Macrophage-expressed gene 1 protein

Overview
NameMacrophage-expressed gene 1 protein
Smed IDSMED30029077
Length (bp)2367
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Macrophage-expressed gene 1 protein (SMED30029077) t-SNE clustered cells

Violin plots show distribution of expression levels for Macrophage-expressed gene 1 protein (SMED30029077) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Macrophage-expressed gene 1 protein (SMED30029077) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Macrophage-expressed gene 1 protein (SMED30029077) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029077

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30029077SMESG000044682.1 Contig721uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30029077SMESG000044682.1 Contig721uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30029077SMESG000044682.1 Contig721newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30029077SMESG000044682.1 Contig721newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30029077SMESG000058940.1 Contig721uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30029077SMESG000058940.1 Contig721uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30029077SMESG000058940.1 Contig721newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30029077SMESG000058940.1 Contig721newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30029077SMESG000044681.1 dd_Smed_v4_983_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30029077SMESG000044681.1 dd_Smed_v4_983_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30029077SMESG000044681.1 dd_Smed_v4_983_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029077SMESG000044681.1 dd_Smed_v4_983_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30029077SMESG000044681.1 dd_Smed_v4_983_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Human
Match: MPEG1 (macrophage expressed 1 [Source:HGNC Symbol;Acc:HGNC:29619])

HSP 1 Score: 352.058 bits (902), Expect = 1.372e-109
Identity = 216/636 (33.96%), Postives = 331/636 (52.04%), Query Frame = 1
Query:  151 QLCQLMPNQRTFDVLPGSGWDNLANIGMGRILDLNFSKCSFSNDNKYLIPNQLAIYPEKSSQVEISSEIFRHFSNYTSMSSQSINVGAEGGYGIF-KIGGSFSTENTKIKSDQMETKSIFTRVQLRYLGFQSMFEPDTPLYPTFKNRIMDIAGLVVENKDSLYPEYLADMIVRDYGTHVIRAIDAGAILSKTDALNSQYVKKYEXXXXXXXXXXXXXXXXXXKIDGKYQTKTTQTNI--DEFNHNVVKTHIDTVGGAIFGANTSLSDWENSVMNNLVPIDRRGEPLYYAITPRALPELDQETVHKIYVLIKKAILRYYTANGRIGCLDIYSPNFNPDANIDSGNCEHPSVNFTFGGTYQVCGGPA-------CGPYAQVNPLTGGFSCPSGFISIKLHSGL-------VRCDESCHGWWFWRSCDTTC--------SYFTTFWCYPVNIGPNYNGYQFGGI----------RQGSCPIGYIPLKVGLSIEICVTVDADPFNPYAIKFGGFFSCSAGNPLAQEYVKN---KPKLYSSSKMADLKYWPKTCAKGYVAHISSIEQGCQISYCTETNKVSLGPLPRIIKPPFIS--IDYNPNSTKVLIFTTKNGETFIKDN-VGSWKLEDIQREKRNMLV 1935
            Q C+        +VLPG GWDNL N+ MGR+++L +S C  + D +Y+IP+++   P+K S +E++SEI   ++NY S +S SIN        +F K+ G FSTE  ++K+ Q++ ++I TRVQ+R L +     P   L   F+  ++DI+  + EN  +    YLA+++V +YGTHV  ++DAGA L + D L + +++  +S SS  +V+ASA       ++ K++   T  N+    +  N   + + ++GG  F    +L  W+  + N+LV IDR G PL++ I P  LP+L    V K+   ++ A+ RYYT N   GC D+ SPNFN  AN D G+CE    NF+FGG YQ C   +       C    Q NPLTG FSCPSG+  + L S +       + C   C    F   C T C        + F  FWC   +  P  +G  FGG+             SCP GY PL++  ++++CV+ D +  + +A+ FGGFFSC+ GNPL    +      P L             K C  G+  H + I  GCQ+SYC ++   + G LP    PPF    +     +  V++  ++N  ++IKD+    W+L +    +R M V
Sbjct:   32 QKCKNALKLPVLEVLPGGGWDNLRNVDMGRVMELTYSNCRTTEDGQYIIPDEIFTIPQKQSNLEMNSEILESWANYQSSTSYSINTE----LSLFSKVNGKFSTEFQRMKTLQVKDQAITTRVQVRNLVYTVKINPTLELSSGFRKELLDISDRL-ENNQTRMATYLAELLVLNYGTHVTTSVDAGAALIQEDHLRASFLQ--DSQSSRSAVTASAGLAFQNTVNFKFEENYTSQNVLTKSYLSNRTNSRVQSIGGVPFYPGITLQAWQQGITNHLVAIDRSGLPLHFFINPNMLPDLPGPLVKKVSKTVETAVKRYYTFNTYPGCTDLNSPNFNFQANTDDGSCEGKMTNFSFGGVYQECTQLSGNRDVLLCQKLEQKNPLTGDFSCPSGYSPVHLLSQIHEEGYNHLECHRKCTLLVF---CKTVCEDVFQVAKAEFRAFWCVASSQVPENSGLLFGGLFSSKSINPMTNAQSCPAGYFPLRLFENLKVCVSQDYELGSRFAVPFGGFFSCTVGNPLVDPAISRDLGAPSL-------------KKCPGGFSQHPALISDGCQVSYCVKSGLFTGGSLPPARLPPFTRPPLMSQAATNTVIVTNSENARSWIKDSQTHQWRLGEPIELRRAMNV 644          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Zebrafish
Match: mpeg1.1 (macrophage expressed 1, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030131-7347])

HSP 1 Score: 328.176 bits (840), Expect = 8.432e-101
Identity = 217/680 (31.91%), Postives = 335/680 (49.26%), Query Frame = 1
Query:  142 DAYQLCQLMPNQRTFDVLPGSGWDNLANIGMGRILDLNFSKCSFSNDNKYLIPNQLAIYPEKSSQVEISSEIFRHFSNYTSMSSQSINVGAEGGYGIFKI-GGSFSTENTKIKSDQMETKSIFTRVQLRYLGFQSMFEPDTPLYPTFKNRIMDIAGLVVENKDSLYPEYLADMIVRDYGTHVIRAIDAGAILSKTDALNSQYVKKYEXXXXXXXXXXXXXXXXXXKIDGKYQTKTTQTNIDEFNHNVVKTHIDTVGGAIFGANTSLSDWENSVMNNLVPIDRRGEPLYYAITPRALPELDQETVHKIYVLIKKAILRYYTANGRIGCLDIYSPNFNPDANIDSGNCEHPSVNFTFGGTYQVC------GGPACGPYAQVNPLTGGFSCPSGFISIKLHSGLV-------RCDESCHGWWFW---RSCDTTC--------SYFTTFWCYPVNIGPNYNGYQFGGI----------RQGSCPIGYIPLK-VGLSIEICVTVDADPFNPYAIKFGGFFSCSAGNPLAQEYVKNKPKLYSSSKMADLKYWPKTCAKGYVAHISSIEQGCQISYCTETNKVSLG-----PLPRIIKPPFISIDYNPNSTKVLIFTTKNGETFIK-DNVGSWKLE---DIQR-------------EKRNMLVGSIVGSFLMAACICLTIFFIQRRH 2007
            +  +LC+   +    +VLPG GWDNL NI MGR+++L++S+C  + D  YLIP+++ + P+K S VE +SEI   +    S +S S+N         F +    FSTEN ++K+ Q++  S+  RVQ+R   +     PD  L   F  +  +IA   +EN  + +  YL++ +V DYGTHVI ++DAGA L + D L   Y+   +SD S++S SA A+F    K D    T    +    +  N+  + I + GGA+F    +L  W+ S +NNLV IDR G PL+Y + P   P+L   TV+K+   ++KA  RYY  N   GC+++ SPNFN  AN+D  +CE P  N +FGG YQ C      G   C   AQ NP TGG+SCP  + +  LHS +V        C   CH   F      CD TC        +   T WC   +  P  +GY FGG+          +  SCP  Y   + +   + IC++ D +    +++ F GFFSC +GNPL+    +                    C   +  H+++I  GCQ+ YC ++   S G      LP   +PP + +     +T  +   T+   ++++      W+L    DI++             +K  + +G IV   L+A  +  T+  ++RR+
Sbjct:   28 NGLRLCRKNSSLTALEVLPGGGWDNLRNIDMGRVMNLSYSQCQTTEDGVYLIPDEVFVIPQKVSGVETNSEIIMSWLEQKSSTSSSVNADVS----FFSVLNAKFSTENQRMKTHQVKEGSVTARVQVRNHLYTVKAYPDFTLDSRFAKQAEEIAD-AIENNQTRHANYLSEKLVLDYGTHVITSVDAGATLVQEDYLKMSYISNSQSDKSSVSASAGANFFDKVKFDIGGNTSQGSSQSSSYQGNITYSLIQSHGGALFYPGITLQKWQQSTLNNLVAIDRSGLPLHYFLNPSTFPDLPTPTVNKLASTVRKAAERYYKVNTIPGCVNVDSPNFNFQANVDDASCEGPITNLSFGGIYQRCTPLTPDGNIICDETAQKNPATGGYSCPQHYNTTLLHSEIVEKGFNHYECHTHCHSCGFLGLSTCCDKTCGDSYHVRRAKLETLWCSSTHKTPENSGYLFGGLFGPGIQNPLTKSSSCPPSYFTQRFLSNGMMICMSNDYEIGTRFSVPFAGFFSCQSGNPLSNGQSR--------------------CPPQFSQHLAAISDGCQVLYCVQSGVFSGGHLKPVRLPPFTRPPVVGMI----ATNTVAVMTEGERSWVRVGETKMWRLAKPGDIKQMQSILDASEMSGGKKAGVAIGIIV---LVALVVAGTVVIMKRRN 675          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Zebrafish
Match: mpeg1.1 (macrophage expressed 1, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030131-7347])

HSP 1 Score: 328.176 bits (840), Expect = 8.432e-101
Identity = 217/680 (31.91%), Postives = 335/680 (49.26%), Query Frame = 1
Query:  142 DAYQLCQLMPNQRTFDVLPGSGWDNLANIGMGRILDLNFSKCSFSNDNKYLIPNQLAIYPEKSSQVEISSEIFRHFSNYTSMSSQSINVGAEGGYGIFKI-GGSFSTENTKIKSDQMETKSIFTRVQLRYLGFQSMFEPDTPLYPTFKNRIMDIAGLVVENKDSLYPEYLADMIVRDYGTHVIRAIDAGAILSKTDALNSQYVKKYEXXXXXXXXXXXXXXXXXXKIDGKYQTKTTQTNIDEFNHNVVKTHIDTVGGAIFGANTSLSDWENSVMNNLVPIDRRGEPLYYAITPRALPELDQETVHKIYVLIKKAILRYYTANGRIGCLDIYSPNFNPDANIDSGNCEHPSVNFTFGGTYQVC------GGPACGPYAQVNPLTGGFSCPSGFISIKLHSGLV-------RCDESCHGWWFW---RSCDTTC--------SYFTTFWCYPVNIGPNYNGYQFGGI----------RQGSCPIGYIPLK-VGLSIEICVTVDADPFNPYAIKFGGFFSCSAGNPLAQEYVKNKPKLYSSSKMADLKYWPKTCAKGYVAHISSIEQGCQISYCTETNKVSLG-----PLPRIIKPPFISIDYNPNSTKVLIFTTKNGETFIK-DNVGSWKLE---DIQR-------------EKRNMLVGSIVGSFLMAACICLTIFFIQRRH 2007
            +  +LC+   +    +VLPG GWDNL NI MGR+++L++S+C  + D  YLIP+++ + P+K S VE +SEI   +    S +S S+N         F +    FSTEN ++K+ Q++  S+  RVQ+R   +     PD  L   F  +  +IA   +EN  + +  YL++ +V DYGTHVI ++DAGA L + D L   Y+   +SD S++S SA A+F    K D    T    +    +  N+  + I + GGA+F    +L  W+ S +NNLV IDR G PL+Y + P   P+L   TV+K+   ++KA  RYY  N   GC+++ SPNFN  AN+D  +CE P  N +FGG YQ C      G   C   AQ NP TGG+SCP  + +  LHS +V        C   CH   F      CD TC        +   T WC   +  P  +GY FGG+          +  SCP  Y   + +   + IC++ D +    +++ F GFFSC +GNPL+    +                    C   +  H+++I  GCQ+ YC ++   S G      LP   +PP + +     +T  +   T+   ++++      W+L    DI++             +K  + +G IV   L+A  +  T+  ++RR+
Sbjct:   28 NGLRLCRKNSSLTALEVLPGGGWDNLRNIDMGRVMNLSYSQCQTTEDGVYLIPDEVFVIPQKVSGVETNSEIIMSWLEQKSSTSSSVNADVS----FFSVLNAKFSTENQRMKTHQVKEGSVTARVQVRNHLYTVKAYPDFTLDSRFAKQAEEIAD-AIENNQTRHANYLSEKLVLDYGTHVITSVDAGATLVQEDYLKMSYISNSQSDKSSVSASAGANFFDKVKFDIGGNTSQGSSQSSSYQGNITYSLIQSHGGALFYPGITLQKWQQSTLNNLVAIDRSGLPLHYFLNPSTFPDLPTPTVNKLASTVRKAAERYYKVNTIPGCVNVDSPNFNFQANVDDASCEGPITNLSFGGIYQRCTPLTPDGNIICDETAQKNPATGGYSCPQHYNTTLLHSEIVEKGFNHYECHTHCHSCGFLGLSTCCDKTCGDSYHVRRAKLETLWCSSTHKTPENSGYLFGGLFGPGIQNPLTKSSSCPPSYFTQRFLSNGMMICMSNDYEIGTRFSVPFAGFFSCQSGNPLSNGQSR--------------------CPPQFSQHLAAISDGCQVLYCVQSGVFSGGHLKPVRLPPFTRPPVVGMI----ATNTVAVMTEGERSWVRVGETKMWRLAKPGDIKQMQSILDASEMSGGKKAGVAIGIIV---LVALVVAGTVVIMKRRN 675          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Zebrafish
Match: mpeg1.3 (macrophage expressed 1, tandem duplicate 3 [Source:ZFIN;Acc:ZDB-GENE-081105-5])

