTEVGIINVQDRDSDKNGQVRCSIQANAPFKLVPSIKNYYSV-VSTG------QLDRELVSDYNITISATDEGSPPLSSFKTVHLSVADINDNPPVFEEQSYSAYVSENNQA---GSTLCSVSARDPDWRQNGTVIYSLLAAEVNGAPVSSYVSVNGDTGL------IHAVRPFDYEQLRSFQVQVMARDNGSPPLSSNVSVSVFISDVNDNSPQILYPAPEGSSFMTELVPKAAHGGSLVSKVIAVDADSGQNAWLSYHIVKSTDPGL-----FTIGLHSGEIRTQRDISQSDSMKQNLIVAVKDNGQPSLSATCAMYLLISDNLAEVPELKDISYDEKNSKLTSYLIIALVCVSTFFLTFIIIILGVRFCRRRKP 743          
BLAST of Protocadherin-1 vs. Planmine SMEST
Match: SMESG000008751.1 (SMESG000008751.1)

HSP 1 Score: 1976.44 bits (5119), Expect = 0.000e+0
Identity = 998/998 (100.00%), Postives = 998/998 (100.00%), Query Frame = 2
Query:  203 LWMHSYNFEANVVKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLDFKGHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESGTYYLKIQATDNGSPPRFSDVTIITVKISTAEKTNYLIKNSQISFTLIVVTSLASFSICVALMVGIILMWRKSYPIQLNSDRTTGNWDDPKTLQWEISPFVDVDHRPNESIVLNDSKFYNSMTSDLCNICVADPLLTQFRDFPQNRIESNIPNQNILQSSGHLQFRQXXXXXXXXXXXXGHGASEYNPINSEAKFNRYHHAYGNSTLREHSTLQEESQVLSEDIISSSKPPQIYQNEYYNQIRCVFLELPQSAQ 3196
            LWMHSYNFEANVVKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLDFKGHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRGTILTGTTTVYITVTDVNDNTPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESGTYYLKIQATDNGSPPRFSDVTIITVKISTAEKTNYLIKNSQISFTLIVVTSLASFSICVALMVGIILMWRKSYPIQLNSDRTTGNWDDPKTLQWEISPFVDVDHRPNESIVLNDSKFYNSMTSDLCNICVADPLLTQFRDFPQNRIESNIPNQNILQSSGHLQFRQFSPDFDSSSVDSGHGASEYNPINSEAKFNRYHHAYGNSTLREHSTLQEESQVLSEDIISSSKPPQIYQNEYYNQIRCVFLELPQSAQ
Sbjct:   10 LWMHSYNFEANVVKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLDFKGHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRGTILTGTTTVYITVTDVNDNTPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESGTYYLKIQATDNGSPPRFSDVTIITVKISTAEKTNYLIKNSQISFTLIVVTSLASFSICVALMVGIILMWRKSYPIQLNSDRTTGNWDDPKTLQWEISPFVDVDHRPNESIVLNDSKFYNSMTSDLCNICVADPLLTQFRDFPQNRIESNIPNQNILQSSGHLQFRQFSPDFDSSSVDSGHGASEYNPINSEAKFNRYHHAYGNSTLREHSTLQEESQVLSEDIISSSKPPQIYQNEYYNQIRCVFLELPQSAQ 1007          
BLAST of Protocadherin-1 vs. Planmine SMEST
Match: SMESG000008751.1 (SMESG000008751.1)

HSP 1 Score: 1970.28 bits (5103), Expect = 0.000e+0
Identity = 996/996 (100.00%), Postives = 996/996 (100.00%), Query Frame = 2
Query:  209 MHSYNFEANVVKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLDFKGHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESGTYYLKIQATDNGSPPRFSDVTIITVKISTAEKTNYLIKNSQISFTLIVVTSLASFSICVALMVGIILMWRKSYPIQLNSDRTTGNWDDPKTLQWEISPFVDVDHRPNESIVLNDSKFYNSMTSDLCNICVADPLLTQFRDFPQNRIESNIPNQNILQSSGHLQFRQXXXXXXXXXXXXGHGASEYNPINSEAKFNRYHHAYGNSTLREHSTLQEESQVLSEDIISSSKPPQIYQNEYYNQIRCVFLELPQSAQ 3196
            MHSYNFEANVVKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLDFKGHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRGTILTGTTTVYITVTDVNDNTPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESGTYYLKIQATDNGSPPRFSDVTIITVKISTAEKTNYLIKNSQISFTLIVVTSLASFSICVALMVGIILMWRKSYPIQLNSDRTTGNWDDPKTLQWEISPFVDVDHRPNESIVLNDSKFYNSMTSDLCNICVADPLLTQFRDFPQNRIESNIPNQNILQSSGHLQFRQFSPDFDSSSVDSGHGASEYNPINSEAKFNRYHHAYGNSTLREHSTLQEESQVLSEDIISSSKPPQIYQNEYYNQIRCVFLELPQSAQ