HSP 1 Score: 317.005 bits (811), Expect = 4.026e-97
Identity = 196/603 (32.50%), Postives = 308/603 (51.08%), Query Frame = 1
Query:  106 LVRGSNEVNTIKDAYQLCQLMPNQRTFDVLPGSGWDNLANIGMGRILDLNFSKCSFSNDNKYLIPNQLAIYPEKSSQVEISSEIFRHFSNYTSMSSQSINVGAEGGYGIFK-IGGSFSTENTKIKSDQMETKSIFTRVQLRYLGFQSMFEPDTPLYPTFKNRIMDIAGLVVENKDSLYPEYLADMIVRDYGTHVIRAIDAGAILSKTDALNSQYVKKYEXXXXXXXXXXXXXXXXXXKIDGKYQTKTTQTNIDEFNHNVVKTHIDTVGGAIFGANTSLSDWENSVMNNLVPIDRRGEPLYYAITPRALPELDQETVHKIYVLIKKAILRYYTANGRIGCLDIYSPNFNPDANIDSGNCEHPSVNFTFGGTYQVC------GGPACGPYAQVNPLTGGFSCPSGFISIKLHSGLV-------RCDESCH--GWWFWRS-CDTTC--------SYFTTFWCYPVNIGPNYNGYQFGGI----------RQGSCPIG-YIPLKVGLSIEICVTVDADPFNPYAIKFGGFFSCSAGNPLAQEYVKNKPKLYSSSKMADLKYWPKTCAKGYVAHISSIEQGCQISYCTETNKVSLGPLPRIIKPPFIS 1806
            L+R SN +N        C    N    +VLPG GWDNL NI MGR+++L++S+C  + D  YLIP+++ + P+K + VE +SE+   + +  S +S SIN         F  + G FS E+ +IK+ Q++  S+ +RVQ+R   +     P+ PL   F  ++ +IA  +  ++  L   YL++ ++ DYGTHVI +++AGA L + D L   Y+ K + D S++S SA  +F    K+D  Y      +    +  N+  + I + GGA+F    +L  W+ S +NNLV IDR G PL+Y + P   P++ +  V K+ + + +A  +YY  N   GC+++ S NFN  AN+D  +CE P  N +FGG YQ C      G   C   AQ NP TGG+SC   + +  L S ++        C ++C   G+  W + C  TC        +   T WCY     P Y+GY FGG+          R  +CP   ++   +  +I +C++ D       A+ FGGFFSC +GNPL+    +  P+                    +  H+++I  GCQ+ YC ++   S G L  ++ PP+ S
Sbjct:   23 LIRPSNGLNE-------CHKNSNLVALEVLPGGGWDNLRNIDMGRVMNLSYSQCQTTEDGVYLIPDEVFVIPQKENTVETNSEMIMSWLDQKSSTSSSINADVS----FFSWLNGKFSREHQRIKTHQVKESSVTSRVQVRNRLYTVKAYPNFPLDSRFAQQVEEIADAITNDQTRL-ATYLSEKLILDYGTHVITSVEAGASLVQEDYLKMSYILKNQLDLSSVSASAGFNFFDKVKLDPSYNGGQKTSLNSSYQGNITYSLIQSHGGALFYPGMTLQKWQESTLNNLVAIDRSGLPLHYFLNPSTFPDISEALVRKLALSVSQAAEQYYKVNTIPGCVNVDSKNFNFQANVDDVSCEGPITNLSFGGMYQQCTPLTIDGSTICDEMAQKNPATGGYSCSQKYNTTLLRSEIIERGYTRYECQDNCRSCGFLGWSTCCSQTCNNVNYIRRAKVDTLWCYSTQKIPEYSGYIFGGLYGPSMQNPFTRSYTCPPNFFVQPILSRAIMVCLSNDYVKATKSAVPFGGFFSCQSGNPLSNGESRCPPQ--------------------FSQHLAAISDGCQVLYCVQSGVFSGGQLKPVLLPPYTS 593          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Zebrafish
Match: mpeg1.2 (macrophage expressed 1, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-050522-305])

HSP 1 Score: 309.301 bits (791), Expect = 9.226e-94
Identity = 201/630 (31.90%), Postives = 307/630 (48.73%), Query Frame = 1
Query:  157 CQLMPNQRTFDVLPGSGWDNLANIGMGRILDLNFSKCSFSNDNKYLIPNQLAIYPEKSSQVEISSEIFRHFSNYTSMSSQSINVGAEGGYGIFKIGGSFSTENTKIKSDQMETKSIFTRVQLRYLGFQSMFEPDTPLYPTFKNRIMDIAGLVVENKDSLYPEYLADMIVRDYGTHVIRAIDAGAILSKTDALNSQYVKKYEXXXXXXXXXX-XXXXXXXXKIDGKYQTKTTQTNIDEFNHNVVKTHIDTVGGAIFGANTSLSDWENSVMNNLVPIDRRGEPLYYAITPRALPELDQETVHKIYVLIKKAILRYYTANGRIGCLDIYSPNFNPDANIDSGNCEHPSVNFTFGGTYQVC------GGPACGPYAQVNPLTGGFSCPSGFISIKLHSGLVR-------CDESCHG-WWFWRSCDTTC--------SYFTTFWCYPVNIGPNYNGYQFGGI----------RQGSCPIGYIPLKVGLS--IEICVTVDADPFNPYAIKFGGFFSCSAGNPLAQEYVKNKPKLYSSSKMADLKYWPKTCAKGYVAHISSIEQGCQISYCTETNKVSLGP-----LPRIIKPPFISIDYNPNSTKVLIFTTKNGETFIK-DNVGSWKLEDIQREKR 1923
            C+   N    +VLPG GWDNL N+ +GR+++L +S+C  + D  YLIP+++ + P K+S VE  SE    + +  S +S SIN  A+  Y +  + G FS ENT++K  Q+   S+ TRVQ+R   +     PD  L   F  +I ++A   +EN  +    YL++ ++ +YGTHVI +IDAGA L + D +   YV    S+ S++S SA    F  +    G  +T+ T   +  +  N+  + + + GGA+F    ++  W+ S  N+LV IDR G P++Y + P   P+L   T+HK+   ++KA  RYY  N   GC D  S NFN  AN++  +CE P  N TFGG YQ C      G   C  +AQ NP TG F+C   + + +LHS  V+       C E CH  W     C   C        +   T+WC      P   GY FGG+          +   CP  Y   +V L+  + IC++ D +     ++ FGG FSC +GNP A    +                    C   Y  H+++I  GCQ+ YC ++   + G      LP   KPP I    N  +T  +   T+  + +++      W++ ++    R
Sbjct:   30 CRQNSNLTALEVLPGGGWDNLRNLDVGRVMNLTYSQCQTTEDGLYLIPDEVFVIPRKTSGVETHSETIMSWLDQRSSTSGSIN--ADASY-LTVLNGKFSEENTRMKIHQVRGNSVTTRVQVRNHLYTVNAYPDFTLDSRFSQQISELAD-AIENNQTRQAMYLSEKVILEYGTHVITSIDAGATLVQEDYIKRSYVSDTNSERSSVSASAGINFFNMVNFNFGSKETEQTSETLT-YQQNITYSLVQSHGGALFYQGITMQKWQESTQNHLVAIDRSGLPIHYFLNPAVFPDLPVPTLHKLAFSVQKAAERYYNINTTPGCTDQSSQNFNFQANVNDTSCEGPVTNLTFGGVYQTCTPESPDGNVICDEFAQRNPDTGDFTCRQPYSATRLHSENVQQGYNNYECHEECHSCWLILDCCHQVCGNVYYVRQAQIDTYWCSTSQTVPENTGYLFGGLFGPSLQNPQTKSHDCPANYFE-QVFLTNGMRICLSNDYEAGTISSVPFGGLFSCQSGNPQAGNQYR--------------------CPPQYSQHLATISDGCQVLYCVQSGVFTGGQLKPVHLPPFTKPPLI----NMMATNTVAVMTEGDKAWMRVGGTKKWRVANLGEVSR 629          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Zebrafish
Match: mpeg1.1 (macrophage expressed 1, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030131-7347])

HSP 1 Score: 68.5514 bits (166), Expect = 9.185e-14
Identity = 26/64 (40.62%), Postives = 44/64 (68.75%), Query Frame = 1
Query:  142 DAYQLCQLMPNQRTFDVLPGSGWDNLANIGMGRILDLNFSKCSFSNDNKYLIPNQLAIYPEKSS 333
            +  +LC+   +    +VLPG GWDNL NI MGR+++L++S+C  + D  YLIP+++ + P+K +
Sbjct:   28 NGLRLCRKNSSLTALEVLPGGGWDNLRNIDMGRVMNLSYSQCQTTEDGVYLIPDEVFVIPQKKT 91          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Mouse
Match: Mpeg1 (macrophage expressed gene 1 [Source:MGI Symbol;Acc:MGI:1333743])

HSP 1 Score: 338.191 bits (866), Expect = 2.044e-104
Identity = 213/687 (31.00%), Postives = 339/687 (49.34%), Query Frame = 1
Query:  145 AYQLCQLMPNQRTFDVLPGSGWDNLANIGMGRILDLNFSKCSFSNDNKYLIPNQLAIYPEKSSQVEISSEIFRHFSNYTSMSSQSINVGAEGGYGIF-KIGGSFSTENTKIKSDQMETKSIFTRVQLRYLGFQSMFEPDTPLYPTFKNRIMDIAGLVVENKDSLYPEYLADMIVRDYGTHVIRAIDAGAILSKTDALNSQYV--KKYEXXXXXXXXXXXXXXXXXXKIDGKYQTKTTQTNIDEFNHNVVKTHIDTVGGAIFGANTSLSDWENSVMNNLVPIDRRGEPLYYAITPRALPELDQETVHKIYVLIKKAILRYYTANGRIGCLDIYSPNFNPDANIDSGNCEHPSVNFTFGGTYQVC----GGPACGPYAQVNPLTGGFSCPSGFISIKLHS-------GLVRCDESCHGWWFWRSCDTTC--------SYFTTFWCYPVNIGPNYNGYQFGGI----------RQGSCPIGYIPLKVGLSIEICVTVDADPFNPYAIKFGGFFSCSAGNPLAQEYVKNKPKLYSSSKMADLKYWPKTCAKGYVAHISSIEQGCQISYCTETNKVSLGP-----LPRIIKPPFISIDYNPNSTKVLIFTTKNGETFIKD-NVGSWKLEDIQREKRNMLV---------GSIVGSFLMAACICLTIFFIQRRHYKRMIEKLDYKPLTKNEQL 2064
             +Q+C+        +VLPG GWDNL N+ MGR++DL ++ C  + D +Y+IP+++   P+K S +E++SE+   + NY S +S SIN        +F ++ G FSTE  ++K+ Q++ +++ TRVQ+R   +     P + L   F   +MDI   + +N+  +   YLA++++ +YGTHVI ++DAGA L + D + S ++   +   ++ T S   +   +  FK++  Y ++T+ T   ++  N   + + + GG  F    +L  W+  + N+LV IDR G PL++ I P  LP L    V K+   ++ A+  YYT N   GC ++ SPNFN  AN+D  +C+    NFTFGG YQ C    G   C    Q N LTG FSCP G+  + L S         + C + C    F   C T C        + F  +WC      P+ +G  FGG+             SCP GYIPL +  S+++CV++D +    +++ FGGFFSC  GNPL         +  S  K          C  G+  H++ I  GCQ+SYC +    + G      LP   KPP +S      +  V++  ++   ++IKD     WKL +    +R M V         G       +   I L +      +  R  +K +Y+ + + E L
Sbjct:   37 GFQICKNALKLPVLEVLPGGGWDNLRNVDMGRVMDLTYTNCKTTEDGQYIIPDEVYTIPQKESNLEMNSEVLESWMNYQSTTSLSINTE----LALFSRVNGKFSTEFQRMKTLQVKDQAVTTRVQVRNRIYTVKTTPTSELSLGFTKALMDICDQLEKNQTKM-ATYLAELLILNYGTHVITSVDAGAALVQEDHVRSSFLLDNQNSQNTVTASAGIAFLNIVNFKVETDYISQTSLTK--DYLSNRTNSRVQSFGGVPFYPGITLETWQKGITNHLVAIDRAGLPLHFFIKPDKLPGLPGPLVKKLSKTVETAVRHYYTFNTHPGCTNVDSPNFNFQANMDDDSCDAKVTNFTFGGVYQECTELSGDVLCQNLEQKNLLTGDFSCPPGYTPVHLLSQTHEEGYSRLECKKKCTLKIF---CKTVCEDVFRVAKAEFRAYWCVAAGQVPDNSGLLFGGVFTDKTINPMTNAQSCPAGYIPLNLFESLKVCVSLDYELGFKFSVPFGGFFSCIMGNPLVNSDTAKDVRAPSLKK----------CPGGFSQHLAVISDGCQVSYCVKAGIFTGGSLLPVRLPPYTKPPLMS---QVATNTVIVTNSETARSWIKDPQTNQWKLGEPLELRRAMTVIHGDSNGMSGGEAAGITLGVTIALGVVITLAIYGTRKYKKKEYQEIEEQESL 700          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Mouse
Match: Pfpl (pore forming protein-like [Source:MGI Symbol;Acc:MGI:1860266])

HSP 1 Score: 321.242 bits (822), Expect = 2.974e-98
Identity = 204/684 (29.82%), Postives = 342/684 (50.00%), Query Frame = 1
Query:  145 AYQLCQLMPNQRTFDVLPGSGWDNLANIGMGRILDLNFSKCSFSNDNKYLIPNQLAIYPEKSSQVEISSEIFRHFSNYTSMSSQSINVGAEGGYGIFKIGGSFSTENTKIKSDQMETKSIFTRVQLRYLGFQSMFEPDTPLYPTFKNRIMDIAGLVVENKDSLYPEYLADMIVRDYGTHVIRAIDAGAILSKTDALNSQYVK--KYEXXXXXXXXXXXXXXXXXXKIDGKYQTKTTQTNIDE-FNHNVVKTHIDTVGGAIFGANTSLSDWENSVMNNLVPIDRRGEPLYYAITPRALPELDQETVHKIYVLIKKAILRYYTANGRIGCLDIYSPNFNPDANIDSGNCEHPSVNFTFGGTYQVCGGPA-------CGPYAQVNPLTGGFSCPSGFISIKLHSGL-------VRCDESCHGWWFWRSCDTTC--------SYFTTFWCYPVNIGPNYNGYQFGGI----------RQGSCPIGYIPLKVGLSIEICVTVDADPFNPYAIKFGGFFSCSAGNPLAQEYVKNKPKLYSSSKMADLK--YWPKTCAKGYVAHISSIEQGCQISYCTETNKVSLGPLPRIIKPPFISIDYNPNSTKVLIFTTKNGETFIKDNVG-SWKLEDIQREKRNMLVGSIVGSFLMAACICLTIFFIQRRHYKRMIEKLDYKPLTKNEQLADYGSI 2082
             +Q CQ   N    +VLPG GWDNL N+ MG+++DL ++ C  + D +Y+IP+ +   P+K S +E++SEI   + NY S +S SIN+  +      ++ G FS+E  +IK+ Q+  +++ TR Q+R L +     P+  L   FK  +M+I   + +N+  +   YLA++++ +YGTH+I ++DAGA L + D + S Y+K  K    +   S   + + +  FKI+  ++    Q N+   +  N   + + ++GG  F    ++  W+  ++N+LV +DR G PL++ I P  LP   +  V ++   ++ A   YY  N   GC +I SPNF+  AN D G+C+   VN  FGG YQ+C   +       C  + Q NPLTG FSCP  +  + L S         + C + C    F   C T+C        +  +++WC   +  P  +G  FGG+           + SCP  Y PLK+  ++++CV++D +    Y++ FGGFFSC+ GNP           LY S    DL+  + PK C  G+   +++I  GCQ+SYC +    +   L     PP+  +  +  ST  +  T ++  +++KD     W LE+  +  R  L G    +  +   + L +      +  R  +K     L + + L  +  +
Sbjct:   30 GFQKCQNALNLPVLEVLPGGGWDNLRNMDMGQVMDLTYNNCKTTEDGQYIIPDDVFTIPQKESNLEMNSEILDSWENYRSTTSFSINLNLDYRP---RVNGKFSSEFQRIKTTQVRDQAVTTRAQVRNLVYTVKANPNAELNLGFKKELMEICDRLEKNQTKM-ATYLAELLILNYGTHIITSVDAGATLVQEDHVKSSYLKNNKGNRAAVAASAGFTFAKVVNFKIETGFEY---QNNLATGYLQNRTGSRVQSIGGIPFYPGMTIETWQKGIINHLVAVDRAGLPLHFFIKPEKLPAFPRHLVEQLAKTVETAAESYYNFNTYPGCTNINSPNFDFQANTDDGSCDGKLVNAPFGGVYQLCRQLSGHDYDDMCLDFHQKNPLTGDFSCPPDYTPVHLLSQTHEKGYTGMECRDKCILKIF---CRTSCKDEFRVAKAEVSSYWCAASSQVPENSGILFGGVFTDKSINPMTNEPSCPTSYFPLKLFENVKVCVSLDHELGPKYSVPFGGFFSCTKGNP-----------LYGSFTSGDLEKSFLPK-CPGGFSQQLAAIIDGCQVSYCVKAGVFTRASLAPARLPPYTQLPMSQLSTDSVEMTGESPISWVKDPYTLQWNLEESSKSGR--LSGGSTAAITIVVILALGVLTAMAIYGNRRFKKNKPNGLPRQQALLPFPRV 689          
BLAST of Macrophage-expressed gene 1 protein vs. UniProt/SwissProt
Match: sp|Q5RBP9|MPEG1_PONAB (Macrophage-expressed gene 1 protein OS=Pongo abelii OX=9601 GN=MPEG1 PE=2 SV=1)

HSP 1 Score: 354.755 bits (909), Expect = 6.707e-110
Identity = 215/631 (34.07%), Postives = 334/631 (52.93%), Query Frame = 1
Query:  151 QLCQLMPNQRTFDVLPGSGWDNLANIGMGRILDLNFSKCSFSNDNKYLIPNQLAIYPEKSSQVEISSEIFRHFSNYTSMSSQSINVGAEGGYGIF-KIGGSFSTENTKIKSDQMETKSIFTRVQLRYLGFQSMFEPDTPLYPTFKNRIMDIAGLVVENKDSLYPEYLADMIVRDYGTHVIRAIDAGAILSKTDALNSQYVKKYEXXXXXXXXXXXXXXXXXXKIDGKYQTKTTQTNI--DEFNHNVVKTHIDTVGGAIFGANTSLSDWENSVMNNLVPIDRRGEPLYYAITPRALPELDQETVHKIYVLIKKAILRYYTANGRIGCLDIYSPNFNPDANIDSGNCEHPSVNFTFGGTYQVCGGPA-------CGPYAQVNPLTGGFSCPSGFISIKLHSGL-------VRCDESCHGWWFWRSCDTTC--------SYFTTFWCYPVNIGPNYNGYQFGGI----------RQGSCPIGYIPLKVGLSIEICVTVDADPFNPYAIKFGGFFSCSAGNPLAQEYVKNKPKLYSSSKMADLKYWPKTCAKGYVAHISSIEQGCQISYCTETNKVSLGPLPRIIKPPFIS--IDYNPNSTKVLIFTTKNGETFIKDN-VGSWKLEDIQREKRNM 1929
            Q C+        +VLPG GWDNL N+ MGR+++L +S C  + D +Y+IP+++   P+K S +E++SEI   ++NY S +S SIN        +F K+ G FSTE  ++K+ Q++ ++I TRVQ+R L +     P   L  +F+  ++DI+  + EN  +    YLA+++V +YGTHVI ++DAGA L + D + + +++  +S SS  +V+ASA       ++ K++   T  N+    +  N   + + ++GG  F    +L  W+  + N+LV IDR G PL++ I P  LP+L    V K+   ++ A+ RYYT N   GC D+ SPNFN  AN D G+CE    NF+FGG YQ C   +       C    Q NPLTG FSCPSG+  ++L S +       + C   C    F   C T C        + F  FWC   +  P  +G  FGG+             SCP GY PL +  ++++CV+ D +  + +A+ FGGFFSC+ GNPL        P +     +  L    K C  G+  H++ I  GCQ+SYC ++   + G LP    PPF    +     +  V++  ++N  ++IKD+    W+L +    +R M
Sbjct:   32 QKCKNALKLPVLEVLPGGGWDNLRNVDMGRVMELTYSNCRTTEDGQYIIPDEIFTIPQKQSNLEMNSEILESWANYQSSTSYSINTE----LSLFSKVNGKFSTEFQRMKTLQLKDQAITTRVQVRNLIYTVKINPALELNWSFRKELLDISDRL-ENNQTRMATYLAELLVLNYGTHVITSVDAGAALIQEDHIRASFLQ--DSQSSRSAVTASAGLAFQNTVNFKFEENYTSQNVLTKSYLSNRTNSRVQSIGGVPFYPGITLQAWQQGITNHLVAIDRSGLPLHFFINPNMLPDLPGPLVKKVSKTVETAVKRYYTFNTYPGCTDLNSPNFNFQANTDDGSCEGKMTNFSFGGVYQECTQLSGNRDVLLCQKLEQKNPLTGDFSCPSGYSPVRLLSQIHEEGYNHLECHRKCTLLVF---CKTVCEDVFQVAKAEFRAFWCVASSQVPENSGLLFGGLFSSKSINPMTNAQSCPAGYFPLSLFENLKVCVSQDYELGSRFAVPFGGFFSCTVGNPLVD------PAISRDLGVPSL----KKCPGGFSQHLALISDGCQVSYCVKSGLFTGGSLPPARLPPFTRPPLMSQAATNTVIVTNSENARSWIKDSQTHQWRLGEPIELRRAM 642          
BLAST of Macrophage-expressed gene 1 protein vs. UniProt/SwissProt
Match: sp|Q2M385|MPEG1_HUMAN (Macrophage-expressed gene 1 protein OS=Homo sapiens OX=9606 GN=MPEG1 PE=1 SV=1)

HSP 1 Score: 352.058 bits (902), Expect = 6.590e-109
Identity = 216/636 (33.96%), Postives = 331/636 (52.04%), Query Frame = 1
Query:  151 QLCQLMPNQRTFDVLPGSGWDNLANIGMGRILDLNFSKCSFSNDNKYLIPNQLAIYPEKSSQVEISSEIFRHFSNYTSMSSQSINVGAEGGYGIF-KIGGSFSTENTKIKSDQMETKSIFTRVQLRYLGFQSMFEPDTPLYPTFKNRIMDIAGLVVENKDSLYPEYLADMIVRDYGTHVIRAIDAGAILSKTDALNSQYVKKYEXXXXXXXXXXXXXXXXXXKIDGKYQTKTTQTNI--DEFNHNVVKTHIDTVGGAIFGANTSLSDWENSVMNNLVPIDRRGEPLYYAITPRALPELDQETVHKIYVLIKKAILRYYTANGRIGCLDIYSPNFNPDANIDSGNCEHPSVNFTFGGTYQVCGGPA-------CGPYAQVNPLTGGFSCPSGFISIKLHSGL-------VRCDESCHGWWFWRSCDTTC--------SYFTTFWCYPVNIGPNYNGYQFGGI----------RQGSCPIGYIPLKVGLSIEICVTVDADPFNPYAIKFGGFFSCSAGNPLAQEYVKN---KPKLYSSSKMADLKYWPKTCAKGYVAHISSIEQGCQISYCTETNKVSLGPLPRIIKPPFIS--IDYNPNSTKVLIFTTKNGETFIKDN-VGSWKLEDIQREKRNMLV 1935
            Q C+        +VLPG GWDNL N+ MGR+++L +S C  + D +Y+IP+++   P+K S +E++SEI   ++NY S +S SIN        +F K+ G FSTE  ++K+ Q++ ++I TRVQ+R L +     P   L   F+  ++DI+  + EN  +    YLA+++V +YGTHV  ++DAGA L + D L + +++  +S SS  +V+ASA       ++ K++   T  N+    +  N   + + ++GG  F    +L  W+  + N+LV IDR G PL++ I P  LP+L    V K+   ++ A+ RYYT N   GC D+ SPNFN  AN D G+CE    NF+FGG YQ C   +       C    Q NPLTG FSCPSG+  + L S +       + C   C    F   C T C        + F  FWC   +  P  +G  FGG+             SCP GY PL++  ++++CV+ D +  + +A+ FGGFFSC+ GNPL    +      P L             K C  G+  H + I  GCQ+SYC ++   + G LP    PPF    +     +  V++  ++N  ++IKD+    W+L +    +R M V
Sbjct:   32 QKCKNALKLPVLEVLPGGGWDNLRNVDMGRVMELTYSNCRTTEDGQYIIPDEIFTIPQKQSNLEMNSEILESWANYQSSTSYSINTE----LSLFSKVNGKFSTEFQRMKTLQVKDQAITTRVQVRNLVYTVKINPTLELSSGFRKELLDISDRL-ENNQTRMATYLAELLVLNYGTHVTTSVDAGAALIQEDHLRASFLQ--DSQSSRSAVTASAGLAFQNTVNFKFEENYTSQNVLTKSYLSNRTNSRVQSIGGVPFYPGITLQAWQQGITNHLVAIDRSGLPLHFFINPNMLPDLPGPLVKKVSKTVETAVKRYYTFNTYPGCTDLNSPNFNFQANTDDGSCEGKMTNFSFGGVYQECTQLSGNRDVLLCQKLEQKNPLTGDFSCPSGYSPVHLLSQIHEEGYNHLECHRKCTLLVF---CKTVCEDVFQVAKAEFRAFWCVASSQVPENSGLLFGGLFSSKSINPMTNAQSCPAGYFPLRLFENLKVCVSQDYELGSRFAVPFGGFFSCTVGNPLVDPAISRDLGAPSL-------------KKCPGGFSQHPALISDGCQVSYCVKSGLFTGGSLPPARLPPFTRPPLMSQAATNTVIVTNSENARSWIKDSQTHQWRLGEPIELRRAMNV 644          
BLAST of Macrophage-expressed gene 1 protein vs. UniProt/SwissProt
Match: sp|Q2KJC3|MPEG1_BOVIN (Macrophage-expressed gene 1 protein OS=Bos taurus OX=9913 GN=MPEG1 PE=2 SV=2)

HSP 1 Score: 339.732 bits (870), Expect = 2.640e-104
Identity = 221/708 (31.21%), Postives = 341/708 (48.16%), Query Frame = 1
Query:  133 TIKDAYQLCQLMPNQRTFDVLPGSGWDNLANIGMGRILDLNFSKCSFSNDNKYLIPNQLAIYPEKSSQVEISSEIFRHFSNYTSMSSQSINVGAEGGYGIF-KIGGSFSTENTKIKSDQMETKSIFTRVQLRYLGFQSMFEPDTPLYPTFKNRIMDIAGLVVENKDSLYPEYLADMIVRDYGTHVIRAIDAGAILSKTDALNSQYVKKYEXXXXXXXXXXXXXXXXXXKIDGKYQTKTTQTNIDEFNHNVVKTHIDTVGGAIFGANTSLSDWENSVMNNLVPIDRRGEPLYYAITPRALPELDQETVHKIYVLIKKAILRYYTANGRIGCLDIYSPNFNPDANIDSGNCEHPSVNFTFGGTYQVCGG-------PACGPYAQVNPLTGGFSCPSGFISIKLHSGL-------VRCDESCHGWWFWRSCDTTC--------SYFTTFWCYPVNIGPNYNGYQFGGIRQG----------SCPIGYIPLKVGLSIEICVTVDADPFNPYAIKFGGFFSCSAGNPLAQEYVKN---KPKLYSSSKMADLKYWPKTCAKGYVAHISSIEQGCQISYCTETNKVSLGPLPRIIKPPFIS--IDYNPNSTKVLIFTTKNGETFIKD-NVGSWKLEDIQREKRNM---------LVGSIVGSFLMAACICLTIFFIQRRHYKRMIEKLDYKPLTKNEQLADYGSINNTDRV*LKQ 2112
            T +  +Q C+         VLPG GWDNL N+  GR+++L +S C  + D +Y++P+++   P+K S +E++S+I   + NY S +S SIN+       +F K+ G FS E  +IK+ Q++ +++ T+VQ+R L +     PD  L   FK  +MDI+   +EN  +    YLA+++V +YGTHVI ++DAGA L + D + S +++  +S  S ++ SA  +FL++     +    +  T    +  N   + + + GG  F    +L  W+  V N+LV +DR G PLY+ I P  LP+L    V K+   ++ A+ RYY  N   GC D+ SPNFN  AN D G+CE    NF+FGG YQ C           C    Q NPLTG  SCPSG+  ++L +         + C   C  + F   C T C        + F  FWC         +G  FGG+  G          SCP GY  LK+  ++++C ++D +    ++I FGGFFSC+AGNPL           P L             + C  G+  H++ I  GCQ+SYC +    + G LP +  PP+    +     +  VL+   +   ++IKD     W+L +    +R M         L G       +   I L        +  R   K  Y+ L   +Q    G+  N D +  +Q
Sbjct:   26 TDEPGFQNCKNALKLPVLPVLPGGGWDNLRNVDTGRVMELAYSHCRTTEDGQYIVPDEIFTIPQKQSNLEMNSKILESWVNYQSSTSNSINME----LSLFSKVNGKFSLEFQRIKTLQVKDQAVTTQVQVRNLVYTVKINPDAELSLGFKKALMDISE-QLENNQTRMATYLAELLVLNYGTHVITSVDAGAALIQEDHIRSSFLQDSQSSRSAVTASAGITFLNIVNFKFEENYTSQNTFTKSYLSNRTNSRVQSFGGLPFYPGITLQAWQQGVSNHLVAMDRAGLPLYFFINPERLPDLPGPLVRKLSKTVEAAVRRYYAVNTYPGCTDLSSPNFNFQANTDDGSCEGKMTNFSFGGVYQECTQFSGNEVVQLCQNLEQKNPLTGSVSCPSGYSPVQLLTQTHEEGYNHLECSRKCTLYIF---CKTVCEDVFRVARAEFRAFWCAASGQVSENSGLLFGGLFSGKSINPLTNAQSCPAGYFQLKLFENLKVCASLDYELGYRFSIPFGGFFSCAAGNPLVDSATSKDLGAPSL-------------RKCPGGFSQHLALISDGCQVSYCVKAGLFTGGSLPPVRLPPYTRPPLMSQVATNTVLVTNHETASSWIKDPQTHQWRLGEPLELRRAMRVVHGDGEGLSGGAAAGLTLGVTIALAGVVALAIYGARKSRKKGYQALQDEKQSLAAGAAVNGDALDQEQ 712          
BLAST of Macrophage-expressed gene 1 protein vs. UniProt/SwissProt
Match: sp|A1L314|MPEG1_MOUSE (Macrophage-expressed gene 1 protein OS=Mus musculus OX=10090 GN=Mpeg1 PE=1 SV=1)