Sbjct:    1 MHSYNFEANVVKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLDFKGHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRGTILTGTTTVYITVTDVNDNTPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESGTYYLKIQATDNGSPPRFSDVTIITVKISTAEKTNYLIKNSQISFTLIVVTSLASFSICVALMVGIILMWRKSYPIQLNSDRTTGNWDDPKTLQWEISPFVDVDHRPNESIVLNDSKFYNSMTSDLCNICVADPLLTQFRDFPQNRIESNIPNQNILQSSGHLQFRQFSPDFDSSSVDSGHGASEYNPINSEAKFNRYHHAYGNSTLREHSTLQEESQVLSEDIISSSKPPQIYQNEYYNQIRCVFLELPQSAQ 996          
BLAST of Protocadherin-1 vs. Planmine SMEST
Match: SMESG000023091.1 (SMESG000023091.1)

HSP 1 Score: 402.905 bits (1034), Expect = 9.802e-122
Identity = 278/840 (33.10%), Postives = 450/840 (53.57%), Query Frame = 2
Query:  209 MHSYNFEANVVKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKLDFK-GHLLVNKRIDREFLCPNVD-------KIDDCQLELMIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKV----YFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDRES-----LTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVND-KFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXX-XXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNH-----SFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNF--VNNDVNSLWYEKYFTILTRNGGIFMSRDLQESGTYYLKIQATDNGSPPRFSDVTIITVKISTAEKTNYLIKNSQISFTLIVVTSLASFSICVALMVGIILMWRK 2650
            +H  N  +  +KY +KEES  N LIGNI +DSR     K  E+ T++IY  +   N  ++  K G   V  RIDRE +C   +       K  +C+L L +    +HWI V I IEDIND+ P F    K I++ E +++  + PL  A D D+    +Q Y LE     F L Y P F L L +  KLD++    + ++L L ACDGG P+QC  QKL I V D NDN PIF +++    + E T +GS IF   A+D DSGL+G IN+ +  + +   K     +F ++ N+G ++L   L+AK+   F + +EA D +G  P   Q  + I ++D N+H P +S+  +       L++ EN+    ++G++I +DGD+  NGKV+CV+ K++   L L  S+N  D +IY ++    FDRE    FTI I+C+DYG PP  + Q   + + D+NE PP   ++   + ISED+ I      ++  DKD T ++++ +  ++N   F ID   G +K   + DRE I +YI+ + V D  +     T + ++ ++V D NDN P +    + +   N+    YG      Q   LDN        D+ S  V+   +++I+  N       F I++    LF  +SLDRE+ D YK++++++D G P ++  EII V + D+NDN+PIW++ + Q    +N+T  T     I  + A D D  +N+N++Y    V   +NS  ++ + T  T     F++  +     + L +QA+DNG+ P  S  T +T++    E  + L  +  +SF LIV  ++ +  IC++L++ I+++ R+
Sbjct:   17 IHLTNQISQDLKYSVKEESPPNYLIGNIKKDSR--LSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETICSFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHD-SGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKIL-LKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVI---NIIEGNYGVKEKIFQVFALDN--------DIGSNAVVEYTINYIKYRNEIIKEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDI-INLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKM-----FVLHLQASDNGNTPLKSVPTTLTIRYWPMETGSLLSGHDSVSFNLIVTMAVVTCLICLSLLIAIVVVRRR 835          
BLAST of Protocadherin-1 vs. Planmine SMEST
Match: SMESG000068096.1 (SMESG000068096.1)

HSP 1 Score: 363.229 bits (931), Expect = 1.930e-107
Identity = 265/813 (32.60%), Postives = 420/813 (51.66%), Query Frame = 2
Query:  236 VVKYRLKEESDINTLIGNIFEDSRSEYMRKP-KENFT-YKIYTTDIDSNLTKLDFK-GHLLVNKRIDREFLCPNVDKIDDCQLELMIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDR-----ESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYI-VPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSS--LDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESGTYYLKIQATDNGSPPRFSDV--TIITVKISTAEKTNYLIKNSQISFTLIVVTSLASFSICVALMVGII 2635