HSP 1 Score: 338.191 bits (866), Expect = 1.060e-103
Identity = 214/688 (31.10%), Postives = 339/688 (49.27%), Query Frame = 1
Query:  145 AYQLCQLMPNQRTFDVLPGSGWDNLANIGMGRILDLNFSKCSFSNDNKYLIPNQLAIYPEKSSQVEISSEIFRHFSNYTSMSSQSINVGAEGGYGIF-KIGGSFSTENTKIKSDQMETKSIFTRVQLRYLGFQSMFEPDTPLYPTFKNRIMDIAGLVVENKDSLYPEYLADMIVRDYGTHVIRAIDAGAILSKTDALNSQYV--KKYEXXXXXXXXXXXXXXXXXXKIDGKYQTKTTQTNIDEFNHNVVKTHIDTVGGAIFGANTSLSDWENSVMNNLVPIDRRGEPLYYAITPRALPELDQETVHKIYVLIKKAILRYYTANGRIGCLDIYSPNFNPDANIDSGNCEHPSVNFTFGGTYQVC----GGPACGPYAQVNPLTGGFSCPSGFISIKLHS-------GLVRCDESCHGWWFWRSCDTTC--------SYFTTFWCYPVNIGPNYNGYQFGGI----------RQGSCPIGYIPLKVGLSIEICVTVDADPFNPYAIKFGGFFSCSAGNPLAQEYVKNKPKLYSSSKMADLKYWPKTCAKGYVAHISSIEQGCQISYCTETNKVSLGP-----LPRIIKPPFISIDYNPNSTKVLIFTTKNGETFIKD-NVGSWKLEDIQREKRNMLV---------GSIVGSFLMAACICLTIFFIQRRHYKRMIEKLDYKPLTKNEQLA 2067
             +Q+C+        +VLPG GWDNL N+ MGR++DL ++ C  + D +Y+IP+++   P+K S +E++SE+   + NY S +S SIN        +F ++ G FSTE  ++K+ Q++ +++ TRVQ+R   +     P + L   F   +MDI   + +N+  +   YLA++++ +YGTHVI ++DAGA L + D + S ++   +   ++ T S   +   +  FK++  Y ++T+ T   ++  N   + + + GG  F    +L  W+  + N+LV IDR G PL++ I P  LP L    V K+   ++ A+  YYT N   GC ++ SPNFN  AN+D  +C+    NFTFGG YQ C    G   C    Q N LTG FSCP G+  + L S         + C + C    F   C T C        + F  +WC      P+ +G  FGG+             SCP GYIPL +  S+++CV++D +    +++ FGGFFSC  GNPL         +  S  K          C  G+  H++ I  GCQ+SYC +    + G      LP   KPP +S      +  V++  ++   ++IKD     WKL +    +R M V         G       +   I L I      +  R  +K +Y+ + + E L 
Sbjct:   30 GFQICKNALKLPVLEVLPGGGWDNLRNVDMGRVMDLTYTNCKTTEDGQYIIPDEVYTIPQKESNLEMNSEVLESWMNYQSTTSLSINTE----LALFSRVNGKFSTEFQRMKTLQVKDQAVTTRVQVRNRIYTVKTTPTSELSLGFTKALMDICDQLEKNQTKM-ATYLAELLILNYGTHVITSVDAGAALVQEDHVRSSFLLDNQNSQNTVTASAGIAFLNIVNFKVETDYISQTSLTK--DYLSNRTNSRVQSFGGVPFYPGITLETWQKGITNHLVAIDRAGLPLHFFIKPDKLPGLPGPLVKKLSKTVETAVRHYYTFNTHPGCTNVDSPNFNFQANMDDDSCDAKVTNFTFGGVYQECTELSGDVLCQNLEQKNLLTGDFSCPPGYSPVHLLSQTHEEGYSRLECKKKCTLKIF---CKTVCEDVFRVAKAEFRAYWCVAAGQVPDNSGLLFGGVFTDKTINPMTNAQSCPAGYIPLNLFESLKVCVSLDYELGFKFSVPFGGFFSCIMGNPLVNSDTAKDVRAPSLKK----------CPGGFSQHLAVISDGCQVSYCVKAGIFTGGSLLPVRLPPYTKPPLMS---QVATNTVIVTNSETARSWIKDPQTNQWKLGEPLELRRAMTVIHGDSNGMSGGEAAGITLGVTIALGIVITLAIYGTRKYKKKEYQEIEEQESLV 694          
BLAST of Macrophage-expressed gene 1 protein vs. UniProt/SwissProt
Match: sp|Q9WV57|MPEG1_RAT (Macrophage-expressed gene 1 protein OS=Rattus norvegicus OX=10116 GN=Mpeg1 PE=2 SV=2)

HSP 1 Score: 331.643 bits (849), Expect = 3.151e-101
Identity = 220/691 (31.84%), Postives = 344/691 (49.78%), Query Frame = 1
Query:  145 AYQLCQLMPNQRTFDVLPGSGWDNLANIGMGRILDLNFSKCSFSNDNKYLIPNQLAIYPEKSSQVEISSEIFRHFSNYTSMSSQSINVGAEGGYGIF-KIGGSFSTENTKIKSDQMETKSIFTRVQLRYLGFQSMFEPDTPLYPTFKNRIMDIAGLVVENKDSLYPEYLADMIVRDYGTHVIRAIDAGAILSKTDALNSQYV--KKYEXXXXXXXXXXXXXXXXXXKIDGKYQTKTTQTNIDEFNHNVVKTHIDTVGGAIFGANTSLSDWENSVMNNLVPIDRRGEPLYYAITPRALPELDQETVHKIYVLIKKAILRYYTANGRIGCLDIYSPNFNPDANIDSGNCEHPSVNFTFGGTYQVC----GGPACGPYAQVNPLTGGFSCPSGFISIKLHS-------GLVRCDESCHGWWFWRSCDTTC--------SYFTTFWCYPVNIGPNYNGYQFGGI----------RQGSCPIGYIPLKVGLSIEICVTVDADPFNPYAIKFGGFFSCSAGNPLAQEYVKNKPKLYSSSKMADLKYWPKTCAKGYVAHISSIEQGCQISYCTETNKVSLGP-----LPRIIKPPFISIDYNPNSTKVLIFTTKNGETFIKD-NVGSWKLEDIQREKRNMLV----------GSIVG---SFLMAACICLTIFFIQRRHYKRMIEKLDYKPLTKNEQL 2064
             +Q C+        +VLPG GWDNL NI MGR++DL ++ C  + D +Y+IP+++   P+K S +E++SEI   + NY S +S SIN        +F K+ G FSTE  ++K+ Q++ +++ TRVQ+R   +     P + L   F N +MDI   + +N+  +   YLA+++V +YGTHVI ++DAGA L + D + S ++   +   ++ T S   +   +  FK++  + ++T  T    +  N   + + + GG  F    +L  W+  + N+LV IDR G PL++ I P  LP L    V K+   ++ A+  YYT N   GC ++ SPNFN  AN++  +C+    NFTFGG YQ C    G   C    Q N LTG FSCPSG+  + L S         + C + C    F   C T C        + F  +WC      P+ +G  FGG+             SCP GYIPL +  S+++CV++D +    +++ FGGFFSC  GNPL      +  K   +  +       K C  G+  H++ I  GCQ+SYC +    + G      LP   KPP +S      +  V++ +++   ++IKD     WKL +     + M V          G   G     ++A  I +T+     R YK+  E   Y+ + + E L
Sbjct:   30 GFQTCKDTLKLPVLEVLPGGGWDNLRNIDMGRVIDLTYTNCKTTEDGQYIIPDEVYTIPQKESNLEMNSEIRDSWVNYQSTTSFSINTE----LSLFSKVNGKFSTEFQRMKTLQVKDQAVTTRVQVRNRIYTVKNSPTSELSFGFTNALMDICDQLEKNQTKM-ATYLAELLVLNYGTHVITSVDAGAALVQEDHIRSSFLLDNQNSENTVTASAGIAFLNIVNFKVETDHTSQTLLTK--SYLSNRTNSRVQSFGGIPFYPGITLETWQKGITNHLVAIDRAGLPLHFFIKPDKLPGLPGGLVKKLSKTVETAVRHYYTFNTHPGCTNVDSPNFNFQANMEDDSCDAKVTNFTFGGLYQECTELSGDALCQNLEQKNLLTGDFSCPSGYTPVHLLSQTHEEGYSRLECKKKCTLKIF---CKTVCEDVFRVAKAQFRAYWCVATGQVPDNSGLLFGGLFTDKSINPMTNAQSCPAGYIPLNLFESLKVCVSLDYELGYKFSVPFGGFFSCIMGNPLVN---SDTAKDIGAPSL-------KKCPGGFSQHLAVISDGCQVSYCVKAGIFTGGSLLPVRLPPYTKPPLMS---QVATNTVIVTSSETARSWIKDPQTNQWKLGEPLELHKAMTVIHGDGNGMSGGEAAGVTLGVIIALGIVITLAIYSTRKYKKEKE---YQEIEEQESL 694          
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Match: A0A2B4RFA8 (Macrophage-expressed gene 1 protein OS=Stylophora pistillata OX=50429 GN=Mpeg1 PE=4 SV=1)

HSP 1 Score: 426.402 bits (1095), Expect = 2.640e-134
Identity = 219/575 (38.09%), Postives = 344/575 (59.83%), Query Frame = 1
Query:  157 CQLMPNQRTFDVLPGSGWDNLANIGMGRILDLNFSKCSFSNDNKYLIPNQLAIYPEKSSQVEISSEIFRHFSNYTSMSSQSINVGAEGGYGIFKIGGSFSTENTKIKSDQMETKSIFTRVQLRYLGFQSMFEPDTPLYPTFKNRIMDIAGLVVENKDSLYPEYLADMIVRDYGTHVIRAIDAGAILSKTDALNSQYVKKYEXXXXXXXXXXXXXXXXXXKIDGKYQTKTTQTNIDEFNHNVVKTHIDTVGGAIFGANTSLSDWENSVMNNLVPIDRRGEPLYYAITPRALPELDQETVHKIYVLIKKAILRYYTANGRIGCLDIYSPNFNPDANIDSGNCEHPSVNFTFGGTYQVC---GGPA---CGPYAQVNPLTGGFSCPSGFISIKLHSGLV--RCDESCHGWWFWRSCDTTCSY--FTTFWCYPVNIGPNYNGYQFGGI----------RQGSCPIGYIPLKVGLSIEICVTVDADPFNPYAIKFGGFFSCSAGNPLAQEYVKNKPK-------LYSSSKMADLKYWPKTCAKGYVAHISSIEQGCQISYCTETNKVSLGPLPRIIKPPF 1800
            C L      F+VLPG GWDNL N+ MG +  +N+SKC  S+D KYLIP+ + +YP K S+V + +E++ H++NY+S +++SIN  A G +G   + GS+S+E   +K  Q+E KS+ TR QLR+  +    +PD PL P FK+R+++IA  +  N ++ Y  +LA ++VRD+GTH + ++ AGA L+K D L  ++V  ++ D S I+ +ASASF  +F     Y   T +  +D++  N   + + T GG  F  N ++++WE+ + + LV +DR G+PL++AIT  ++PEL +E V K+  +++KAI +YY  N   GC  + SP+F+  AN+D G+CE P+ N+TFGG YQ C   G P+   CG + Q NPLT  ++C +G+  + +H G     C   CHGWW ++SCDT C +  + T+WC      P   GY FGG+          +  SCP+ +  L+ G ++ +CV+ D +     ++ FGGFFSC+ GNPL  +   ++ K       L    K +    WPKTC  GY  H+ +IE+ C+I++C ++N  +    P I +PP+
Sbjct:   46 CPLASGVYRFEVLPGGGWDNLRNLHMGAVSVMNYSKCKTSDDGKYLIPDDVFLYPVKESKVHVFAEMYDHWNNYSSTTTKSINAEASGTFGFGSVSGSYSSEFESVKKHQVEDKSVTTRAQLRHDLYTVKLQPDAPLQPAFKSRLLEIASHLQHN-NTAYASFLAQVLVRDFGTHYVTSVMAGAALAKVDHLTKKFVADFDEDKSKITAAASASFFGVFGASASYTQTTDKKVLDQYTKNTAYSTVYTFGGPPFRVNFTINEWEDQMADELVAVDRSGDPLHFAITHGSVPELSEELVFKLASVVEKAIKQYYEHNTIKGCTKMDSPDFSFQANLDDGSCESPTNNYTFGGVYQTCQCEGSPSSNPCGSFVQKNPLTADYTCSNGYEPVMVHQGRTPQTCHRECHGWWIFKSCDTYCGFANYYTYWCVAKGAVPPNTGYLFGGLYSNVLKNPVTQDHSCPLKFYALRFGATMHVCVSDDYELGFQQSVPFGGFFSCNTGNPLGVKKSSSRAKGSNGHSSLELFVKQSGSSVWPKTCPIGYSQHLGAIEENCEINFCVKSNVFNSKGFPIIKRPPY 619          
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Match: A7SEK6 (Predicted protein (Fragment) OS=Nematostella vectensis OX=45351 GN=v1g115372 PE=4 SV=1)

HSP 1 Score: 395.586 bits (1015), Expect = 1.002e-124
Identity = 222/595 (37.31%), Postives = 348/595 (58.49%), Query Frame = 1
Query:  187 DVLPGSGWDNLANIGMGRILDLNFSKCSFSNDNKYLIPNQLAIYPEKSSQVEISSEIFRHFSNYTSMSSQSINVGAEGGYGIFKIGGSFSTENTKIKSDQMETKSIFTRVQLRYLGFQSMFEPDTPLYPTFKNRIMDIAGLVVENKDSLYPEYLADMIVRDYGTHVIRAIDAGAILSKTDALNSQYVKKYEXXXXXXXXXXXXXXXXXXKIDGKYQTKTTQTNIDEFNHNVVKTHIDTVGGAIFGANTSLSDWENSVMNNLVPIDRRGEPLYYAITPRALPELDQETVHKIYVLIKKAILRYYTANGRIGCLDIYSPNFNPDANIDSGNCEHPSVNFTFGGTYQVC---GGPA---CGPYAQVNPLTGGFSCPSGFISIKLHSGLV--RCDESCHG-WWFWRSCDTTCSY--FTTFWCYPVNIGPNYNGYQFGGI----------RQGSCPIGYIPLKVGLSIEICVTVDADPFNPYAIKFGGFFSCSAGNPLAQEYVKNKPKLYSSSKMADLKYWPKTCAKGYVAHISSIEQGCQISYCTETNKVSLGPLPRIIKPPFISIDYNPN-STKVLIFTTKNGETFIK--DNVGSWKL 1899
            +VLPG GWDNL N+ MG +  +N+S C  S+D K+L+P+ + +YP K S+V   +E + H++NY+S +++SIN  A+  +G   + GSFS+E   +K  Q+E K++ TRVQLR++ + +  +PD+PL P FK+R+++IA  +  N ++ Y  +LA ++VRD+GTH + ++DAGA+L+K D L  ++V     D S I+ SASASF   F   G Y   T    +DE+    V +   T GG  F  N ++++WE+ +++ LV +DR G+PL+Y ITP +LPEL ++   ++  ++K AI +YY  N   GC  + SPNF+  AN+D G+C+ P+ N+TFGG YQ C   G P+   C P AQ NPLT  ++C  G+  + +H G     C + CH  W F++ C   C +  F+T+WC   +  P  +GY FGG+          +  SCP+ +  LK G ++++CV+ D +     ++ FGGFFSC+AGNPLA          +      D     K C  G+  H+ +IE  C+I YC ++N  +L  LP + +PP++S     N S  +L+     G+ + K   N+  W L
Sbjct:    1 EVLPGGGWDNLRNLHMGAVSAMNYSLCRSSDDGKFLVPDNVFLYPVKKSKVNTFAEFYDHWNNYSSTTTKSINAEAKASFGFGSVSGSFSSEYESVKKHQVEDKTVTTRVQLRHVFYTAKLQPDSPLQPAFKDRLLEIASHLQHN-NTAYASFLAQVLVRDFGTHYVSSVDAGAVLAKVDHLTKKFVADSNEDKSKITASASASFFHFFGASGSYSKSTDTKTLDEYTKATVYSTTYTYGGPPFRVNFTINEWEDKMLDELVAVDRSGDPLHYTITPGSLPELCEQATFQLAAVVKNAIKQYYIHNTIKGCTKMDSPNFSFQANMDDGSCQSPTNNYTFGGVYQTCQTDGSPSSDPCAPLAQKNPLTADYTCTPGYEPVLVHQGRTPQSCHKDCHRVWLFFKRCSVQCGFGSFSTYWCVAKSAVPANSGYLFGGLYSDVLKNPLTQDHSCPLKFYALKFGATMKVCVSDDYELGYQQSLPFGGFFSCNAGNPLA----------FKKPPTGD-----KGCPTGFSQHLGAIEANCEIQYCVKSNVFNLQGLPIVRRPPYLSPPAVYNYSVPMLLVNEDTGQIWFKRAGNMPQWLL 579          
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Match: Q6RYF8 (Macrophage expressed protein OS=Haliotis rufescens OX=6454 PE=2 SV=1)

HSP 1 Score: 394.045 bits (1011), Expect = 2.997e-122
Identity = 216/572 (37.76%), Postives = 333/572 (58.22%), Query Frame = 1
Query:  184 FDVLPGSGWDNLANIGMGRILDLNFSKCSFSNDNKYLIPNQLAIYPEKSSQVEISSEIFRHFSNYTSMSSQSINVGAEGGYGIFKIGGSFSTENTKIKSDQMETKSIFTRVQLRYLGFQSMFEPDTPLYPTFKNRIMDIAGLVVENKDSLYPEYLADMIVRDYGTHVIRAIDAGAILSKTDALNSQYVKKYEXXXXXXXXXXXXXXXXXXKIDGKYQTKTTQTNIDEFNHNVVKTHIDTVGGAIFGA-NTSLSDWENSVMNNLVPIDRRGEPLYYAITPRALPELDQETVHKIYVLIKKAILRYYTANGRIGCLDIYSPNFNPDANIDSGNCEHPSVNFTFGGTYQVCG-------GPACGPYAQVNPLTGGFSCPSGFISIKLHSGLV---RCDESCHG-WWFWRSCDT----TCSYFTTFWCYPVNIGPNYNGYQFGG---------IRQG-SCPIGYIPLKVGLSIEICVTVDADPFNPYAIKFGGFFSCSAGNPLAQEYVKNKPKLYSSSKMADL-------KYWPKTCAKGYVAHISSIEQGCQISYCTETNKVSLGPLPRIIKPPF 1800
            F+VLPG GWDNL N+  G ++  N+S+C  + D ++LIP+ +   P K+S++ + +E+  H+SNYTS ++  +N+ A   +G  K+ G+FS+    +KS Q+  KS  TRVQLRY+ + +  +PD  L+PTFK+R++ IAG +  NK      Y ++++VRD+GTHV+ ++DAGA L + D ++S++V   +   + I+  ASASFL +F ID  Y + T+      +  +   + IDT+GG +F A N + +DW N V + LV +DR G+PL++ I   +LPEL    ++++  L+++ IL YY  N   GC ++ SPNF+P AN+D G C+ P  N TFGG YQ C        G  C    QVNP TGG +CP G+ S++LH+G +   +   SCH  W F++ C      + + +   WC         +GY FGG         + QG +CP+ +    +G  + IC++ D +    Y++ FGGF SC+ GNPLA    K K K   +S +  L       K WPK C KGY  H++ ++QGC+I+YC     +S   LP+I +PPF
Sbjct:   46 FEVLPGQGWDNLRNVDAGLVVVYNYSRCRTTEDGRFLIPDTVNTIPLKASKLNVYAELISHWSNYTSTTAHGVNIDAGLKFGSVKVSGTFSSGYESVKSKQIGDKSYTTRVQLRYVRYSAKLQPDAALHPTFKSRLLSIAGSLQLNKTD-QARYDSELLVRDFGTHVVTSVDAGAALVQEDQVSSEFVNSRKFTKNQITAGASASFLGIFSIDVSYHSSTSNEVKTAYEKSRSSSQIDTLGGPMFKASNFTANDWTNEVDHELVAVDRSGDPLFFLINSASLPELPNSVLYQLQNLVEETILHYYEFNTYRGCTELDSPNFSPAANLDDGTCKSPYTNLTFGGVYQTCSMSSGSNNGDLCSGLDQVNPKTGGHTCPDGYESVELHTGRLSDSKSVHSCHSCWLFFKCCHDNYYHSEATYIMHWCAATGPVSQDSGYLFGGLYTSQLNNPLTQGKTCPVNFYTRTLGKDLHICISDDYELGMKYSMPFGGFISCTTGNPLAMN-PKPKSKGDMNSALPSLHSFFQGSKTWPKHCPKGYSQHLAYVDQGCEINYCLLAGSLSEVGLPKIRRPPF 615          
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Match: A0A1S3J0V4 (LOW QUALITY PROTEIN: macrophage-expressed gene 1 protein-like OS=Lingula unguis OX=7574 GN=LOC106169090 PE=4 SV=2)

HSP 1 Score: 391.734 bits (1005), Expect = 4.489e-122
Identity = 235/599 (39.23%), Postives = 339/599 (56.59%), Query Frame = 1
Query:  175 QRTFD---VLPGSGWDNLANIGMGRILDLNFSKCSFSNDNKYLIPNQLAIYPEKSSQVEISSEIFRHFSNYTSMSSQSINVGAEGGYGIFKIGGSFSTENTKIKSDQMETKSIFTRVQLRYLGFQSMFEPDTPLYPTFKNRIMDIAGLVVENKDSLYPEYLADMIVRDYGTHVIRAIDAGAILSKTDALNSQYVKKYEXXXXXXXXXXXXXXXXXXKIDGKYQTKTTQTNIDEFNHNVVKTHIDTVGGAIF-GANTSLSDWENSVMNNLVPIDRRGEPLYYAITPRALPELDQETVHKIYVLIKKAILRYYTANGRIGCLDIYSPNFNPDANIDSGNCEHPSVNFTFGGTYQVCGGPACGPY-AQVNPLTGGFSCPSGFISIKLHSGLVR-CDESCHGWWFWR-SCDTTCS--YFTTFWCYPVNIGPNYNGYQFGG---------IRQG-SCPIGYIPLKVG--LSIEICVTVDADPFNPYAIKFGGFFSCSAGNPLA---------QEYVKNKPKLYSSSKM-ADLKYWPKTCAKGYVAHISSIEQGCQISYCTETNKVSLGPLPRIIKPPF-ISIDYNPNSTKVLIFTTKNGETFIK 1875
            Q+T D   V+P +GWDNL N+ MG ++ LN+SKC  + D K++IP+     P K S VE  SE++ HF NYTS++S SIN+ A   +    + GSFS  +   K      KS+ +RVQLRY+ ++   +PD  L+PTFK+R+++IA  + E +D+    YL++++VRDYGTH + +IDAGA + + D LNS Y+K  ++D STI  SA AS          Y     +  ++++  + V +H +TVGG  F  A+ +L  W + + NNLV +DR G+PLYY IT   LPEL  +TV  +   ++KA+  YY  N   GC  I SPNF+  AN D   C +P  NFTFGG YQ C G  C P  + VN  TG +SC   + ++ L  G +R C   CH +WF R  C   C    +  +WC      P  +G+ FGG         + QG SCP+ +  LK+G  L I ICV+ D +    YAI F GFFSCS+GNPLA         +  V+  P   ++  M A   +WPK C  GY  H+ +I +GC+I+YC + + ++   LP I +PPF +      NST++L+  T +G   +K
Sbjct:   17 QQTMDMLEVIPLNGWDNLRNVDMGPVMALNYSKCRITQDRKFMIPDDTYAVPLKKSNVETYSELYTHFLNYTSVTSSSINLEAHASWSYGSVSGSFSWSHQNSKMHITGDKSVLSRVQLRYVLYKIRSQPDPQLHPTFKDRLLEIASYIQE-RDNDAVTYLSELLVRDYGTHFVTSIDAGAAIIQEDHLNSSYIKNMDNDRSTIKASAGASLFGFIGASASYTHAVEKGQLEKYVQSRVTSHTETVGGPPFRXASFTLDQWVDDLQNNLVAVDREGDPLYYIITTGTLPELPLDTVRDLADSVQKAVESYYLYNVYRGCTSIDSPNFSYIANFDDNTCVNPFTNFTFGGVYQTCSGGLCSPEDSLVNHKTGTYSCLPQYTAVLLDEGKLRKCHRECHHFWFIRYRCHDVCDDRNYQIYWCAATGKIPQESGFLFGGTYTANTDNPLTQGKSCPVHFTALKLGVPLPIYICVSDDYELGFRYAIPFAGFFSCSSGNPLAISPHIPNLHKRSVEGAPLGLAAVLMDAGAPFWPKKCPHGYSQHLLAINEGCEINYCVKAHALTPNALPIIRRPPFQLKPKLLRNSTRLLM--TASGRVSMK 612          
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Match: A0A1R7T0A1 (Macrophage expressed protein OS=Haliotis madaka OX=81897 PE=2 SV=1)

HSP 1 Score: 393.275 bits (1009), Expect = 4.582e-122
Identity = 219/595 (36.81%), Postives = 338/595 (56.81%), Query Frame = 1
Query:  184 FDVLPGSGWDNLANIGMGRILDLNFSKCSFSNDNKYLIPNQLAIYPEKSSQVEISSEIFRHFSNYTSMSSQSINVGAEGGYGIFKIGGSFSTENTKIKSDQMETKSIFTRVQLRYLGFQSMFEPDTPLYPTFKNRIMDIAGLVVENKDSLYPEYLADMIVRDYGTHVIRAIDAGAILSKTDALNSQYVKKYEXXXXXXXXXXXXXXXXXXKIDGKYQTKTTQTNIDEFNHNVVKTHIDTVGGAIFGA-NTSLSDWENSVMNNLVPIDRRGEPLYYAITPRALPELDQETVHKIYVLIKKAILRYYTANGRIGCLDIYSPNFNPDANIDSGNCEHPSVNFTFGGTYQVCG-------GPACGPYAQVNPLTGGFSCPSGFISIKLHSGLV---RCDESCHG-WWFWRSCDT----TCSYFTTFWCYPVNIGPNYNGYQFGG---------IRQG-SCPIGYIPLKVGLSIEICVTVDADPFNPYAIKFGGFFSCSAGNPLAQEYVKNKPKLYSSSKMADL-------KYWPKTCAKGYVAHISSIEQGCQISYCTETNKVSLGPLPRIIKPPFISIDYNPNSTKVLIFTTKNGETF 1869
            F+VLPG GWDNL N+  G ++  N+S+C  + D ++LIP+ +   P K+S++ + +E+  H+SNYTS ++  +NV A   Y   K+ G FS+    +KS Q+  KS  TRVQLRY+ + +  +PD  L+PTFK+R++ IAG +  NK      Y ++++VRD+GTHV+ ++DAGA L + D ++S++V   +   + I+  ASAS   +F ID  Y + T+      +  +   + IDT+GG +F A N + +DW N V + LV +DR G+PL++ I   +LPEL    ++++  L+++ IL YY  N   GC ++ SPNF+P AN+D G C+ P  N TFGG YQ C        G  C    QVNP TGG +CP G+ S++LH+G +   +   SCH  W F++ C      + + +   WC         +GY FGG         + QG +CP+ +    +G  + IC++ D +    Y++ FGGF SC+ GNPLA    K K K   +S +  L       K WPK C KGY  H++ ++QGC+I+YC     +S   LP+I +PPF        +  +L+ +T+N   F
Sbjct:   46 FEVLPGQGWDNLRNVDAGLVVVYNYSRCRTTEDGRFLIPDTVNTIPLKASKLNVYAELISHWSNYTSTTAHGVNVDAGLKYDSVKVSGKFSSGYESVKSKQIGDKSYTTRVQLRYVRYSAKLQPDAALHPTFKSRLLSIAGSLQLNKTD-QARYDSELLVRDFGTHVVTSVDAGAALVQEDQVSSEFVNSRKFTKNQITAGASASLFGIFSIDVSYHSSTSNEVKKAYEQSRSSSQIDTLGGPMFKASNFTANDWTNEVDHELVAVDRSGDPLFFLINSASLPELPNSVLYQLQNLVEETILHYYEFNTYRGCTELDSPNFSPAANLDDGTCKSPYTNLTFGGVYQTCSMSSGSNNGDLCSGLDQVNPKTGGHTCPDGYESVELHTGRLSDSKSVHSCHSCWLFFKCCHDNYYHSEATYIMHWCAATGPVSQDSGYLFGGLYTSQLNNPLTQGKTCPVNFYTRTLGKDLHICISDDYELGMKYSMPFGGFISCTTGNPLAMN-PKPKSKGGMNSALPSLHSFFQGSKTWPKHCPKGYSQHLAYVDQGCEINYCLLAGSLSEVGLPKIRRPPF-------QTAPLLLPSTENHVVF 631          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Cavefish
Match: ENSAMXT00000015822.2 (pep primary_assembly:Astyanax_mexicanus-2.0:6:8259512:8262317:1 gene:ENSAMXG00000015374.2 transcript:ENSAMXT00000015822.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 283.108 bits (723), Expect = 1.883e-84
Identity = 191/597 (31.99%), Postives = 297/597 (49.75%), Query Frame = 1
Query:  232 MGRILDLNFSKCSFSNDNKYLIPNQLAIYPEKSSQVEISSEIFRHFSNYTSMSSQSINVGAEGGYGIFKIGGSFSTENTKIKSDQMETKSIFTRVQLRYLGFQSMFEPDTPLYPTFKNRIMDIAGLVVENKDSLYPEYLADMIVRDYGTHVIRAIDAGAILSKTDALNSQYVKKYEXXXXXXXXXXXXXXXXXXKIDGKYQTKTTQTNIDEFNHNVVKTHIDTVGGAIFGANTSLSDWENSVMNNLVPIDRRGEPLYYAITPRALPELDQETVHKIYVLIKKAILRYYTANGRIGCLDIYSPNFNPDANIDSGNCEHPSVNFTFGGTYQVC------GGPACGPYAQVNPLTGGFSCPSGFISIKLHSGLVR-------CDESCHGWWF---WRSCDTTC--------SYFTTFWCYPVNIGPNYNGYQFGGI----------RQGSCPIGYIPLK-VGLSIEICVTVDADPFNPYAIKFGGFFSCSAGNPLAQEYVKNKPKLYSSSKMADLKYWPKTCAKGYVAHISSIEQGCQISYCTETNKVSLGP-----LPRIIKPPFISIDYNPNSTKVLIFTTKNGETFIK-DNVGSWKL 1899
            MGR++++++S+C  + D  YLIP+++ + P+K S+VE++SEI   +    S +S SIN  A+G +    +   FS EN ++K+ Q+   S+  RVQ+R   +     PD  L   F  ++ +IA   +EN  + + EYL++ +V DYGTHVI ++DAGA L + D L S YV   +S  S++S SA A+F +  + D   +   T +    +  NV  +   + GGA+F    +L  W+ S +NNLV IDR G PL+Y + P    +L   TV+K+ +L+ +AI RYY  N R GC+   S NF+  AN+D  +CE PS N +FGG YQ C      G   C   A  NP TG +SC   +I+  L S           C+  CH   F   +  CD  C        +   T+WC      P ++GY FGGI          +  SCP  +     +    +IC++ D +    +++ FGGFFSC + N LA                         C   +  H+++I  GCQI +C ++   + G      LP   +PP ISI     +T  +   T+  + +++  +   WK+
Sbjct:    1 MGRVMNMSYSQCQTTEDGVYLIPDEVFVIPQKVSKVEMNSEIISSWLEQRSSTSGSIN--ADGSF-FSVLNCKFSAENQRMKTHQVNYNSVTARVQVRNHLYTVKAYPDFSLDSRFAQQVEEIAD-AIENNQTRHAEYLSEKLVLDYGTHVITSVDAGATLEEEDYLKSSYVSDTQSSQSSVSASAGANFFNKVQFDIGSKESQTTSETRNYLGNVTYSITLSHGGALFYPGITLQKWQESTLNNLVAIDRSGLPLHYFLNPSVFSDLPLPTVNKLALLVSQAIERYYKVNTRPGCVKPDSRNFDFQANVDDASCEGPSTNLSFGGVYQQCTPLTPDGDVICQELASTNPATGSYSCKQPYIATLLRSETQERPYDQYVCNTHCHDCGFLGLFTCCDQVCGNVYHVRRAQINTYWCATNGATPEFSGYLFGGIFGPSFQNPLTKSRSCPSNFFAQTFLSNGFKICLSSDYETATKFSVPFGGFFSCQSTNLLAG--------------------GQSHCPPQFSQHLATITDGCQILFCVQSGIFTGGELKPIHLPPFTRPPVISI----LATNTVAVMTEGDQAWVRVKDTKMWKV 569          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Cavefish
Match: MPEG1 (macrophage expressed 1 [Source:HGNC Symbol;Acc:HGNC:29619])