            ++ Y + EE  +   IGNI +DS+      P K N + + +Y  D   +   L+ K G +  + R+DRE +C        C  + ++   P +W +V I + DINDN P F   E  I V ES      LPL+ A+D DL  + VQSY L   E  FS+ Y    SL LVV+ +LD++N S R F   LIACDGG   +C +QKL+I +TD NDN P F ++ +   I E   I SVI+  NA+D DS LFGKI +K          ++F ++  +GE++LI SL ++  +  IL + A DE G GPF  +  L I +Q ENNH P ++L        +  ++MENSP   ++G+++  D D  +NG+V C L  N   +L +  S+ +K +  Y L T    D E  +   + + C D+G     S   FNV + D+NE+ P+F  SN S  + E+      ++++ A D+D   ++ + L    N+ F+I+   G +    H DRE +  ++ + V + D      L+ ++ + I + D+NDN PV+    Q    EN  I    N I  L+  D D + N T+  ++ S+    N+       N SF+ID     +  + S   D E  D+Y+  +I+ D G+PK SN   I + + D NDN+P+W   NN   +Q+N+T + +   PI  + A D D+ KN+N++Y  + ND +    E  + +   +G +++   L   G Y LK+QA DNG PP  S++   +I V  +   K  + I  + +  T+ +V+ L   ++ + L VG +
Sbjct:   27 IINYVIDEELPVLYCIGNILKDSKFNSSPIPIKLNSSRFILYAEDNIRHYFSLNNKTGDIFQSHRLDRETVCEPHLFSGSCSFKFLVLLPPKYWFRVTISVRDINDNVPVFRQSEITIHVKESEKKFYSLPLEPAIDNDLAQYSVQSYLLLGVEKAFSITYEIPMSLNLVVVDELDYDNESSRVFIANLIACDGGNSSKCGQQKLKILITDVNDNKPKFFKSDDSIKISEFQKINSVIYHANATDIDSNLFGKIAYKFSTEIKLSTMMFFQIDPISGEIILINSLESRKSAFLILKIIAHDEFGSGPFYDEMSLKIYIQSENNHHPKITLRQLPHKAVKEFSVMENSPPNTYIGLIMVEDPDKFENGQVECKLANNKHEFLVMHFSNRIKQKTFYTLNTILEIDCEKTNLIPVTVECNDFGRDSKTSSLTFNVRITDVNEYAPNFSKSNLSESVLENSPPGMLIMKLSAFDRDYYSNITFKL--INNELFKINSETGEIFTFQHIDRETLGDFVNITVVINDNGLDRSLSSSSQILIRILDINDNIPVLVNKTQISFEENSTI--SPNFITTLKGFDPDLNENGTIRYEIHSIMEYKNNFPSFN--NQSFKIDPSTGAISFRPSFRFDYETADRYEFKLILRDNGVPKLSNKYSIIINILDINDNAPVWASPNNLDRFQLNITGQPDAERPIFRLHAYDYDSNKNNNLTYQIIINDNDKKLIEDTYFLSPEHGYLYLKSQLS-IGIYELKVQANDNGIPPLKSNILKLLINVHPNVTSKQTFSISITMMGVTIFLVSGL---TLTILLGVGYL 829          
BLAST of Protocadherin-1 vs. Planmine SMEST
Match: SMESG000076350.1 (SMESG000076350.1)

HSP 1 Score: 363.999 bits (933), Expect = 8.461e-107
Identity = 281/829 (33.90%), Postives = 432/829 (52.11%), Query Frame = 2
Query:  239 VKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKL----DFKGHLLVNKRIDREFLCP-NVDKIDDCQLELMIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAK-IVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPIL---SLG-DRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRXXXXXXXXXXXXXXXXXXXXXPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSV---HVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNL--NHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESGTYYLKIQATDNGSPPRFSDVTIITVKISTAEKTNYLIKNSQISFTLIVVTSLASFSICVALMVGIILMWRKSYPIQLNSDR 2680
            + Y +KEE D+   +GN+  DS + +  +PK   T+K+Y    D  L K     +  G L++ +RIDRE +CP +   +D CQ+EL I    D+WI V I I+D+ND++PKF     +I++SE++ VG ++ L+TA D D+E   V +Y +      F++ +  +  L L+V+  LD+E  +   +  TL+ACD G P  C  Q L I V D NDN+P+F Q +    IKE+  +G V+    A D DSGLFG++ ++    +      YF ++  TGE+ L   LN K I   F L++EA D   V P      + + ++D NN  P++   SLG  ++   + EN     H  ++  SDGD+  N +V C L     N+  L  S  +K   IY L   RVFDRE+  +F + + C D G P   + +   V + D+NEF P F   NY++ +SE+  I   L+Q+ A D D T  L Y L PS N  F ID   G L+     DRE   K  + V   DQ      T TTTV+IT+TDVNDN P +    +  ++EN + L     + ++Q +D D   N TV   +  V     L+  +   R     F ID+   NL +  SLDRE ID Y L I++ D G P+ +++E IT+ V D NDN P W +Q    A+  N+T ++ L  +  II+ QA+D D++ N+NI+Y+    D   L Y           G   +R     G Y +K+ A DNG+P   +++  I + IS+    + +I  S   F +++V ++ +    V L + I LM+ K   +++ ++R