HSP 1 Score: 279.256 bits (713), Expect = 4.860e-83
Identity = 194/613 (31.65%), Postives = 299/613 (48.78%), Query Frame = 1
Query:  232 MGRILDLNFSKCSFSNDNKYLIPNQLAIYPEKSSQVEISSEIFRHFSNYTSMSSQSINVGAEGGYGIFKI-GGSFSTENTKIKSDQMETKSIFTRVQLRYLGFQSMFEPDTPLYPTFKNRIMDIAGLVVENKDSLYPEYLADMIVRDYGTHVIRAIDAGAILSKTDALNSQYVKKYEXXXXXXXXXXXXXXXXXXKID-------GKYQTKTTQTNIDEFNHNVVKTHIDTVGGAIFGANTSLSDWENSVMNNLVPIDRRGEPLYYAITPRALPELDQETVHKIYVLIKKAILRYYTANGRIGCLDIYSPNFNPDANIDSGNCEHPSVNFTFGGTYQVC------GGPACGPYAQVNPLTGGFSCPSGFISIKLHSGLVR-------CDESCHG---WWFWRSCDTTC--------SYFTTFWCYPVNIGPNYNGYQFGGI----------RQGSCPIGYIPLK-VGLSIEICVTVDADPFNPYAIKFGGFFSCSAGNPLAQEYVKNKPKLYSSSKMADLKYWPKTCAKGYVAHISSIEQGCQISYCTETNKVSLGP-----LPRIIKPPFISIDYNPNSTKVLIFTTKNGETFIK-DNVGSWKL---EDIQR 1914
            MGR++++++S+C  + D  YLIP+++ + P+K S+VE++SEI   +    S +S SIN         F +    FSTEN ++K+ Q++  S+  RVQ+R   +     PD  L   F  +  +IA   +EN  + + EYL++ +V DYGTHVI ++D GA L + D L S YV   +S  S++S SA A+F    K D       G  +T+  Q NI    +++  +H    GGA+F    +L  W+ S +NNLV IDR G PL+Y + P   P+L   TV+K+ V + +AI RYY  N   GC+   S NFN  AN+D  +CE P+ N +FGG YQ C      G   C   A  NP TG +SC   +I+  L S           C   C+G    W    C+  C        +   T+WC      P ++GY FGG+          +  SCP  +     +    +IC++ D +    +++ FGGFFSC + N LA    +                    C   +  H+ +I  GCQI +C ++   + G      LP   +PP IS+     +T  +   T+  + +++  +   WK+   EDI +
Sbjct:    1 MGRVMNISYSQCQTTEDGVYLIPDEVFVIPQKVSKVEMNSEIISSWLEQKSSTSSSINADV----SFFSVVNAKFSTENQRMKTHQVKGNSVTARVQVRNHLYTVKAYPDFTLDSRFARQAEEIAD-AIENNQTRHAEYLSEKMVLDYGTHVITSVDTGATLVEEDYLKSSYVSDAQSSQSSVSASAGANFFDKVKFDIGTKDSQGTSETRNYQGNI---TYSITLSH----GGALFYPGITLQKWQESTLNNLVAIDRSGLPLHYFLNPSVFPDLPLPTVNKLAVSVSQAIERYYKVNTHPGCVKPDSKNFNFQANVDDASCEGPNTNLSFGGVYQQCTPLNSYGDAICQELASKNPATGSYSCQQPYIATLLRSETQERPYDQYVCHRHCYGCGFLWLDTCCENICGNVYHVRRAQIKTYWCATNGATPEFSGYLFGGLFGPSLQNPLTKSRSCPPNFFTQTFLSSGFKICLSNDYEAATRFSVPFGGFFSCQSTNQLAGSQSR--------------------CPPQFSQHLVAISDGCQILFCVQSGIFTGGELLPIRLPPFTRPPVISMI----ATNTVAVMTEGDQAWVRVKDTKLWKVAKPEDITK 577          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Nematostella
Match: EDO37879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEK6])

HSP 1 Score: 395.586 bits (1015), Expect = 1.386e-128
Identity = 222/595 (37.31%), Postives = 348/595 (58.49%), Query Frame = 1
Query:  187 DVLPGSGWDNLANIGMGRILDLNFSKCSFSNDNKYLIPNQLAIYPEKSSQVEISSEIFRHFSNYTSMSSQSINVGAEGGYGIFKIGGSFSTENTKIKSDQMETKSIFTRVQLRYLGFQSMFEPDTPLYPTFKNRIMDIAGLVVENKDSLYPEYLADMIVRDYGTHVIRAIDAGAILSKTDALNSQYVKKYEXXXXXXXXXXXXXXXXXXKIDGKYQTKTTQTNIDEFNHNVVKTHIDTVGGAIFGANTSLSDWENSVMNNLVPIDRRGEPLYYAITPRALPELDQETVHKIYVLIKKAILRYYTANGRIGCLDIYSPNFNPDANIDSGNCEHPSVNFTFGGTYQVC---GGPA---CGPYAQVNPLTGGFSCPSGFISIKLHSGLV--RCDESCHG-WWFWRSCDTTCSY--FTTFWCYPVNIGPNYNGYQFGGI----------RQGSCPIGYIPLKVGLSIEICVTVDADPFNPYAIKFGGFFSCSAGNPLAQEYVKNKPKLYSSSKMADLKYWPKTCAKGYVAHISSIEQGCQISYCTETNKVSLGPLPRIIKPPFISIDYNPN-STKVLIFTTKNGETFIK--DNVGSWKL 1899
            +VLPG GWDNL N+ MG +  +N+S C  S+D K+L+P+ + +YP K S+V   +E + H++NY+S +++SIN  A+  +G   + GSFS+E   +K  Q+E K++ TRVQLR++ + +  +PD+PL P FK+R+++IA  +  N ++ Y  +LA ++VRD+GTH + ++DAGA+L+K D L  ++V     D S I+ SASASF   F   G Y   T    +DE+    V +   T GG  F  N ++++WE+ +++ LV +DR G+PL+Y ITP +LPEL ++   ++  ++K AI +YY  N   GC  + SPNF+  AN+D G+C+ P+ N+TFGG YQ C   G P+   C P AQ NPLT  ++C  G+  + +H G     C + CH  W F++ C   C +  F+T+WC   +  P  +GY FGG+          +  SCP+ +  LK G ++++CV+ D +     ++ FGGFFSC+AGNPLA          +      D     K C  G+  H+ +IE  C+I YC ++N  +L  LP + +PP++S     N S  +L+     G+ + K   N+  W L
Sbjct:    1 EVLPGGGWDNLRNLHMGAVSAMNYSLCRSSDDGKFLVPDNVFLYPVKKSKVNTFAEFYDHWNNYSSTTTKSINAEAKASFGFGSVSGSFSSEYESVKKHQVEDKTVTTRVQLRHVFYTAKLQPDSPLQPAFKDRLLEIASHLQHN-NTAYASFLAQVLVRDFGTHYVSSVDAGAVLAKVDHLTKKFVADSNEDKSKITASASASFFHFFGASGSYSKSTDTKTLDEYTKATVYSTTYTYGGPPFRVNFTINEWEDKMLDELVAVDRSGDPLHYTITPGSLPELCEQATFQLAAVVKNAIKQYYIHNTIKGCTKMDSPNFSFQANMDDGSCQSPTNNYTFGGVYQTCQTDGSPSSDPCAPLAQKNPLTADYTCTPGYEPVLVHQGRTPQSCHKDCHRVWLFFKRCSVQCGFGSFSTYWCVAKSAVPANSGYLFGGLYSDVLKNPLTQDHSCPLKFYALKFGATMKVCVSDDYELGYQQSLPFGGFFSCNAGNPLA----------FKKPPTGD-----KGCPTGFSQHLGAIEANCEIQYCVKSNVFNLQGLPIVRRPPYLSPPAVYNYSVPMLLVNEDTGQIWFKRAGNMPQWLL 579          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Nematostella
Match: EDO28266 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6Y8])

HSP 1 Score: 90.8929 bits (224), Expect = 7.099e-22
Identity = 47/109 (43.12%), Postives = 74/109 (67.89%), Query Frame = 1
Query:  187 DVLPGSGWDNLANIGMGRILDLNFSKCSFSNDNKYLIPNQLAIYPEKSSQVEISSEIFRHFSNYTSMSSQSINVGAEGGYGIFKIGGSFSTENTKIKSDQMETKSIFTR 513
            +VLPG GWDNL N+ MG +  +N+S C  S+D K+LIP+ + +YP K S+V   +E + H++NY+S +++SIN  A+  +G   + GSFS+E   +K  Q+E K++ TR
Sbjct:    1 EVLPGGGWDNLRNLHMGAVSAMNYSLCRSSDDGKFLIPDNVFLYPVKKSKVNTFAEFYDHWNNYSSTTTKSINAEAKASFGFGSVSGSFSSEYESVKKHQVEDKTVTTR 109          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Medaka
Match: ENSORLT00000006104.2 (pep primary_assembly:ASM223467v1:9:9652430:9669002:1 gene:ENSORLG00000027013.1 transcript:ENSORLT00000006104.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 306.22 bits (783), Expect = 3.359e-93
Identity = 200/677 (29.54%), Postives = 322/677 (47.56%), Query Frame = 1
Query:  118 SNEVNTIKDAYQLCQLMPNQ--RTFDVLPGSGWDNLANIGMGRILDLNFSKCSFSNDNKYLIPNQLAIYPEKSSQVEISSEIFRHFSNYTSMSSQSINVGAEGGYGIFKIGGSFSTENTKIKSDQMETKSIFTRVQLRYLGFQSMFEPDTPLYPTFKNRIMDIAGLVVENKDSLYPEYLADMIVRDYGTHVIRAIDAGAILSKTDALNSQYVKKYEXXXXXXXXXXXXXXXXXXKIDGKYQTKTTQTNIDEFNHNVVKTHIDTVGGAIFGANTSLSDWENSVMNNLVPIDRRGEPLYYAITPRALPELDQETVHKIYVLIKKAILRYYTANGRIGCLDIYSPNFNPDANIDSGNCEHPSVNFTFGGTYQVC------GGPACGPYAQVNPLTGGFSCPSGFISIKLHSGLVR---CDESCH------GWWFWRSCD---------TTCSYFTTFWCYPVNIGPNYNGYQFGGI----------RQGSCPIGYIPLK-VGLSIEICVTVDADPFNPYAIKFGGFFSCSAGNPLAQEYVKNKPKLYSSSKMADLKYWPKTCAKGYVAHISSIEQGCQISYCTETNKVSLGP-----LPRIIKPPFISIDYNPNSTKVLIFTTKNGETFIKDNVGSWKLEDIQREKRNMLVGSIVGSFLMAACICLTIFFIQRRHYKRMI 2022
            SN V+   +  + C+   N   +  +VLPG GWDNL N+ MGR+++  + +C  + D  YL P+++ + P K + VE +SEI   + +    ++ SIN   +    +  +   FS+E  ++K+ Q++  S   RVQ+R   +     PD  L   F +++ +I    +EN  +   +YL++ +V D+GTHVI ++DAGA LS+ D L+S YV   +     +    +      F I   Y  K++   +  +  N+  + I + GGA F    SL  W+ S  NNLV IDR G PL+Y I    + +L Q T++K+ + + +AI RYY  N R GC+D+ + N+N  AN+D  +CE P+ N +FGG YQ C       GP C   AQ NP+TG FSC   +  + L S + +       C+      G+ +  +C             +   T+WC      P  +GY FGGI             SCP  YI LK +     ICV+ D +  N +++ FGG FSC + NPLA                       + C  GY  H+ ++  GC+I YC ++   + G      LP   K P +S+     +  V++ T  +  +       +WKL   + E+ N ++  I    +           +  RH++R++
Sbjct:   18 SNPVSRPTNWLRQCRASTNLSLKALEVLPGGGWDNLRNMDMGRVMNFGYFQCQTTKDGLYLNPDEVFVVPYKETGVETNSEIISSWLDQKGSTAASIN---DDVSDLPVLNAKFSSEIIRMKTHQVKDSSTTARVQVRNFIYSVKSYPDFALDSRFAHQVKEIVD-AIENNQTRRADYLSEKMVLDFGTHVITSVDAGASLSQEDYLHSSYVSVSDRSLIKLQAGLNFYDKLKFDISSNYTQKSS--TLQNYQSNITYSIIQSHGGAPFYPGISLQKWQESTKNNLVAIDRSGVPLHYLINSNTIQDLPQPTLNKVALTVSQAIERYYRINTRPGCVDVTAKNYNFQANVDDKSCEGPATNLSFGGVYQACTELSSDAGPLCEELAQKNPITGDFSCRYPYTPLLLRSEVRQEGYTTRDCYDIIYSCGFLYLYTCQREQCQDNYSVRSARILTYWCSVNGTAPENSGYLFGGIYSPSSPNPITNAKSCPANYISLKFLSDGQRICVSQDYELANNFSVPFGGLFSCESVNPLANN--------------------QRRCPPGYSQHLGTVSNGCEILYCVQSGLFTGGELLPIHLPPFTKAPLVSMQ---ATNTVMVMTKGDNSSVHVGGTKAWKLA--KPEEINTILKEIHPELIE----------MSSRHFERLV 653          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Medaka
Match: MPEG1 (macrophage-expressed gene 1 protein [Source:NCBI gene;Acc:101169041])

HSP 1 Score: 295.819 bits (756), Expect = 1.483e-88
Identity = 207/664 (31.17%), Postives = 316/664 (47.59%), Query Frame = 1
Query:  184 FDVLPGSGWDNLANIGMGRILDLNFSKCSFSNDNKYLIPNQLAIYPEKSSQVEISSEIFRHFSNYTSMSSQSINVGAEGGYGIFKIGGSFSTENTKIKSDQMETKSIFTRVQLRYLGFQSMFEPDTPLYPTFKNRIMDIAGLVVENKDSLYPEYLADMIVRDYGTHVIRAIDAGAILSKTDALNSQYVKKYEXXXXXXXXXXXXXXXXXXKIDGKYQTKTTQTNIDEFNHNVVKTHIDTVGGAIFGANTSLSDWENSVMNNLVPIDRRGEPLYYAITPRALPELDQETVHKIYVLIKKAILRYYTANGRIGCLDIYSPNFNPDANIDSGNCEHPSVNFTFGGTYQVC------GGPACGPYAQVNPLTGGFSCPSGFISIKLHS----------------------GLVRCD-ESCHGWWFWRSCDTTCSYFTTFWCYPVNIGPNYNGYQFGGI----------RQGSCPIGYIPLK-VGLSIEICVTVDADPFNPYAIKFGGFFSCSAGNPLAQEYVKNKPKLYSSSKMADLKYWPKTCAKGYVAHISSIEQGCQISYCTETNKVSLGPLPRIIKPPFISIDY-NPNSTKVLIFTTKNGETFIK-DNVGSWKL----------EDIQREKRNMLVGSIVG-SFLMAACICLTIFFIQRRHYKR 2016
             +VLPG GWDNL N+ MGR+++ ++ +C  + D  YLIP+++ + P K + VE +SEI   + +    ++ SIN   +    +  +   FS E T++K+ Q++  S   RVQ+R   +     PD  L   F +++ +IA   +EN  +   +YL++ +V D+GTHVI ++DAGA LS+ D L S YV    SDSS+I  SA  +F    K D         + +  +  N+  + I + GG  F    SL  W+ S  NNLV IDR G PL+Y I    + +L Q T++K+ + + +AI RYY  N R GC+D+ + N+N  AN+D  +C+ P+ N +FGG YQ C       GP C   AQ NP TG FSC S +    L S                      GL  C  + C   +  RS     +   T+WC      P  +GY FGGI             SCP  YI L+ +     ICV+ D +    +++ FGG FSC + NPLA                       + C  GY  H+ ++  GC+I YC ++   + G L  I  PPF      +  +T  ++  T+   ++++     +WKL          ++I  E   M  G   G +F +   + L +  +     KR
Sbjct:   70 LEVLPGGGWDNLRNMDMGRVMNFSYFQCQTTEDGLYLIPDEVFVVPYKETGVETNSEIISSWLDQKGSTAASIN---DDVSFLPVLNAKFSVEITRMKTHQVKDSSTTARVQVRNFIYSVKSYPDFALDSRFAHQVKEIAD-AIENNQTRRADYLSEKMVVDFGTHVITSVDAGASLSQEDYLRSSYVSNSVSDSSSIKASAGLNFFDKLKFDISSDYTQKSSTLQNYQSNITYSIIQSHGGTPFYPGISLQKWQESTKNNLVAIDRSGVPLHYLINTNTIQDLPQPTLNKVALTVSQAIERYYRINTRPGCVDVTAKNYNFQANVDDKSCKGPATNLSFGGVYQACTELSSDAGPLCEELAQKNPNTGDFSCRSPYTPTLLRSEVRQKGYTTYDCYDIRYSCGFLGLFTCHRKQCQDNYHVRS-----ARILTYWCSVNGKAPESSGYLFGGIYSPSSPNPITNAKSCPANYISLRFLSDGQRICVSQDYELATRFSVPFGGLFSCESVNPLANNQ--------------------RRCPPGYSQHLGTVSDGCEILYCVQSGLFTGGKLLPIHLPPFTKAPLVSMQATNTVMVMTEGDNSWVRVGGTKAWKLAKPEEINKIMKEIHPELNEMSSGQKAGVAFGVIGLMVLIVIMVVALRRKR 704          
BLAST of Macrophage-expressed gene 1 protein vs. Planmine SMEST
Match: SMESG000044681.1 (SMESG000044681.1)

HSP 1 Score: 1301.19 bits (3366), Expect = 0.000e+0
Identity = 649/668 (97.16%), Postives = 651/668 (97.46%), Query Frame = 1
Query:   97 FKILVRGSNEVNTIKDAYQLCQLMPNQRTFDVLPGSGWDNLANIGMGRILDLNFSKCSFSNDNKYLIPNQLAIYPEKSSQVEISSEIFRHFSNYTSMSSQSINVGAEGGYGIFKIGGSFSTENTKIKSDQMETKSIFTRVQLRYLGFQSMFEPDTPLYPTFKNRIMDIAGLVVENKDSLYPEYLADMIVRDYGTHVIRAIDAGAILSKTDALNSQYVKKYEXXXXXXXXXXXXXXXXXXKIDGKYQTKTTQTNIDEFNHNVVKTHIDTVGGAIFGANTSLSDWENSVMNNLVPIDRRGEPLYYAITPRALPELDQETVHKIYVLIKKAILRYYTANGRIGCLDIYSPNFNPDANIDSGNCEHPSVNFTFGGTYQVCGGPACGPYAQVNPLTGGFSCPSGFISIKLHSGLVRCDESCHGWWFWRSCDTTCSYFTTFWCYPVNIGPNYNGYQFGGIRQGSCPIGYIPLKVGLSIEICVTVDADPFNPYAIKFGGFFSCSAGNPLAQEYVKNKPKLYSSSKMADLKYWPKTCAKGYVAHISSIEQGCQISYCTETNKVSLGPLPRIIKPPFISIDYNPNSTKVLIFTTKNGETFIKDNVGSWKLEDIQREKRNMLVGSIVGSFLMAACICLTIFFIQRRHYKRMIEKLDYKPLTKNEQLADYGSINNTDRV 2100
            FKILV+GSNEVNTIKDAYQLCQLMPNQRTFDVLPGSGWDNLANIGMGRILDLNFSKCSFSNDNKYLIPNQLAIYPEKSSQVEISSEIFRHFSNYTSMSSQSINVGAEGGYGIFKIGGSFSTENTKIKSDQMETKSIFTRVQLRYLGFQSMFEPDTPLYPTFKNRIMDIAGLVVENKDSLYPEYLADMIVRDYGTHVIRAIDAGAILSKTDALNSQYVKKYESDSSTISVSASASFLSLFKIDGKYQTKTTQTNIDEFNHNVVKTHIDTVGGAIFGANTSLS+               GEPLYYAITPRALPELDQETVHKIYVLIKKAILRYYTANGRIGCLDIYSPNFNPDANIDSGNCEHPSVNFTFGGTYQVCGGPACGPYAQVNPLTGGFSCPSGFISIKLHSGLVRCDESCHGWWFWRSCDTTCSYFTTFWCYPVNIGPNYNGYQFGGIRQGSCPIGYIPLKVGLSIEICVTVDADPFNPYAIKFGGFFSCSAGNPLAQEYVKNKPKLYSSSKMADLKYWPKTCAKGYVAHISSIEQGCQISYCTETNKVS GPLPRIIKPPFISIDYNPNSTKVLIFTTKNGETFIKDNVGSWKLEDIQREKRNMLVGSIVGSFLMAACICLTIFFIQRRHYKRMIEKLDYKPLT NEQLADYGSINNTDRV
Sbjct:   12 FKILVKGSNEVNTIKDAYQLCQLMPNQRTFDVLPGSGWDNLANIGMGRILDLNFSKCSFSNDNKYLIPNQLAIYPEKSSQVEISSEIFRHFSNYTSMSSQSINVGAEGGYGIFKIGGSFSTENTKIKSDQMETKSIFTRVQLRYLGFQSMFEPDTPLYPTFKNRIMDIAGLVVENKDSLYPEYLADMIVRDYGTHVIRAIDAGAILSKTDALNSQYVKKYESDSSTISVSASASFLSLFKIDGKYQTKTTQTNIDEFNHNVVKTHIDTVGGAIFGANTSLSE---------------GEPLYYAITPRALPELDQETVHKIYVLIKKAILRYYTANGRIGCLDIYSPNFNPDANIDSGNCEHPSVNFTFGGTYQVCGGPACGPYAQVNPLTGGFSCPSGFISIKLHSGLVRCDESCHGWWFWRSCDTTCSYFTTFWCYPVNIGPNYNGYQFGGIRQGSCPIGYIPLKVGLSIEICVTVDADPFNPYAIKFGGFFSCSAGNPLAQEYVKNKPKLYSSSKMADLKYWPKTCAKGYVAHISSIEQGCQISYCTETNKVSFGPLPRIIKPPFISIDYNPNSTKVLIFTTKNGETFIKDNVGSWKLEDIQREKRNMLVGSIVGSFLMAACICLTIFFIQRRHYKRMIEKLDYKPLTNNEQLADYGSINNTDRV 664          
BLAST of Macrophage-expressed gene 1 protein vs. Planmine SMEST
Match: SMESG000044682.1 (SMESG000044682.1)

HSP 1 Score: 1159.82 bits (2999), Expect = 0.000e+0
Identity = 568/654 (86.85%), Postives = 603/654 (92.20%), Query Frame = 1
Query:  139 KDAYQLCQLMPNQRTFDVLPGSGWDNLANIGMGRILDLNFSKCSFSNDNKYLIPNQLAIYPEKSSQVEISSEIFRHFSNYTSMSSQSINVGAEGGYGIFKIGGSFSTENTKIKSDQMETKSIFTRVQLRYLGFQSMFEPDTPLYPTFKNRIMDIAGLVVENKDSLYPEYLADMIVRDYGTHVIRAIDAGAILSKTDALNSQYVKKYEXXXXXXXXXXXXXXXXXXKIDGKYQTKTTQTNIDEFNHNVVKTHIDTVGGAIFGANTSLSDWENSVMNNLVPIDRRGEPLYYAITPRALPELDQETVHKIYVLIKKAILRYYTANGRIGCLDIYSPNFNPDANIDSGNCEHPSVNFTFGGTYQVCGGPACGPYAQVNPLTGGFSCPSGFISIKLHSGLVRCDESCHGWWFWRSCDTTCSYFTTFWCYPVNIGPNYNGYQFGGIRQGSCPIGYIPLKVGLSIEICVTVDADPFNPYAIKFGGFFSCSAGNPLAQEYVKNKPKLYSSSKMADLKYWPKTCAKGYVAHISSIEQGCQISYCTETNKVSLGPLPRIIKPPFISIDYNPNSTKVLIFTTKNGETFIKDNVGSWKLEDIQREKRNMLVGSIVGSFLMAACICLTIFFIQRRHYKRMIEKLDYKPLTKNEQLADYGSINNTDRV 2100
            K+AY+LC L  NQ TFDVLPGSGWDNLAN+GMGRILDLNFSKCSFSNDNKYLIPNQLAIYP+K+SQVEISSEIFRHFSNYTSMSSQSIN+ AEG +G +KIGGSFSTENTKIKSDQMETKSI TRVQLRYL FQSMFEPDTPLYPTFKNRI+DIAGLV+ENKDSLYPEYLADMIVRDYGTHVIRAIDAGAILSKTDALNS+YVKKY SDSSTISVSASASFL +FKI G+YQTKT+QTNIDEFNHN  KTHIDTVGGAIFGAN SLSDWENSVMNNLVPIDRRGEPLYYAITPRALPELDQ TVHK+  L+KKAILRYY ANGRIGCLDIYSPNFNPDANIDSGNCEHPSVNFTFGGTYQVCGGPACGPYAQVNPLTGGFSCPSGFISIKLHSGLVRCDESCHGWWFWRSCDTTCSYFTTFWCYPVNIGPNYNGYQFGGIRQGSCPIGYIPLKV LS EICVTVDADPFNPYAIKFGGFFSCSAGNPLA+EYV  KPKL S+SKM  L YWPKTCAKGYVAHI SIEQGCQISYCTETNKVSLGPLP IIKPPFIS +YNPNSTKV +F  K GET IKD++G WK+E ++R+KR++L+GSI+GS L  ACICL +FF+QRRHYK+ I   D KPL  NEQ A+Y SINNT+ V
Sbjct:   29 KNAYELCHLRSNQLTFDVLPGSGWDNLANVGMGRILDLNFSKCSFSNDNKYLIPNQLAIYPQKTSQVEISSEIFRHFSNYTSMSSQSINLDAEGLFGHWKIGGSFSTENTKIKSDQMETKSILTRVQLRYLVFQSMFEPDTPLYPTFKNRIIDIAGLVIENKDSLYPEYLADMIVRDYGTHVIRAIDAGAILSKTDALNSRYVKKYASDSSTISVSASASFLGMFKISGRYQTKTSQTNIDEFNHNADKTHIDTVGGAIFGANMSLSDWENSVMNNLVPIDRRGEPLYYAITPRALPELDQTTVHKVTELLKKAILRYYMANGRIGCLDIYSPNFNPDANIDSGNCEHPSVNFTFGGTYQVCGGPACGPYAQVNPLTGGFSCPSGFISIKLHSGLVRCDESCHGWWFWRSCDTTCSYFTTFWCYPVNIGPNYNGYQFGGIRQGSCPIGYIPLKVALSTEICVTVDADPFNPYAIKFGGFFSCSAGNPLAKEYVNKKPKLPSNSKMEGLLYWPKTCAKGYVAHIVSIEQGCQISYCTETNKVSLGPLPLIIKPPFISTNYNPNSTKVFLFKNKKGETIIKDDLGYWKIEQLERQKRDILIGSIIGSLLTTACICLIVFFVQRRHYKQKIGNSDSKPLINNEQFANYCSINNTEPV 682          
BLAST of Macrophage-expressed gene 1 protein vs. Planmine SMEST
Match: SMESG000044677.1 (SMESG000044677.1)

HSP 1 Score: 868.226 bits (2242), Expect = 0.000e+0
Identity = 435/494 (88.06%), Postives = 457/494 (92.51%), Query Frame = 1
Query:   97 FKILVRGSNEVNTIKDAYQLCQLMPNQRTFDVLPGSGWDNLANIGMGRILDLNFSKCSFSNDNKYLIPNQLAIYPEKSSQVEISSEIFRHFSNYTSMSSQSINVGAEGGYGIFKIGGSFSTENTKIKSDQMETKSIFTRVQLRYLGFQSMFEPDTPLYPTFKNRIMDIAGLVVENKDSLYPEYLADMIVRDYGTHVIRAIDAGAILSKTDALNSQYVKKYEXXXXXXXXXXXXXXXXXXKIDGKYQTKTTQTNIDEFNHNVVKTHIDTVGGAIFGANTSLSDWENSVMNNLVPIDRRGEPLYYAITPRALPELDQETVHKIYVLIKKAILRYYTANGRIGCLDIYSPNFNPDANIDSGNCEHPSVNFTFGGTYQVCGGPACGPYAQVNPLTGGFSCPSGFISIKLHSGLVRCDESCHGWWFWRSCDTTCSYFTTFWCYPVNIGPNYNGYQFGGIRQGSCPIGYIPLKVGLSIEICVTVDADPFNPYAIKFGGFF 1578
            F+  V+GSNEVNTIKD+YQLC+L   Q+TFDVLPGSGWDNLANI MGRILDLNFSKCSFSNDNKYLIPNQLAIYPEKSSQVEISSEIF HFSNYTSMSSQSINVGAEGGYGIFKIGGSFSTENTKIKSDQMETKSIFTRV LRYLGFQSMFEPDTPLYPTFKNRIMDIAGLVVENKDSLYPEYLADMI+             G    K DALNS+YVKKY SDSS ISVSASASFLSLFKIDGKYQTK ++ +I+E+NHNVVKTHIDTVGGAIFGANTSLSDWENSVMNNLVPIDRRGEPLYYAITPRALPELDQ+TVHK++VL+KKAI+RYYTAN RIGCLD+YSPNFNPDANIDSGNCE PSVNFTFGGTYQ+CGGPACGPYAQVNPLTGGFSCPSGFISIKLHSGLVRCDESCHGWW WR CDTTCSYFTTFWCYPVNIGPNYNGYQFGGIR+ +CP+GYIPLKVGLS EICVTVDA PFNPYAIKFGGFF
Sbjct:   12 FRSAVKGSNEVNTIKDSYQLCRLTSKQKTFDVLPGSGWDNLANIDMGRILDLNFSKCSFSNDNKYLIPNQLAIYPEKSSQVEISSEIFHHFSNYTSMSSQSINVGAEGGYGIFKIGGSFSTENTKIKSDQMETKSIFTRVHLRYLGFQSMFEPDTPLYPTFKNRIMDIAGLVVENKDSLYPEYLADMIM------------LGRFCQKPDALNSRYVKKYASDSSAISVSASASFLSLFKIDGKYQTKNSKESINEYNHNVVKTHIDTVGGAIFGANTSLSDWENSVMNNLVPIDRRGEPLYYAITPRALPELDQKTVHKVFVLLKKAIVRYYTANVRIGCLDMYSPNFNPDANIDSGNCESPSVNFTFGGTYQICGGPACGPYAQVNPLTGGFSCPSGFISIKLHSGLVRCDESCHGWWVWRKCDTTCSYFTTFWCYPVNIGPNYNGYQFGGIRKENCPVGYIPLKVGLSTEICVTVDAGPFNPYAIKFGGFF 493          
BLAST of Macrophage-expressed gene 1 protein vs. Planmine SMEST
Match: SMESG000044677.1 (SMESG000044677.1)