Sbjct:  173 IHYAVKEEIDVGNFVGNLNIDS-NIFKIQPKS--TFKLYD---DGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVIITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNL--LYLIVINALDYE--TQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSV-PKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENF-KLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIGLLLLQLHATDDDATAQLLYQLAPSQNAFFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQTATTTVFITITDVNDNPPTVINPPKLQVKENEETLPM--FLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENR--TKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKW-FQ--PVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGD--DLVYIDAII------GDLRARQSIREGHYLIKLVANDNGNPNLSTEIK-INLYISSKSTFSTVINISDDQFRVVIVIAMVTMGGVVLLGLFIFLMFMKKRSVKMQNER 973          
The following BLAST results are available for this feature:
BLAST of Protocadherin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH11X1.918e-5527.32protocadherin 11 X-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11X2.091e-5527.11protocadherin 11 X-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11X2.215e-5527.11protocadherin 11 X-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11X2.349e-5527.11protocadherin 11 X-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11X2.716e-5527.11protocadherin 11 X-linked [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-14.021e-3925.86FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
fmi-12.559e-3126.68FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-42.768e-2727.21Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI... [more]
cdh-15.601e-2423.76CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
cdh-31.032e-1725.86Cadherin-3 [Source:UniProtKB/Swiss-Prot;Acc:P3461... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ds7.260e-4625.71gene:FBgn0284247 transcript:FBtr0078045[more]
ds7.260e-4625.71gene:FBgn0284247 transcript:FBtr0343249[more]
ft7.891e-3824.29gene:FBgn0001075 transcript:FBtr0077478[more]
kug4.397e-3427.26gene:FBgn0261574 transcript:FBtr0346077[more]
kug4.397e-3427.26gene:FBgn0261574 transcript:FBtr0332721[more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh2g281.553e-5727.23protocadherin 2 gamma 28 [Source:ZFIN;Acc:ZDB-GENE... [more]
pcdh2aa151.753e-5627.40protocadherin 2 alpha a 15 [Source:ZFIN;Acc:ZDB-GE... [more]
pcdh2aa152.005e-5627.61protocadherin 2 alpha a 15 [Source:ZFIN;Acc:ZDB-GE... [more]
pcdh1gb23.389e-5626.98protocadherin 1 gamma b 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
pcdh1gb23.893e-5627.57protocadherin 1 gamma b 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH175.622e-5531.76protocadherin 17 [Source:NCBI gene;Acc:100485388][more]
PCDH176.022e-5531.76protocadherin 17 [Source:NCBI gene;Acc:100485388][more]
pcdh177.081e-5426.48protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh171.759e-5326.48protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh171.782e-5326.48protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdhga31.534e-5528.92protocadherin gamma subfamily A, 3 [Source:MGI Sym... [more]
Pcdhgb54.010e-5530.85protocadherin gamma subfamily B, 5 [Source:MGI Sym... [more]
Pcdh12.540e-5426.40protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh12.540e-5426.40protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdhac23.679e-5327.95protocadherin alpha subfamily C, 2 [Source:MGI Sym... [more]
back to top
BLAST of Protocadherin-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9BZA7|PC11X_HUMAN1.128e-5427.11Protocadherin-11 X-linked OS=Homo sapiens OX=9606 ... [more]
sp|Q6WXV7|PC11X_PONPY3.280e-5427.23Protocadherin-11 X-linked OS=Pongo pygmaeus OX=960... [more]
sp|Q9BZA8|PC11Y_HUMAN5.802e-5427.37Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 ... [more]
sp|Q6WYY1|PC11X_PANPA6.563e-5427.11Protocadherin-11 X-linked OS=Pan paniscus OX=9597 ... [more]
sp|Q71M42|PC11X_PANTR6.736e-5427.11Protocadherin-11 X-linked OS=Pan troglodytes OX=95... [more]
back to top
BLAST of Protocadherin-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183A8853.945e-9629.85Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A2H1C5378.117e-9529.97Cadherin domain protein OS=Fasciola hepatica OX=61... [more]
A0A0R3VT892.076e-9430.94Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A0R3X3J45.319e-9429.08Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
A0A4E0R4751.081e-9329.97Protocadherin-1 OS=Fasciola hepatica OX=6192 GN=D9... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh18a3.312e-6227.79protocadherin 18a [Source:ZFIN;Acc:ZDB-GENE-000607... [more]
pcdh18a7.449e-6227.86protocadherin 18a [Source:ZFIN;Acc:ZDB-GENE-000607... [more]
ENSAMXT00000044488.11.610e-6128.55pep primary_assembly:Astyanax_mexicanus-2.0:8:9178... [more]
pcdh1g96.988e-5728.27protocadherin 1 gamma 9 [Source:ZFIN;Acc:ZDB-GENE-... [more]
pcdh1gc57.114e-5728.35protocadherin 1 gamma c 5 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh111.023e-5026.67protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
si:ch211-199f5.13.145e-4729.12protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660][more]
ENSPMAT00000008517.11.298e-4425.92pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
ENSPMAT00000010725.13.864e-3824.97pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 ... [more]
ENSPMAT00000004042.14.965e-3826.11pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO461899.456e-5127.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354121.887e-4325.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404704.274e-4226.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO417677.881e-3824.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO333604.566e-3728.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000041785.13.322e-6227.52protocadherin gamma-C5 [Source:NCBI gene;Acc:10116... [more]
pcdh1a2.360e-5626.41protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
pcdh1a2.669e-5626.41protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
ENSORLT00000033522.12.696e-5630.39pep primary_assembly:ASM223467v1:10:15043367:15050... [more]
ENSORLT00000035950.18.188e-5631.51pep primary_assembly:ASM223467v1:10:15034655:15043... [more]
back to top
BLAST of Protocadherin-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000008751.10.000e+0100.00SMESG000008751.1[more]
SMESG000008751.10.000e+0100.00SMESG000008751.1[more]
SMESG000023091.19.802e-12233.10SMESG000023091.1[more]
SMESG000068096.11.930e-10732.60SMESG000068096.1[more]
SMESG000076350.18.461e-10733.90SMESG000076350.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029094 ID=SMED30029094|Name=Protocadherin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=3639bp
GGACAATTTTTATATTTGAAATTTTATTTCGAAATATTTTCAACACATCT
TTTGGGAAATAGACGATTTTGATTGGTCGAGAAAAACTTTGATTGACTAA
TTAGAACAAAATAAAAAATAATTCAAAACTAGATACAAAAAGACATTGAA
CAACGAAAAAATCATTTAGAAAATAATGAAACTGTTTATTTTCATTAATT
TTCTTTGGATGCACTCTTACAACTTTGAAGCTAACGTCGTAAAGTATCGC
TTGAAAGAAGAAAGTGATATCAATACTCTGATTGGAAATATCTTCGAAGA
TTCTCGATCAGAATATATGAGAAAACCGAAAGAAAATTTCACTTACAAAA
TTTACACAACAGATATTGATTCAAACCTCACCAAGCTTGACTTTAAAGGC
CATTTATTGGTAAATAAACGAATAGACCGTGAATTTCTCTGTCCGAATGT
CGACAAGATCGACGATTGTCAATTGGAGTTGATGATCCATGCTTTCCCAG
ATCATTGGATAAAAGTATTTATAATAATTGAGGATATAAATGACAATAAA
CCGAAATTTCCCACCAAAGAAAAACGAATTAAAGTTAGTGAAAGTATTGC
TGTGGGCAATCAACTTCCTTTACAAACAGCCATGGATGAAGACTTGGAAT
ATTTTGGAGTCCAATCTTATAATCTTGAAGATAGTGAGCCATTTTTTTCT
TTACTGTACCGTCCGATGTTTAGCTTGACACTTGTTGTACTGAAGAAACT
TGATTTCGAGAATATTAGTCACCGATATTTCAATCTAACTTTAATTGCAT
GTGATGGGGGAACTCCCGTTCAATGCGATAAACAGAAATTACAAATAGAA
GTCACTGATTCCAACGATAACAACCCAATATTTGATCAAACTCAAAATTA
CAAATTTATCAAAGAATCTACTCCGATAGGCTCAGTGATTTTCATTTTCA
ACGCGTCTGACGCTGACAGCGGACTTTTCGGAAAGATCAACTTTAAACTG
TTACCAGCTAGAACAACAAAAAACAAAGTTTATTTTAATCTGAATTTCAA
TACAGGAGAACTGGTATTAATTACTAGTCTTAATGCAAAAATAGTTTCGA
AATTTATTTTGGATGTTGAAGCTAGAGATGAGAATGGAGTCGGGCCGTTT
TCGTCTCAGTGTCAATTAACGATTCGAGTTCAAGATGAAAATAATCACGC
TCCAATTTTATCACTTGGAGACAGAGAATCATTGACAATAATGGAGAATT
CTCCTGCCGGCGAGCATGTAGGTATGGTGATTGCCAGTGATGGGGATTTA
GAAGACAACGGAAAAGTCACTTGTGTTCTCTTGAAAAACGACAGCAACTA
CTTAGCATTGGATAGGTCTCATAATATGAAAGATGAAATTATATATAGAT
TAGTAACAACAAGAGTTTTTGATAGAGAATTATTAGATTATTTTACAATA
ATGATCTCCTGTCAAGATTATGGTAACCCTCCTCATCGGTCGTTTCAGTT
GTTCAATGTCTCAGTTGGTGATATAAATGAATTCCCTCCAAGTTTTTATC
ATTCCAATTATTCTATTTTTATTTCCGAAGATATAGAAATAAACAGTGCA
TTAATCCAAATAAAGGCTTTAGATAAGGATAAAACACATTCTCTTAACTA
TCATTTAGATCCTTCTGTGAATGATAAATTCCAAATTGATATTAATAAAG
GCATCTTAAAAAATATCGTCCACTTTGATAGAGAAGTCATTCCAAAATAT
ATTGTTCCGGTTTTTGTGACAGATCAAGTGAGAGGAACAATTCTCACCGG
TACAACAACAGTTTATATCACAGTTACTGATGTTAATGATAACACTCCGG
TCATGACGGGTATCAAACAATTTGTCATCCGAGAGAACGTTCAAATTTTA
ACATATGGGAATTTAATCGGAGAACTCCAAACTCAAGACTTAGACAACAG
CTACAATGCAACCGTAGTCTGTGATTTACTAAGCGTCCACGTTCTCTCCA
ACCATATGTCTTGGATTCGATTATTAAATCATTCCTTCGAAATTGACAAA
TATAAATGCAATTTATTTGTAAAATCCTCTCTAGACCGAGAACAAATTGA
TAAATATAAATTAAACATAATCATTTCTGATTTGGGAATACCAAAACGAA
GTAACATGGAAATCATAACGGTAATGGTTGAAGATGAAAATGACAATTCT
CCGATTTGGCGATATCAAAACAATCAAACAGCGTATCAGGTCAACGTGAC
GGCCGAAACCAATTTAAATCATCCAATTATATTGGTGCAAGCCACCGATA
TTGACGCAAAAAAAAACTCGAATATTTCCTATAATTTCGTCAACAATGAT
GTCAATTCGTTATGGTATGAAAAATATTTTACGATTTTAACTAGAAATGG
TGGCATATTTATGTCAAGAGATTTACAAGAAAGTGGAACGTACTATTTGA
AAATACAGGCAACTGATAATGGAAGTCCTCCGAGATTCTCTGACGTAACT
ATAATTACAGTGAAAATTTCCACTGCCGAAAAGACGAATTATTTGATAAA
AAACTCACAAATTAGTTTCACTTTAATTGTCGTAACATCCTTGGCATCTT
TCTCTATTTGTGTAGCGTTAATGGTTGGAATTATTTTGATGTGGAGGAAA
TCCTATCCAATACAGCTAAATAGTGACCGAACAACTGGAAATTGGGATGA
TCCTAAAACCTTGCAATGGGAAATCAGTCCGTTTGTTGATGTCGATCATA
GACCAAACGAATCAATTGTGCTAAATGATTCTAAGTTTTACAATTCAATG
ACTTCGGATTTGTGTAACATTTGTGTTGCTGATCCTTTATTAACTCAATT
CAGAGATTTCCCTCAAAACCGAATCGAATCAAACATTCCAAATCAGAATA
TCTTACAAAGTTCTGGTCATTTGCAATTTCGGCAATTTAGTCCCGACTTT
GATTCATCGAGTGTTGATTCTGGTCACGGTGCAAGCGAATACAATCCAAT
TAATTCTGAAGCAAAATTTAATCGATACCATCATGCATATGGAAATTCTA
CGTTAAGAGAACATTCGACTTTACAGGAAGAATCTCAAGTTTTATCCGAA
GACATTATCTCATCTTCAAAGCCTCCACAAATATATCAGAATGAATATTA
CAATCAAATTCGTTGTGTGTTTCTTGAGCTACCTCAATCAGCTCAACTTT
AATTTTGCTTAATTATAAAGTTGTGTATAATAAATAAATAAAATATTTAA
TTTTTGTAATGGAATATAATTTATTAATAATTATTAAAATTAAAAATCAC
CTACATAACCTTTGTACGACACATTTTACAAATACCAAACCACTAATTTA
TTACAATGAGATTTTCTGAATGCACACACACACAAATATTGTTAATAATT
TATAATAAATAATACTCTGAGATTGCAAACTTCAAAGTGTAAATTAGTAT
TTACTTCTCTTTCTCTCTTGTTATTTAAATGAATAGGATTCGACTAGATT
TTTAGTCACTGTGGCTGACCCGAAAATTTATCATCGCTATTAAAAAACCA
TATCAAATTTCAATTTCTTTTAAAGCGTTCGGTAAAGTGCTCGAATTTTT
GTGCTTATTTATATTTTATTCTCTTTTAATTAACACTTA
back to top

protein sequence of SMED30029094-orf-1

>SMED30029094-orf-1 ID=SMED30029094-orf-1|Name=SMED30029094-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1009bp
MKLFIFINFLWMHSYNFEANVVKYRLKEESDINTLIGNIFEDSRSEYMRK
PKENFTYKIYTTDIDSNLTKLDFKGHLLVNKRIDREFLCPNVDKIDDCQL
ELMIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQ
TAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHR
YFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTP
IGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLIT
SLNAKIVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPILSLGDR
ESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHN
MKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDI
NEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVND
KFQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRGTILTGTTTVYITV
TDVNDNTPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCD
LLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIII
SDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNLNHP
IILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDL
QESGTYYLKIQATDNGSPPRFSDVTIITVKISTAEKTNYLIKNSQISFTL
IVVTSLASFSICVALMVGIILMWRKSYPIQLNSDRTTGNWDDPKTLQWEI
SPFVDVDHRPNESIVLNDSKFYNSMTSDLCNICVADPLLTQFRDFPQNRI
ESNIPNQNILQSSGHLQFRQFSPDFDSSSVDSGHGASEYNPINSEAKFNR
YHHAYGNSTLREHSTLQEESQVLSEDIISSSKPPQIYQNEYYNQIRCVFL
ELPQSAQL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR002126Cadherin-like_dom
IPR013164Cadherin_N
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002126Cadherin-likePRINTSPR00205CADHERINcoord: 507..533
score: 24.43
coord: 66..85
score: 30.46
coord: 324..343
score: 30.05
coord: 542..559
score: 43.2
coord: 455..468
score: 34.88
coord: 309..321
score: 29.98
coord: 236..265
score: 28.5
IPR002126Cadherin-likeSMARTSM00112CA_2coord: 704..785
e-value: 0.013
score: 23.1
coord: 368..455
e-value: 3.2E-12
score: 56.6
coord: 584..676
e-value: 7.7E-13
score: 58.7
coord: 258..343
e-value: 3.1E-16
score: 69.9
coord: 150..234
e-value: 7.8E-10
score: 48.7
coord: 479..558
e-value: 3.3E-14
score: 63.2
IPR002126Cadherin-likePFAMPF00028Cadherincoord: 462..551
e-value: 4.7E-10
score: 39.8
coord: 566..668
e-value: 6.1E-10
score: 39.4
coord: 353..447
e-value: 4.5E-8
score: 33.4
coord: 691..780
e-value: 2.6E-11
score: 43.8
coord: 245..336
e-value: 1.3E-8
score: 35.2
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 559..674
e-value: 6.5E-17
score: 64.0
coord: 343..452
e-value: 8.2E-16
score: 60.4
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 675..793
e-value: 2.9E-16
score: 61.8
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 232..342
e-value: 2.0E-22
score: 81.8
coord: 453..558
e-value: 2.3E-19
score: 71.9
coord: 122..231
e-value: 5.6E-17
score: 64.2
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 21..121
e-value: 1.2E-11
score: 46.6
NoneNo IPR availablePANTHERPTHR24028FAMILY NOT NAMEDcoord: 492..782
coord: 10..534
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 245..345
score: 18.617
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 458..560
score: 21.533
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 18..128
score: 10.221
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 683..798
score: 15.307
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 560..678
score: 16.798
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 347..457
score: 17.039
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 129..236
score: 17.258
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 352..452
e-value: 5.21307E-17
score: 75.0425
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 462..556
e-value: 7.6226E-20
score: 83.1317
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 134..232
e-value: 2.43494E-13
score: 64.6421
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 245..341
e-value: 2.37868E-19
score: 81.9761
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 687..780
e-value: 9.28643E-14
score: 65.7977
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 565..674
e-value: 4.65616E-16
score: 72.3461
NoneNo IPR availableTMHMMTMhelixcoord: 799..821
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 548..558
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 666..676
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 224..234
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 116..126
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 121..228
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 684..777
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 230..337
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 352..450
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 553..670
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 445..562