HSP 1 Score: 850.121 bits (2195), Expect = 0.000e+0
Identity = 435/533 (81.61%), Postives = 457/533 (85.74%), Query Frame = 1
Query:   97 FKILVRGSNEVNTIKDAYQLCQLMPNQRTFDVLPGSGWDNLANIGMGRILDLNFSKCSFSNDNKYLIPNQLAIYPEKSSQVEISSEIFRHFSNYTSMSSQSINVGAEGGYGIFKIGGSFSTENTKIKSDQ---------------------------------------METKSIFTRVQLRYLGFQSMFEPDTPLYPTFKNRIMDIAGLVVENKDSLYPEYLADMIVRDYGTHVIRAIDAGAILSKTDALNSQYVKKYEXXXXXXXXXXXXXXXXXXKIDGKYQTKTTQTNIDEFNHNVVKTHIDTVGGAIFGANTSLSDWENSVMNNLVPIDRRGEPLYYAITPRALPELDQETVHKIYVLIKKAILRYYTANGRIGCLDIYSPNFNPDANIDSGNCEHPSVNFTFGGTYQVCGGPACGPYAQVNPLTGGFSCPSGFISIKLHSGLVRCDESCHGWWFWRSCDTTCSYFTTFWCYPVNIGPNYNGYQFGGIRQGSCPIGYIPLKVGLSIEICVTVDADPFNPYAIKFGGFF 1578
            F+  V+GSNEVNTIKD+YQLC+L   Q+TFDVLPGSGWDNLANI MGRILDLNFSKCSFSNDNKYLIPNQLAIYPEKSSQVEISSEIF HFSNYTSMSSQSINVGAEGGYGIFKIGGSFSTENTKIKSDQ                                       METKSIFTRV LRYLGFQSMFEPDTPLYPTFKNRIMDIAGLVVENKDSLYPEYLADMI+             G    K DALNS+YVKKY SDSS ISVSASASFLSLFKIDGKYQTK ++ +I+E+NHNVVKTHIDTVGGAIFGANTSLSDWENSVMNNLVPIDRRGEPLYYAITPRALPELDQ+TVHK++VL+KKAI+RYYTAN RIGCLD+YSPNFNPDANIDSGNCE PSVNFTFGGTYQ+CGGPACGPYAQVNPLTGGFSCPSGFISIKLHSGLVRCDESCHGWW WR CDTTCSYFTTFWCYPVNIGPNYNGYQFGGIR+ +CP+GYIPLKVGLS EICVTVDA PFNPYAIKFGGFF
Sbjct:   12 FRSAVKGSNEVNTIKDSYQLCRLTSKQKTFDVLPGSGWDNLANIDMGRILDLNFSKCSFSNDNKYLIPNQLAIYPEKSSQVEISSEIFHHFSNYTSMSSQSINVGAEGGYGIFKIGGSFSTENTKIKSDQAKWTSMSSQSVNVGADGDFEIFKIGGCFSSESTKIKTDKMETKSIFTRVHLRYLGFQSMFEPDTPLYPTFKNRIMDIAGLVVENKDSLYPEYLADMIM------------LGRFCQKPDALNSRYVKKYASDSSAISVSASASFLSLFKIDGKYQTKNSKESINEYNHNVVKTHIDTVGGAIFGANTSLSDWENSVMNNLVPIDRRGEPLYYAITPRALPELDQKTVHKVFVLLKKAIVRYYTANVRIGCLDMYSPNFNPDANIDSGNCESPSVNFTFGGTYQICGGPACGPYAQVNPLTGGFSCPSGFISIKLHSGLVRCDESCHGWWVWRKCDTTCSYFTTFWCYPVNIGPNYNGYQFGGIRKENCPVGYIPLKVGLSTEICVTVDAGPFNPYAIKFGGFF 532          
BLAST of Macrophage-expressed gene 1 protein vs. Planmine SMEST
Match: SMESG000044678.1 (SMESG000044678.1)

HSP 1 Score: 776.163 bits (2003), Expect = 0.000e+0
Identity = 367/517 (70.99%), Postives = 438/517 (84.72%), Query Frame = 1
Query:  544 MFEPDTPLYPTFKNRIMDIAGLVVENKDSLYPEYLADMIVRDYGTHVIRAIDAGAILSKTDALNSQYVKKYEXXXXXXXXXXXXXXXXXXKIDGKYQTKTTQTNIDEFNHNVVKTHIDTVGGAIFGANTSLSDWENSVMNNLVPIDRRGEPLYYAITPRALPELDQETVHKIYVLIKKAILRYYTANGRIGCLDIYSPNFNPDANIDSGNCEHPSVNFTFGGTYQVCGGPACGPYAQVNPLTGGFSCPSGFISIKLHSGLVRCDESCHGWWFWRSCDTTCSYFTTFWCYPVNIGPNYNGYQFGGIRQGSCPIGYIPLKVGLSIEICVTVDADPFNPYAIKFGGFFSCSAGNPLAQEYVKNKPKLYSSSKMADLKYWPKTCAKGYVAHISSIEQGCQISYCTETNKVSLGPLPRIIKPPFISIDYNPNSTKVLIFTTKNGETFIKDNVGSWKLEDIQREKRNMLVGSIVGSFLMAACICLTIFFIQRRHYKRMIEKLDYKPLTKNEQLADYGSINNTD 2094
            MFEPDTPLYPTFKNRIMDIAGLVVE KDSLYPEYLADMIVRDYGTHVIRAIDAGAILSKTDAL S+Y K Y+SDS+TISVSA+ASFL+LF +  K+Q+ T+Q  ++E+N N+ KTHIDT+GG +FGANT+L+DWE +VMNNLVPIDRRGEPLYY ITPRALPELD ETV+++Y L+KKAI RYY  NGR GCLDI SPNFNPDANIDSGNCEHPSVNFTFGG YQ C GP+C    Q NPLTG +SCPSGF S++LH GLV+C + CHGWW +R+C+T CSY+T +WC+P   G NYNGYQFGGIRQGSCPIG+IPLK GL+IEICVT+D DP NP+ I+FGG FSCSAGNPLA+EYV  K K + + KM D+KYWPKTCAKG+VAHI++IEQGCQISYCTETNKVS G  PR+IKPPFISI+YNPNSTKVL+F+   GET IKDN G+WK+++++++ R++L+G+IVGS L+AACIC  IF+IQRR+Y    + ++ K  T  E + +YGSIN T+
Sbjct:    1 MFEPDTPLYPTFKNRIMDIAGLVVEKKDSLYPEYLADMIVRDYGTHVIRAIDAGAILSKTDALQSKYAKSYQSDSTTISVSATASFLNLFSMSSKFQSTTSQEKVNEYNENISKTHIDTIGGGLFGANTTLADWEETVMNNLVPIDRRGEPLYYVITPRALPELDDETVNQVYQLVKKAIERYYFRNGRKGCLDIMSPNFNPDANIDSGNCEHPSVNFTFGGVYQSCEGPSCSSSVQENPLTGTYSCPSGFSSLELHRGLVKCIQICHGWWIFRNCETKCSYYTLYWCHPNESGSNYNGYQFGGIRQGSCPIGFIPLKFGLNIEICVTIDTDPNNPFVIQFGGLFSCSAGNPLAKEYVNGKAKSFQNLKMNDIKYWPKTCAKGFVAHIATIEQGCQISYCTETNKVSYGAFPRLIKPPFISINYNPNSTKVLVFSNLKGETLIKDNFGTWKVDELKKQNRDLLIGTIVGSLLLAACICFVIFYIQRRYYINRYKLINRKKFTDEESMTNYGSINGTE 517          
The following BLAST results are available for this feature:
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
MPEG11.372e-10933.96macrophage expressed 1 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mpeg1.18.432e-10131.91macrophage expressed 1, tandem duplicate 1 [Source... [more]
mpeg1.18.432e-10131.91macrophage expressed 1, tandem duplicate 1 [Source... [more]
mpeg1.34.026e-9732.50macrophage expressed 1, tandem duplicate 3 [Source... [more]
mpeg1.29.226e-9431.90macrophage expressed 1, tandem duplicate 2 [Source... [more]
mpeg1.19.185e-1440.63macrophage expressed 1, tandem duplicate 1 [Source... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Mpeg12.044e-10431.00macrophage expressed gene 1 [Source:MGI Symbol;Acc... [more]
Pfpl2.974e-9829.82pore forming protein-like [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5RBP9|MPEG1_PONAB6.707e-11034.07Macrophage-expressed gene 1 protein OS=Pongo abeli... [more]
sp|Q2M385|MPEG1_HUMAN6.590e-10933.96Macrophage-expressed gene 1 protein OS=Homo sapien... [more]
sp|Q2KJC3|MPEG1_BOVIN2.640e-10431.21Macrophage-expressed gene 1 protein OS=Bos taurus ... [more]
sp|A1L314|MPEG1_MOUSE1.060e-10331.10Macrophage-expressed gene 1 protein OS=Mus musculu... [more]
sp|Q9WV57|MPEG1_RAT3.151e-10131.84Macrophage-expressed gene 1 protein OS=Rattus norv... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2B4RFA82.640e-13438.09Macrophage-expressed gene 1 protein OS=Stylophora ... [more]
A7SEK61.002e-12437.31Predicted protein (Fragment) OS=Nematostella vecte... [more]
Q6RYF82.997e-12237.76Macrophage expressed protein OS=Haliotis rufescens... [more]
A0A1S3J0V44.489e-12239.23LOW QUALITY PROTEIN: macrophage-expressed gene 1 p... [more]
A0A1R7T0A14.582e-12236.81Macrophage expressed protein OS=Haliotis madaka OX... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSAMXT00000015822.21.883e-8431.99pep primary_assembly:Astyanax_mexicanus-2.0:6:8259... [more]
MPEG14.860e-8331.65macrophage expressed 1 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO378791.386e-12837.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO282667.099e-2243.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSORLT00000006104.23.359e-9329.54pep primary_assembly:ASM223467v1:9:9652430:9669002... [more]
MPEG11.483e-8831.17macrophage-expressed gene 1 protein [Source:NCBI g... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000044681.10.000e+097.16SMESG000044681.1[more]
SMESG000044682.10.000e+086.85SMESG000044682.1[more]
SMESG000044677.10.000e+088.06SMESG000044677.1[more]
SMESG000044677.10.000e+081.61SMESG000044677.1[more]
SMESG000044678.10.000e+070.99SMESG000044678.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029077 ID=SMED30029077|Name=Macrophage-expressed gene 1 protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2367bp
TAAGTAAAACAAAAATTCGAAATTTGTATATTAATGCGAACAAAGTTTAA
AAATTTATTGTAAATGTATATTCAAATATTACTAATAATTAGTCTTTTCA
AAATATTAGTGAGAGGATCAAATGAAGTCAATACTATTAAGGATGCGTAT
CAATTGTGTCAGTTGATGCCCAATCAAAGAACGTTCGATGTTTTACCTGG
ATCAGGATGGGATAACCTGGCCAATATCGGCATGGGAAGGATACTTGATT
TAAACTTTTCGAAGTGTTCATTTTCCAATGACAACAAATATCTGATCCCG
AATCAACTGGCCATTTATCCAGAAAAATCTTCCCAAGTTGAAATCTCAAG
TGAAATATTCCGTCATTTCTCAAATTACACATCTATGTCTTCGCAATCTA
TCAATGTTGGTGCTGAAGGTGGCTACGGAATATTTAAAATTGGGGGATCT
TTTTCCACGGAAAATACAAAGATCAAAAGTGATCAGATGGAAACGAAATC
CATTTTCACCAGAGTTCAGTTGCGATATTTGGGGTTCCAGTCAATGTTTG
AGCCGGATACGCCTCTCTATCCAACATTCAAGAACAGAATTATGGACATT
GCTGGATTAGTTGTTGAAAATAAAGACTCACTTTATCCTGAGTATTTGGC
TGACATGATTGTTCGAGACTACGGGACCCATGTAATCCGTGCTATAGATG
CTGGGGCGATTTTGTCAAAAACCGATGCTTTGAATTCACAATACGTAAAG
AAATATGAATCGGATAGTTCCACAATCTCCGTTTCTGCGTCAGCATCTTT
TCTTAGTTTGTTTAAAATAGATGGTAAATACCAAACTAAAACTACACAAA
CGAATATTGATGAGTTCAATCACAACGTTGTTAAAACTCACATTGATACG
GTCGGAGGTGCCATATTTGGAGCCAATACGTCTTTGTCCGACTGGGAAAA
TTCTGTCATGAATAATTTAGTTCCCATAGATCGGAGGGGTGAACCATTAT
ACTATGCCATTACTCCTCGTGCCTTGCCAGAACTGGATCAAGAAACCGTG
CACAAAATTTATGTCTTAATAAAGAAAGCAATTCTACGATATTATACAGC
CAATGGCCGAATTGGATGCCTTGATATATATTCTCCAAACTTCAATCCGG
ATGCCAATATTGATTCTGGGAATTGTGAACATCCGTCTGTGAATTTTACT
TTTGGAGGTACTTATCAAGTTTGCGGTGGTCCTGCATGTGGTCCATATGC
TCAAGTAAATCCATTAACAGGAGGGTTTTCTTGTCCCTCTGGATTTATTT
CGATAAAACTTCACAGTGGCTTAGTTCGATGTGACGAATCATGTCATGGG
TGGTGGTTTTGGAGAAGCTGCGATACAACTTGCTCTTATTTTACCACTTT
TTGGTGTTATCCGGTGAATATCGGCCCAAATTACAATGGATATCAATTTG
GAGGAATTCGTCAAGGAAGTTGTCCCATTGGATATATTCCACTCAAGGTC
GGATTAAGCATAGAAATTTGTGTGACAGTTGATGCTGACCCGTTCAATCC
ATATGCTATTAAATTTGGCGGCTTTTTCAGCTGCAGTGCCGGAAATCCGC
TAGCTCAAGAATATGTTAAAAACAAACCAAAGTTATATTCCAGTTCGAAA
ATGGCAGATTTAAAATATTGGCCTAAAACCTGTGCCAAAGGTTATGTGGC
TCACATTTCATCAATTGAACAAGGCTGTCAGATTTCATACTGTACAGAGA
CAAATAAAGTTTCTTTAGGCCCTTTACCTCGGATAATTAAACCTCCATTT
ATTTCAATTGATTACAATCCAAACAGCACGAAAGTTTTAATATTTACAAC
CAAAAACGGTGAAACGTTTATAAAAGATAACGTTGGATCATGGAAATTAG
AGGACATTCAAAGAGAGAAAAGAAATATGTTAGTTGGATCAATCGTTGGA
AGTTTTCTAATGGCTGCCTGCATCTGTTTGACGATTTTCTTCATTCAAAG
AAGACATTATAAACGAATGATTGAAAAGTTAGATTATAAACCATTAACAA
AGAATGAACAATTGGCGGACTACGGCTCAATAAATAATACAGACAGAGTG
TAATTAAAACAACAAAATTAAATGTTTTTCAAACATTTTTAGCTTAGCTC
ATGAAAACAATTTACATTGTTCACAAAATTTATTTGCATTTTTTATCAAT
TATTGTAATTGCTTAATGTCGTTAATAATTACATTTTTATATGGAAATAT
ATCTGATTTCATTATTTTTTCAAAATGATAAGATGACTATTTAATTTTGT
TTGATAGCAAGAGAACAAAAAATTTTGTGATTAATTCTGATGATTTATTG
ATCTATTTTCATTTGAC
back to top

protein sequence of SMED30029077-orf-1

>SMED30029077-orf-1 ID=SMED30029077-orf-1|Name=SMED30029077-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=680bp
MYIQILLIISLFKILVRGSNEVNTIKDAYQLCQLMPNQRTFDVLPGSGWD
NLANIGMGRILDLNFSKCSFSNDNKYLIPNQLAIYPEKSSQVEISSEIFR
HFSNYTSMSSQSINVGAEGGYGIFKIGGSFSTENTKIKSDQMETKSIFTR
VQLRYLGFQSMFEPDTPLYPTFKNRIMDIAGLVVENKDSLYPEYLADMIV
RDYGTHVIRAIDAGAILSKTDALNSQYVKKYESDSSTISVSASASFLSLF
KIDGKYQTKTTQTNIDEFNHNVVKTHIDTVGGAIFGANTSLSDWENSVMN
NLVPIDRRGEPLYYAITPRALPELDQETVHKIYVLIKKAILRYYTANGRI
GCLDIYSPNFNPDANIDSGNCEHPSVNFTFGGTYQVCGGPACGPYAQVNP
LTGGFSCPSGFISIKLHSGLVRCDESCHGWWFWRSCDTTCSYFTTFWCYP
VNIGPNYNGYQFGGIRQGSCPIGYIPLKVGLSIEICVTVDADPFNPYAIK
FGGFFSCSAGNPLAQEYVKNKPKLYSSSKMADLKYWPKTCAKGYVAHISS
IEQGCQISYCTETNKVSLGPLPRIIKPPFISIDYNPNSTKVLIFTTKNGE
TFIKDNVGSWKLEDIQREKRNMLVGSIVGSFLMAACICLTIFFIQRRHYK
RMIEKLDYKPLTKNEQLADYGSINNTDRV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000106ciliated epithelial cell
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR020864MACPF
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane