Transient receptor potential cation channel subfamily M member 2

Overview
NameTransient receptor potential cation channel subfamily M member 2
Smed IDSMED30029075
Length (bp)3710
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transient receptor potential cation channel subfamily M member 2 (SMED30029075) t-SNE clustered cells

Violin plots show distribution of expression levels for Transient receptor potential cation channel subfamily M member 2 (SMED30029075) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transient receptor potential cation channel subfamily M member 2 (SMED30029075) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transient receptor potential cation channel subfamily M member 2 (SMED30029075) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029075

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30029075SMESG000035341.1 SmedASXL_014132SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30029075SMESG000035341.1 dd_Smed_v4_9288_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30029075SMESG000035341.1 dd_Smed_v4_9288_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029075SMESG000035341.1 dd_Smed_v4_9288_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30029075SMESG000035341.1 dd_Smed_v4_9288_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029075SMESG000035344.1 SMESG000035341.1 Contig39676newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029075SMESG000035344.1 SMESG000035341.1 Contig39676uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30029075SMESG000035341.1 dd_Smed_v4_9288_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Human
Match: TRPM3 (transient receptor potential cation channel subfamily M member 3 [Source:HGNC Symbol;Acc:HGNC:17992])

HSP 1 Score: 321.242 bits (822), Expect = 2.014e-90
Identity = 305/1155 (26.41%), Postives = 530/1155 (45.89%), Query Frame = 1
Query:  148 YGAIQLSGYRVIAGKNPKYVRVHKDLSNIKGELYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKEA-------DCSVVQLIVEGGKNTIQTGAEALKSN--IPVVVMKGSKRAADVICDVVESSSD--MFQDTIKLK-LEEFEKEWNITTDEEKGNFQKNLVIFYECYQIGK-VHLFNM-KDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEINI-NLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKANAH-LHTAVNFIFKGTIDSPEKQSLKMIGRLINQLTDNLFPQMYQEANSDSCSCCCW--KSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEE-----SSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMRY-QEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNI-FQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXEDFKRTEYLSKFRKEQHESLDEVGFCSAIRF---------FYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDFIY-CRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQV-----------DTSYMEGSQCLFGYCATPNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKLNICK------NSNNGRLSVDAFIANLIHEEDLECSGFEQQCMETY 3456
            +G I+  G     G + K + V          L  LMT  W  + PKL+IS++GG +N   L    K  F +GLI  + +   WI TGG  TGV + VG+A KD++  S+ +  T+ GI  WG   N+E L  +     +  P           + L+  H  FIL D+G+  K+G E+K R + E+ +S +           VV LIVEGG N I    E L+    +PVVV  GS RA+D++    + S +  +  ++++ + L   +K +  T  + +  F    +I  EC +  + + +F M  +   ++D AI+ A   G     P     +L LA+ +NR D+A  +IF   +   +  + +L   M  AL+ ++  FV   +  G+++  FLT S L +LY      ++ L+  V  + KG +    + SL  IG +I  L    +   Y      +     +  K PK          + +++  E  I       TT          +EE        E+ +  +P             +L +WA+L +R +MA  FW+ G++ +  ALVA  +C ++  +A     ++ ++  + +   +F  LA+ +L ++Y++D+     LL   L  W   +CL +A   +  +F+ H+  Q  L ++W+G++    N   ++++ +          + P ++L                 E  +KD   +  ++ E     + Q    +  +   K K +ED + T  L +   E     DE    S  R          FY API KF    ++Y+ +L +F+Y +L+++      P+      +  I I YI  L  E  +  +  +    + K   W    WN  DL   ++F++  ILR  + D  F    R ++ +++  +YIR ++ + V + +GP V+MI +M+ D+++F+ I L+ L ++G    ++L+PN   +  L +NIFY PYW ++G+V           + +  +G       C T   IV    A +LL  N+LL++LLIA+F  TF +V+  SN+VW F RY++I  F+ RP+LPPP  +F      F+   C+      + +     +  FI +   +E  +   FE+QC+E Y
Sbjct:  139 FGTIEFQG----GGHSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQN-FELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALKDHASKSRGKICTI-GIAPWGIVENQEDLIGRD----VVRPYQTMSNPMSKLTVLNSMHSHFILADNGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLF----IILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASAP----DQLSLALAWNRVDIARSQIF---IYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPK----------ALKLLGMEDDIPLRRGRKTTK-------KREEEVDIDLDDPEINHFPFPF-----------HELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGI----------LLPPSIL---------------SLEFKNKDDMPYMSQAQEI----HLQEKEAEEPEKPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKMER---WPST-----QEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILR--LQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHLCCRWRKHESDPDERDYGLKLFITD---DELKKVHDFEEQCIEEY 1202          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Human
Match: TRPM3 (transient receptor potential cation channel subfamily M member 3 [Source:HGNC Symbol;Acc:HGNC:17992])

HSP 1 Score: 319.701 bits (818), Expect = 4.396e-89
Identity = 307/1156 (26.56%), Postives = 532/1156 (46.02%), Query Frame = 1
Query:  148 YGAIQLSGYRVIAGKNPKYVRVHKDLSNIKGELYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKEA-------DCSVVQLIVEGGKNTIQTGAEALKSN--IPVVVMKGSKRAADVICDVVESSSD--MFQDTIKLK-LEEFEKEWNITTDEEKGNFQKNLVIFYECYQIGK-VHLFNM-KDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEINI-NLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKANAH-LHTAVNFIFKGTIDSPEKQSLKMIGRLINQLTDNLFPQMYQEANSDSCSCCCW--KSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEE-----SSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMRY-QEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNI-FQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXEDFKRTEYLSKFRKEQHESLDEVGFCSAIRF---------FYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLG-EIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDFIY-CRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQV-----------DTSYMEGSQCLFGYCATPNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKLNICK------NSNNGRLSVDAFIANLIHEEDLECSGFEQQCMETY 3456
            +G I+  G     G + K + V          L  LMT  W  + PKL+IS++GG +N   L    K  F +GLI  + +   WI TGG  TGV + VG+A KD++  S+ +  T+ GI  WG   N+E L  +     +  P           + L+  H  FIL D+G+  K+G E+K R + E+ +S +           VV LIVEGG N I    E L+    +PVVV  GS RA+D++    + S +  +  ++++ + L   +K +  T  + +  F    +I  EC +  + + +F M  +   ++D AI+ A   G     P     +L LA+ +NR D+A  +IF   +   +  + +L   M  AL+ ++  FV   +  G+++  FLT S L +LY      ++ L+  V  + KG +    + SL  IG +I  L    +   Y      +     +  K PK          + +++  E  I       TT          +EE        E+ +  +P             +L +WA+L +R +MA  FW+ G++ +  ALVA  +C ++  +A     ++ ++  + +   +F  LA+ +L ++Y++D+     LL   L  W   +CL +A   +  +F+ H+  Q  L ++W+G++    N   ++++ +          + P ++L                 E  +KD   +  ++ E     + Q    +  +   K K +ED + T  L +   E     DE    S  R          FY API KF    ++Y+ +L +F+Y +L+++         +    E+ I I YI F LG E  +  +  +    + K   W    WN  DL   ++F++  ILR  + D  F    R ++ +++  +YIR ++ + V + +GP V+MI +M+ D+++F+ I L+ L ++G    ++L+PN   +  L +NIFY PYW ++G+V           + +  +G       C T   IV    A +LL  N+LL++LLIA+F  TF +V+  SN+VW F RY++I  F+ RP+LPPP  +F      F+   C+      + +     +  FI +   +E  +   FE+QC+E Y
Sbjct:  139 FGTIEFQG----GGHSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQN-FELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALKDHASKSRGKICTI-GIAPWGIVENQEDLIGRD----VVRPYQTMSNPMSKLTVLNSMHSHFILADNGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLF----IILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASAP----DQLSLALAWNRVDIARSQIF---IYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPK----------ALKLLGMEDDIPLRRGRKTTK-------KREEEVDIDLDDPEINHFPFPF-----------HELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGI----------LLPPSIL---------------SLEFKNKDDMPYMSQAQEI----HLQEKEAEEPEKPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKMER-------WPSTQEW-IVISYI-FTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILR--LQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHLCCRWRKHESDPDERDYGLKLFITD---DELKKVHDFEEQCIEEY 1202          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Human
Match: TRPM3 (transient receptor potential cation channel subfamily M member 3 [Source:HGNC Symbol;Acc:HGNC:17992])

HSP 1 Score: 315.464 bits (807), Expect = 7.308e-88
Identity = 306/1145 (26.72%), Postives = 531/1145 (46.38%), Query Frame = 1
Query:  202 YVRVHKDLSNIKGELYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKEA-------DCSVVQLIVEGGKNTIQTGAEALKSN--IPVVVMKGSKRAADVICDVVESSSD--MFQDTIKLK-LEEFEKEWNITTDEEKGNFQKNLVIFYECYQIGK-VHLFNM-KDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEINI-NLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKANAH-LHTAVNFIFKGTIDSPEKQSLKMIGRLINQLTDNLFPQMYQEANSDSCSCCCW--KSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMRY-QEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNI-FQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXEDFKRTEYLSKFRKEQHESLDEVGFCSAIRF---------FYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLG-EIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDFIY-CRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQV-----------DTSYMEGSQC------------LFGYCATPNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKLNICK------NSNNGRLSVDAFIANLIHEEDLECSGFEQQCMETY 3456
            YVRV  D       L  LMT  W  + PKL+IS++GG +N   L    K  F +GLI  + +   WI TGG  TGV + VG+A KD++  S+ +  T+ GI  WG   N+E L  +     +  P           + L+  H  FIL D+G+  K+G E+K R + E+ +S +           VV LIVEGG N I    E L+    +PVVV  GS RA+D++    + S +  +  ++++ + L   +K +  T  + +  F    +I  EC +  + + +F M  +   ++D AI+ A   G     P     +L LA+ +NR D+A  +IF   +   +  + +L   M  AL+ ++  FV   +  G+++  FLT S L +LY      ++ L+  V  + KG +    + SL  IG +I  L    +   Y      +     +  K PK          + +++  E  I P+     T      +++ D +   E+ +  +P             +L +WA+L +R +MA  FW+ G++ +  ALVA  +C ++  +A     ++ ++  + +   +F  LA+ +L ++Y++D+     LL   L  W   +CL +A   +  +F+ H+  Q  L ++W+G++    N   ++++ +          + P ++L                 E  +KD   +  ++ E     + Q    +  +   K K +ED + T  L +   E     DE    S  R          FY API KF    ++Y+ +L +F+Y +L+++         +    E+ I I YI F LG E  +  +  +    + K   W    WN  DL   ++F++  ILR  + D  F    R ++ +++  +YIR ++ + V + +GP V+MI +M+ D+++F+ I L+ L ++G    ++L+PN   +  L +NIFY PYW ++G+V           D+   + + C                C T   IV    A +LL  N+LL++LLIA+F  TF +V+  SN+VW F RY++I  F+ RP+LPPP  +F      F+   C+      + +     +  FI +   +E  +   FE+QC+E Y
Sbjct:    2 YVRVSFDTK--PDLLLHLMTKEWQLELPKLLISVHGGLQN-FELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALKDHASKSRGKICTI-GIAPWGIVENQEDLIGRD----VVRPYQTMSNPMSKLTVLNSMHSHFILADNGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLF----IILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASAP----DQLSLALAWNRVDIARSQIF---IYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPK----------ALKLLGMEDDI-PLRRGRKTTKKREEEVDIDLDDP-EINHFPFPF-----------HELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGI----------LLPPSIL---------------SLEFKNKDDMPYMSQAQEI----HLQEKEAEEPEKPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKMER-------WPSTQEW-IVISYI-FTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILR--LQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDRKQVYDSHTPKSAPCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHLCCRWRKHESDPDERDYGLKLFITD---DELKKVHDFEEQCIEEY 1061          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Human
Match: TRPM3 (transient receptor potential cation channel subfamily M member 3 [Source:HGNC Symbol;Acc:HGNC:17992])

HSP 1 Score: 314.694 bits (805), Expect = 1.312e-87
Identity = 307/1145 (26.81%), Postives = 529/1145 (46.20%), Query Frame = 1
Query:  202 YVRVHKDLSNIKGELYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKEA-------DCSVVQLIVEGGKNTIQTGAEALKSN--IPVVVMKGSKRAADVICDVVESSSD--MFQDTIKLK-LEEFEKEWNITTDEEKGNFQKNLVIFYECYQIGK-VHLFNM-KDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEINI-NLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKANA----HLHTAVN---------FIFKGTIDSPEKQSLKMIGRLINQLTDNLFPQMYQEANSDSCSCCCW--KSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMRY-QEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNI-FQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXEDFKRTEYLSKFRKEQHESLDEVGFCSAIRF---------FYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLG-EIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDFIY-CRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQV-----------DTSYMEGSQCLFGYCATPNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKLNICK------NSNNGRLSVDAFIANLIHEEDLECSGFEQQCMETY 3456
            YVRV  D       L  LMT  W  + PKL+IS++GG +N   L    K  F +GLI  + +   WI TGG  TGV + VG+A KD++  S+ +  T+ GI  WG   N+E L  +     +  P           + L+  H  FIL D+G+  K+G E+K R + E+ +S +           VV LIVEGG N I    E L+    +PVVV  GS RA+D++    + S +  +  ++++ + L   +K +  T  + +  F    +I  EC +  + + +F M  +   ++D AI+ A   G     P     +L LA+ +NR D+A  +IF   +   +  + +L   M  AL+ ++  FV   +  G+++  FLT S L +LY      +    HL   V            FKG +    + SL  IG +I  L    +   Y      +     +  K PK          + +++  E  I P+     T      +++ D +   E+ +  +P             +L +WA+L +R +MA  FW+ G++ +  ALVA  +C ++  +A     ++ ++  + +   +F  LA+ +L ++Y++D+     LL   L  W   +CL +A   +  +F+ H+  Q  L ++W+G++    N   ++++ +          + P ++L                 E  +KD   +  ++ E     + Q    +  +   K K +ED + T  L +   E     DE    S  R          FY API KF    ++Y+ +L +F+Y +L+++         +    E+ I I YI F LG E  +  +  +    + K   W    WN  DL   ++F++  ILR  + D  F    R ++ +++  +YIR ++ + V + +GP V+MI +M+ D+++F+ I L+ L ++G    ++L+PN   +  L +NIFY PYW ++G+V           + +  +G       C T   IV    A +LL  N+LL++LLIA+F  TF +V+  SN+VW F RY++I  F+ RP+LPPP  +F      F+   C+      + +     +  FI +   +E  +   FE+QC+E Y
Sbjct:    2 YVRVSFDTK--PDLLLHLMTKEWQLELPKLLISVHGGLQN-FELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALKDHASKSRGKICTI-GIAPWGIVENQEDLIGRD----VVRPYQTMSNPMSKLTVLNSMHSHFILADNGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLF----IILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASAP----DQLSLALAWNRVDIARSQIF---IYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKREYPGFGWIYFKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPK----------ALKLLGMEDDI-PLRRGRKTTKKREEEVDIDLDDP-EINHFPFPF-----------HELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGI----------LLPPSIL---------------SLEFKNKDDMPYMSQAQEI----HLQEKEAEEPEKPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKMER-------WPSTQEW-IVISYI-FTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILR--LQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHLCCRWRKHESDPDERDYGLKLFITD---DELKKVHDFEEQCIEEY 1061          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Human
Match: TRPM3 (transient receptor potential cation channel subfamily M member 3 [Source:HGNC Symbol;Acc:HGNC:17992])

HSP 1 Score: 314.694 bits (805), Expect = 1.312e-87
Identity = 307/1145 (26.81%), Postives = 529/1145 (46.20%), Query Frame = 1
Query:  202 YVRVHKDLSNIKGELYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKEA-------DCSVVQLIVEGGKNTIQTGAEALKSN--IPVVVMKGSKRAADVICDVVESSSD--MFQDTIKLK-LEEFEKEWNITTDEEKGNFQKNLVIFYECYQIGK-VHLFNM-KDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEINI-NLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKANA----HLHTAVN---------FIFKGTIDSPEKQSLKMIGRLINQLTDNLFPQMYQEANSDSCSCCCW--KSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMRY-QEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNI-FQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXEDFKRTEYLSKFRKEQHESLDEVGFCSAIRF---------FYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLG-EIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDFIY-CRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQV-----------DTSYMEGSQCLFGYCATPNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKLNICK------NSNNGRLSVDAFIANLIHEEDLECSGFEQQCMETY 3456
            YVRV  D       L  LMT  W  + PKL+IS++GG +N   L    K  F +GLI  + +   WI TGG  TGV + VG+A KD++  S+ +  T+ GI  WG   N+E L  +     +  P           + L+  H  FIL D+G+  K+G E+K R + E+ +S +           VV LIVEGG N I    E L+    +PVVV  GS RA+D++    + S +  +  ++++ + L   +K +  T  + +  F    +I  EC +  + + +F M  +   ++D AI+ A   G     P     +L LA+ +NR D+A  +IF   +   +  + +L   M  AL+ ++  FV   +  G+++  FLT S L +LY      +    HL   V            FKG +    + SL  IG +I  L    +   Y      +     +  K PK          + +++  E  I P+     T      +++ D +   E+ +  +P             +L +WA+L +R +MA  FW+ G++ +  ALVA  +C ++  +A     ++ ++  + +   +F  LA+ +L ++Y++D+     LL   L  W   +CL +A   +  +F+ H+  Q  L ++W+G++    N   ++++ +          + P ++L                 E  +KD   +  ++ E     + Q    +  +   K K +ED + T  L +   E     DE    S  R          FY API KF    ++Y+ +L +F+Y +L+++         +    E+ I I YI F LG E  +  +  +    + K   W    WN  DL   ++F++  ILR  + D  F    R ++ +++  +YIR ++ + V + +GP V+MI +M+ D+++F+ I L+ L ++G    ++L+PN   +  L +NIFY PYW ++G+V           + +  +G       C T   IV    A +LL  N+LL++LLIA+F  TF +V+  SN+VW F RY++I  F+ RP+LPPP  +F      F+   C+      + +     +  FI +   +E  +   FE+QC+E Y
Sbjct:    2 YVRVSFDTK--PDLLLHLMTKEWQLELPKLLISVHGGLQN-FELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALKDHASKSRGKICTI-GIAPWGIVENQEDLIGRD----VVRPYQTMSNPMSKLTVLNSMHSHFILADNGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLF----IILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASAP----DQLSLALAWNRVDIARSQIF---IYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKREYPGFGWIYFKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPK----------ALKLLGMEDDI-PLRRGRKTTKKREEEVDIDLDDP-EINHFPFPF-----------HELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGI----------LLPPSIL---------------SLEFKNKDDMPYMSQAQEI----HLQEKEAEEPEKPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKMER-------WPSTQEW-IVISYI-FTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILR--LQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHLCCRWRKHESDPDERDYGLKLFITD---DELKKVHDFEEQCIEEY 1061          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Celegans
Match: gtl-2 (Gon-Two Like (TRP subfamily) [Source:UniProtKB/TrEMBL;Acc:Q20766])

HSP 1 Score: 286.96 bits (733), Expect = 3.200e-79
Identity = 301/1133 (26.57%), Postives = 521/1133 (45.98%), Query Frame = 1
Query:  199 KYVRVHKDLSNIKGELYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSK-KQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVS----KEADCSVVQLIVEGGKNTIQTGAE--ALKSNIPVVVMKGSKRAADVICDVVE--SSSDMFQDTIKLKLEEFEKEWNITTDEEKGNFQKNLVIFYECYQIGKVHLFNMKDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEININLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKANAHLHTAVNFIFK-GTIDSPEKQSLKMIGRLINQLTDNLFPQMYQEANSDSCSCCCWKSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKA-----GAKGEIEIMNNWMRYQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIP----NFVNIFQILINVP----FGY-----LTSRIFI--FPYNLLGKRQTQAVQTNNS---EPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXEDFKRTEYLSKFRKEQHESLDEVGFCSAIRFFYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFF------MGGQVKNFISK-FNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDFIYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNI-NITSPLMRNIFYNPYWQLFGQV-----DTSYMEGSQCLFGYCATPNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFK-LNICKNSNNGRLSVDAFIANLIHEEDLE-CSGFEQQCMET 3453
            +YVR+  D   +  ++  LM  VWG + P+L+I+++GG  N   L       F++G++  +++   WI+T G ++GV + V +A  +  I ++ +     +GI  WG    KE+L  Q E     Y +     V      L+  H  F+L D+G+  +FG ++  R   E  ++          VV  ++EGG ++I    +   +K +IP +V  GS RAAD+I       +S   F   +  KL    K     TD+E+  F+K      EC  + +  L  +  +    +  +     S  ++ Q L  + +L L +++NR D+A+  +F N  RK   ++ L   M  AL  ++  FV+  L  G+++++FL+ + L +LY  +  N+  H+  N++    ++D     ++ MIG+++ +L  N F Q+Y  + S       +K  +I+ S  F+    +++  E + +    +          IN +EE      Y                 DL +WA+LT R  MA+  W  G+D +   L+A  +  +  K A       +    + +N ++ +E+    AI +L + YR D  RT  LL   LP+WG  +CL +A       FL H  CQ  L  +W G +     + V +   LI  P      Y      T+R+     P  L   R++    T+N      G E   +   E    + +  I  + +N+ +          +   FKR   L+KF +               R FY++PITKF    I++L FLT  +  LL+E    +L P+ Y    E+  +I+ ++  +  I +        +  +VK F +K +N W S+   +F +G    F +  + R++       + R L S S  +FY++  E+  V   +GP + M ++M+  + +   + L+ L A+G    +L  PN+ +    L+RNIFY PY+ L+G+V     DT   EG +C  GY   P  +V      FLL  N+LLL+LLIA+F   +    E S  +W F RY+ + E++  P LPPPF++F   Y+F   L   +  +  R   +  I   + E++++    FE+ C++T
Sbjct:  171 QYVRLSYDSEPL--DVMYLMEKVWGLEAPRLVITVHGGMSN-FELEERLGRLFRKGMLKAAQTTGAWIITSGLDSGVVRHVAKALDEAGISARMRSQIVTIGIAPWGVIKRKERLIRQNEH---VYYDVHSLSVNANVGILNDRHSYFLLADNGTVGRFGADLHLRQNLENHIATFGCNGRKVPVVCTLLEGGISSINAIHDYVTMKPDIPAIVCDGSGRAADIISFAARYINSDGTFAAEVGEKLRNLIKMVFPETDQEEM-FRK----ITEC--VIRDDLLRIFRYGQEEEEDVDFVILSTVLQKQNLPPDEQLALTLSWNRVDLAKSCLFSNG-RKWSSDV-LEKAMNDALYWDRVDFVECLLENGVSMKNFLSINRLENLYNMDDINS-AHSVRNWMENFDSMDPHTYLTIPMIGQVVEKLMGNAF-QLYYTSRSFKGKYDRYK--RINQSSYFHRKR-KIVQKELFKKKSDDQ----------INDNEEEDFSFAYPF--------------NDLLIWAVLTSRHGMAECMWVHGEDAMAKCLLAIRLYKATAKIAEDEYLDVEEAKRLFDNAVKCRED----AIELLDQCYRADHDRTLRLLRMELPHWGNNNCLSLAVLANTKTFLAHPCCQILLAELWHGSLKVRSGSNVRVLTALICPPAILFMAYKPKHSKTARLLSEETPEQLPYPRESITSTTSNRYRYSKGPEEQKETLLEKGSYTKKVTIISSRKNSGVASVYGSASSMM---FKREPQLNKFER--------------FRAFYSSPITKFWSWCIAFLIFLTTQTCILLLE---TSLKPSKY----EWITFIYTVTLSVEHIRKLMTSEGSRINEKVKVFYAKWYNIWTSAALLFFLVG--YGFRLVPMYRHS-------WGRVLLSFSNVLFYMKIFEYLSVHPLLGPYIQMAAKMVWSMCYICVLLLVPLMAFGVNRQALTEPNVKDWHWLLVRNIFYKPYFMLYGEVYAGEIDTCGDEGIRCFPGYFIPPLLMV-----IFLLVANILLLNLLIAIFNNIYNDSIEKSKEIWLFQRYQQLMEYHDSPFLPPPFSIFAHVYHFIDYLYNLRRPDTKRFRSEHSIKLSVTEDEMKRIQDFEEDCIDT 1217          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Celegans
Match: gtl-1 (GTL-1; Gon-Two Like (TRP subfamily) [Source:UniProtKB/TrEMBL;Acc:G5ECM4])

HSP 1 Score: 139.428 bits (350), Expect = 6.999e-33
Identity = 124/455 (27.25%), Postives = 209/455 (45.93%), Query Frame = 1
Query:  148 YGAIQLSGYRVIAGKNPKYVRVHKDLSNIKGELYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLA--FKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPN--YDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVS----KEADCSVVQLIVEGGKNTIQTGAEALKS--NIPVVVMKGSKRAADVICDVVESSSD--MFQDTIKLKLEEFEKEWNITTDEEKGNFQKNLVIFYEC-YQIGKVHLFNM-KDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEININLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKANAHLHTAVNFIFKGTIDSPEKQSLKMIGRLINQLTDNLFPQMY 1470
            YG I   G       + +Y R+  D  +   ++  LM  VW  K PKLII++NGG   +   +   KLA  F++G++ ++KS   WI+T G + GV K +  A  D+   + K     +GI +WG    + +     +D  +TY    ++  ++ +    L+  H  F+  D+G+  ++G EI  R   E  ++    K +   +V +++EGG  TI+   + + +   IPV+V  GS RAAD++    ++ S      D I+ +L    +        +    QK +    EC      + +F + +  + +LD  I+    S  +K Q L    +L LA+ +NRAD+A   IF N         +L   M  AL  ++  FV   L  G++++ FLT   L  LY  +K   +     N +    +DS     L  +GRL+  L  NL+   Y
Sbjct:  196 YGNIVFEG----TAHHAQYARISFD--SDPRDIVHLMMKVWKLKPPKLIITINGG---LTKFDLQPKLARTFRKGIMKIAKSTDAWIITSGLDEGVVKHLDSALHDHGNHTSKNHVVAIGIASWGMLKQRSRFV--GKDSTVTYATNVFNNTRLKE----LNDNHSYFLFSDNGTVNRYGAEIIMRKRLEAYLAQGDKKRSAIPLVCVVLEGGAFTIKMVHDYVTTIPRIPVIVCDGSGRAADILAFAHQAVSQNGFLSDNIRNQLVNIVRR---IFGYDPKTAQKLIKQIVECSTNKSLMTIFRLGESSREDLDHVIM----SCLLKGQNLSPPEQLQLALAWNRADIARTEIFANGTEWT--TQDLHNAMIEALSNDRIDFVHLLLENGVSMQKFLTYGRLEHLYNTDKGPQNT-LRTNLL----VDSKHHIKLVEVGRLVENLMGNLYKSNY 621          

HSP 2 Score: 94.3597 bits (233), Expect = 4.643e-19
Identity = 49/132 (37.12%), Postives = 75/132 (56.82%), Query Frame = 1
Query: 1711 YTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAG-AKGEIEIMNNWMRYQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKI 2103
            Y   DL +WA+LT+R +MAK+ W  G++ +  ALVA+ +  SL K A  A GEI +  ++  + +EF  LA+ +L    +  + +T  LL   L  WG E+CL +A  N    FL H  CQ  L+++W G +
Sbjct:  715 YPYSDLMIWAVLTKRQKMAKLMWTHGEEGMAKALVASRLYVSLAKTASLATGEIGMSQDFTEFSDEFSELAVEVLEYCTKHGRDQTLRLLTCELANWGDETCLSLAANNGHRKFLAHPCCQMLLSDLWQGGL 846          

HSP 3 Score: 66.6254 bits (161), Expect = 1.267e-10
Identity = 83/329 (25.23%), Postives = 145/329 (44.07%), Query Frame = 1
Query: 2458 FYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAY------------SRKIEYCIYIFYISFLLGEIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDFIYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQV-----DTSYMEGSQ------------------CLFGYCATPNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKL 3339
            FY APIT + +   +++ FL + +Y LL++   I      Y             RK+   I +     +L ++  FF   Q +N +  F                + + IAY +R  ++ +     R L   +  ++ ++ +++  VQQ +GP + +++ M+  ++    +  I L+A+G    S+ YP  +    L+RNIF  PY+ L+G+V     DT   E  Q                  C+ GY   P     V    F+L TNVLL+++++A     F K  +++  ++ F RY  + E+   P LPPPF +       FKL
Sbjct: 1073 FYKAPITTYWLWFFAFIWFLILLTYNLLVKTQRIASWSEWYVFAYIFVWTLEIGRKVVSTIMMDTSKPVLKQLRVFFF--QYRNGLLAFG--------------LLTYLIAYFIR--LSPTTKTLGRILIICNSVIWSLKLVDYLSVQQGLGPYINIVAEMIPTMIPLCVLVFITLYAFGLLRQSITYPYEDWHWILVRNIFLQPYFMLYGEVYAAEIDTCGDEIWQTHEDENIPISMLNVTHETCVPGYWIAP-----VGLTVFMLATNVLLMNVMVAGCTYIFEKHIQSTREIFLFERYGQVMEYESTPWLPPPFTIIYHVIWLFKL 1378          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Celegans
Match: gon-2 (Transient receptor potential channel [Source:UniProtKB/Swiss-Prot;Acc:Q93971])

HSP 1 Score: 117.857 bits (294), Expect = 3.058e-26
Identity = 110/415 (26.51%), Postives = 197/415 (47.47%), Query Frame = 1
Query:  148 YGAIQLSGYRVIAGKNP---KYVRVHKDLSNIKGELYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLA--FKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKEA-------DCSVVQLIVEGGKNTIQTGAEALKS--NIPVVVMKGSKRAADVICDVVESSSD--MFQDTIKLKLEEFEKEWNITTDEEKGNFQKNLVIFYECYQIGKVHLFNMKD-FKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEININLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKA 1341
            +G ++  G     G +P   +YVRV+ D       +  L  +VW    P+LII+++GG  N    +   KLA  F++GL+  + +   WI+T G +TGV K V  A+ + +  +++     +GI  WG    +E    Q +    T P Y     G+    L+  H  F+L D+G+  ++G E+  R   E  +S++           VV +++EGG  TI++  + + +   +PVVV  GS RAAD++    ++ ++  +  D I+ ++    +     ++         L +  +   +  + +F + +  ++++D AI+ A   G    Q L    +L LA+ +NR D+A   +F   +        L   M  ALI ++  FV   L QG+ ++ FLT S L +LY  +K 
Sbjct:  277 FGQVEFQG-----GPHPYKAQYVRVNFDTE--PAYIMSLFEHVWQISPPRLIITVHGGTSN---FDLQPKLARVFRKGLLKAASTTGAWIITSGCDTGVVKHVA-AALEGAQSAQRNKIVCIGIAPWGLLKKREDFIGQDK----TVPYYPSSSKGRFTG-LNNRHSYFLLVDNGTVGRYGAEVILRKRLEMYISQKQKIFGGTRSVPVVCVVLEGGSCTIRSVLDYVTNVPRVPVVVCDGSGRAADLLAFAHQNVTEDGLLPDDIRRQVLLLVETTFGCSEAAAHRLLHELTVCAQHKNL--LTIFRLGEQGEHDVDHAILTALLKG----QNLSAADQLALALAWNRVDIARSDVF--AMGHEWPQAALHNAMMEALIHDRVDFVRLLLEQGINMQKFLTISRLDELYNTDKG 667          

HSP 2 Score: 90.1225 bits (222), Expect = 7.911e-18
Identity = 78/299 (26.09%), Postives = 140/299 (46.82%), Query Frame = 1
Query: 2458 FYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDFIYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQV-----DTSYME-------------------GSQCLFGYCATPNAI---VQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEF 3273
            FY+API+ F    IS++ F+T F+Y LL++       PT     IEY +  +  +F L ++ +  M    K F  K   +  S WN   +   I + + + +R         Y R + +    ++ ++ +++  V   +GP V M  +M++++ + + + ++ L ++G    S+ YP+      L+RNIF  PY+ L+G+V     DT   E                   G  C+ GY   P  +   + +AN        +LL+S+LIA+F   F   +E S ++W F RY+ + E+
Sbjct: 1201 FYSAPISTFWSWTISFILFITFFTYTLLVK---TPPRPTV----IEYILIAYVAAFGLEQVRKIIMS-DAKPFYEKIRTYVCSFWNCVTILAIIFYIVGFFMRCF---GSVAYGRVILACDSVLWTMKLLDYMSVHPKLGPYVTMAGKMIQNMSYIIVMLVVTLLSFGLARQSITYPDETWHWILVRNIFLKPYFMLYGEVYADEIDTCGDEAWDQHLENGGPVILGNGTTGLSCVPGYWIPPLLMTFFLLIAN--------ILLMSMLIAIFNHIFDATDEMSQQIWLFQRYKQVMEY 1480          

HSP 3 Score: 84.3445 bits (207), Expect = 5.363e-16
Identity = 57/178 (32.02%), Postives = 86/178 (48.31%), Query Frame = 1
Query: 1711 YTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAK-GEIEIMNNWMRYQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLG----KIPNFVNIFQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNN 2229
            Y   +L +WA+LT+R +MA   W+ G++ +  ALVA  +  SL  +A     E+EI     +Y EEF  L++ +L   Y  D  +T  LL   L  W  E+CL +A      +FL H  CQ  L ++W G    +  + + +   LI  PF  +    F     LL + QT A   N+
Sbjct:  850 YPYSELMIWAVLTKRQDMAMCMWQHGEEAMAKALVACRLYKSLATEAAEDYLEVEICEELKKYAEEFRILSLELLDHCYHVDDAQTLQLLTYELSNWSNETCLALAVIVNNKHFLAHPCCQILLADLWHGGLRMRTHSNIKVVLGLICPPFIQMLE--FKTREELLNQPQTAAEHQND 1025          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Celegans
Match: gon-2 (Transient receptor potential channel [Source:UniProtKB/Swiss-Prot;Acc:Q93971])

HSP 1 Score: 117.472 bits (293), Expect = 3.814e-26
Identity = 110/415 (26.51%), Postives = 197/415 (47.47%), Query Frame = 1
Query:  148 YGAIQLSGYRVIAGKNP---KYVRVHKDLSNIKGELYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLA--FKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKEA-------DCSVVQLIVEGGKNTIQTGAEALKS--NIPVVVMKGSKRAADVICDVVESSSD--MFQDTIKLKLEEFEKEWNITTDEEKGNFQKNLVIFYECYQIGKVHLFNMKD-FKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEININLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKA 1341
            +G ++  G     G +P   +YVRV+ D       +  L  +VW    P+LII+++GG  N    +   KLA  F++GL+  + +   WI+T G +TGV K V  A+ + +  +++     +GI  WG    +E    Q +    T P Y     G+    L+  H  F+L D+G+  ++G E+  R   E  +S++           VV +++EGG  TI++  + + +   +PVVV  GS RAAD++    ++ ++  +  D I+ ++    +     ++         L +  +   +  + +F + +  ++++D AI+ A   G    Q L    +L LA+ +NR D+A   +F   +        L   M  ALI ++  FV   L QG+ ++ FLT S L +LY  +K 
Sbjct:  378 FGQVEFQG-----GPHPYKAQYVRVNFDTE--PAYIMSLFEHVWQISPPRLIITVHGGTSN---FDLQPKLARVFRKGLLKAASTTGAWIITSGCDTGVVKHVA-AALEGAQSAQRNKIVCIGIAPWGLLKKREDFIGQDK----TVPYYPSSSKGRFTG-LNNRHSYFLLVDNGTVGRYGAEVILRKRLEMYISQKQKIFGGTRSVPVVCVVLEGGSCTIRSVLDYVTNVPRVPVVVCDGSGRAADLLAFAHQNVTEDGLLPDDIRRQVLLLVETTFGCSEAAAHRLLHELTVCAQHKNL--LTIFRLGEQGEHDVDHAILTALLKG----QNLSAADQLALALAWNRVDIARSDVF--AMGHEWPQAALHNAMMEALIHDRVDFVRLLLEQGINMQKFLTISRLDELYNTDKG 768          

HSP 2 Score: 90.5077 bits (223), Expect = 6.821e-18
Identity = 78/299 (26.09%), Postives = 140/299 (46.82%), Query Frame = 1
Query: 2458 FYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDFIYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQV-----DTSYME-------------------GSQCLFGYCATPNAI---VQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEF 3273
            FY+API+ F    IS++ F+T F+Y LL++       PT     IEY +  +  +F L ++ +  M    K F  K   +  S WN   +   I + + + +R         Y R + +    ++ ++ +++  V   +GP V M  +M++++ + + + ++ L ++G    S+ YP+      L+RNIF  PY+ L+G+V     DT   E                   G  C+ GY   P  +   + +AN        +LL+S+LIA+F   F   +E S ++W F RY+ + E+
Sbjct: 1302 FYSAPISTFWSWTISFILFITFFTYTLLVK---TPPRPTV----IEYILIAYVAAFGLEQVRKIIMS-DAKPFYEKIRTYVCSFWNCVTILAIIFYIVGFFMRCF---GSVAYGRVILACDSVLWTMKLLDYMSVHPKLGPYVTMAGKMIQNMSYIIVMLVVTLLSFGLARQSITYPDETWHWILVRNIFLKPYFMLYGEVYADEIDTCGDEAWDQHLENGGPVILGNGTTGLSCVPGYWIPPLLMTFFLLIAN--------ILLMSMLIAIFNHIFDATDEMSQQIWLFQRYKQVMEY 1581          

HSP 3 Score: 84.3445 bits (207), Expect = 5.069e-16
Identity = 57/178 (32.02%), Postives = 86/178 (48.31%), Query Frame = 1
Query: 1711 YTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAK-GEIEIMNNWMRYQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLG----KIPNFVNIFQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNN 2229
            Y   +L +WA+LT+R +MA   W+ G++ +  ALVA  +  SL  +A     E+EI     +Y EEF  L++ +L   Y  D  +T  LL   L  W  E+CL +A      +FL H  CQ  L ++W G    +  + + +   LI  PF  +    F     LL + QT A   N+
Sbjct:  951 YPYSELMIWAVLTKRQDMAMCMWQHGEEAMAKALVACRLYKSLATEAAEDYLEVEICEELKKYAEEFRILSLELLDHCYHVDDAQTLQLLTYELSNWSNETCLALAVIVNNKHFLAHPCCQILLADLWHGGLRMRTHSNIKVVLGLICPPFIQMLE--FKTREELLNQPQTAAEHQND 1126          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Celegans
Match: gon-2 (Transient receptor potential channel [Source:UniProtKB/Swiss-Prot;Acc:Q93971])

HSP 1 Score: 117.087 bits (292), Expect = 4.784e-26
Identity = 110/415 (26.51%), Postives = 197/415 (47.47%), Query Frame = 1
Query:  148 YGAIQLSGYRVIAGKNP---KYVRVHKDLSNIKGELYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLA--FKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKEA-------DCSVVQLIVEGGKNTIQTGAEALKS--NIPVVVMKGSKRAADVICDVVESSSD--MFQDTIKLKLEEFEKEWNITTDEEKGNFQKNLVIFYECYQIGKVHLFNMKD-FKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEININLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKA 1341
            +G ++  G     G +P   +YVRV+ D       +  L  +VW    P+LII+++GG  N    +   KLA  F++GL+  + +   WI+T G +TGV K V  A+ + +  +++     +GI  WG    +E    Q +    T P Y     G+    L+  H  F+L D+G+  ++G E+  R   E  +S++           VV +++EGG  TI++  + + +   +PVVV  GS RAAD++    ++ ++  +  D I+ ++    +     ++         L +  +   +  + +F + +  ++++D AI+ A   G    Q L    +L LA+ +NR D+A   +F   +        L   M  ALI ++  FV   L QG+ ++ FLT S L +LY  +K 
Sbjct:  317 FGQVEFQG-----GPHPYKAQYVRVNFDTE--PAYIMSLFEHVWQISPPRLIITVHGGTSN---FDLQPKLARVFRKGLLKAASTTGAWIITSGCDTGVVKHVA-AALEGAQSAQRNKIVCIGIAPWGLLKKREDFIGQDK----TVPYYPSSSKGRFTG-LNNRHSYFLLVDNGTVGRYGAEVILRKRLEMYISQKQKIFGGTRSVPVVCVVLEGGSCTIRSVLDYVTNVPRVPVVVCDGSGRAADLLAFAHQNVTEDGLLPDDIRRQVLLLVETTFGCSEAAAHRLLHELTVCAQHKNL--LTIFRLGEQGEHDVDHAILTALLKG----QNLSAADQLALALAWNRVDIARSDVF--AMGHEWPQAALHNAMMEALIHDRVDFVRLLLEQGINMQKFLTISRLDELYNTDKG 707          

HSP 2 Score: 90.5077 bits (223), Expect = 7.124e-18
Identity = 78/299 (26.09%), Postives = 140/299 (46.82%), Query Frame = 1
Query: 2458 FYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDFIYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQV-----DTSYME-------------------GSQCLFGYCATPNAI---VQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEF 3273
            FY+API+ F    IS++ F+T F+Y LL++       PT     IEY +  +  +F L ++ +  M    K F  K   +  S WN   +   I + + + +R         Y R + +    ++ ++ +++  V   +GP V M  +M++++ + + + ++ L ++G    S+ YP+      L+RNIF  PY+ L+G+V     DT   E                   G  C+ GY   P  +   + +AN        +LL+S+LIA+F   F   +E S ++W F RY+ + E+
Sbjct: 1241 FYSAPISTFWSWTISFILFITFFTYTLLVK---TPPRPTV----IEYILIAYVAAFGLEQVRKIIMS-DAKPFYEKIRTYVCSFWNCVTILAIIFYIVGFFMRCF---GSVAYGRVILACDSVLWTMKLLDYMSVHPKLGPYVTMAGKMIQNMSYIIVMLVVTLLSFGLARQSITYPDETWHWILVRNIFLKPYFMLYGEVYADEIDTCGDEAWDQHLENGGPVILGNGTTGLSCVPGYWIPPLLMTFFLLIAN--------ILLMSMLIAIFNHIFDATDEMSQQIWLFQRYKQVMEY 1520          

HSP 3 Score: 84.3445 bits (207), Expect = 5.716e-16
Identity = 57/178 (32.02%), Postives = 86/178 (48.31%), Query Frame = 1
Query: 1711 YTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAK-GEIEIMNNWMRYQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLG----KIPNFVNIFQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNN 2229
            Y   +L +WA+LT+R +MA   W+ G++ +  ALVA  +  SL  +A     E+EI     +Y EEF  L++ +L   Y  D  +T  LL   L  W  E+CL +A      +FL H  CQ  L ++W G    +  + + +   LI  PF  +    F     LL + QT A   N+
Sbjct:  890 YPYSELMIWAVLTKRQDMAMCMWQHGEEAMAKALVACRLYKSLATEAAEDYLEVEICEELKKYAEEFRILSLELLDHCYHVDDAQTLQLLTYELSNWSNETCLALAVIVNNKHFLAHPCCQILLADLWHGGLRMRTHSNIKVVLGLICPPFIQMLE--FKTREELLNQPQTAAEHQND 1065          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339075)

HSP 1 Score: 306.22 bits (783), Expect = 1.622e-86
Identity = 308/1154 (26.69%), Postives = 516/1154 (44.71%), Query Frame = 1
Query:   97 PSVESDC-SEFW---RHEKFQ----YGAIQLSGYRVIAGKNP---KYVRVHKDLSNIKGELY-KLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTV--LGIGTWG-ATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSK-------EADCSVVQLIVEGGKNTIQTGAEALKSN--IPVVVMKGSKRAADVICDVVESSSDMFQDTIKLKLEEF-----EKEWNITTDEEKGNFQ--------KNLVIFYECYQIGKVHLFNMKDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNE-ININLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKANAH-----LHTAVNFIFKGTIDSPEKQSLKMIGRLINQLTDNLFPQMYQEANSDSCSCCCWKSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKG-EIEIMNNWMRYQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNI-FQILINVPFGYLTSRIFIFPYNLLGKRQTQAV-QTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXED---FKRTEYLSKFRK-EQHESLDEVGFCSAIRFFYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILR---NTVNDSDFIYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQV---DTSYMEGSQCLFGYCATPNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKLNICKNSNNGRLSVDAFI 3390
            P +ES    + W   +H + Q    YG I+  G     G +P   +YVR+  D    + EL  +L T  W  + PKL+I++ GG  N   L    K   ++GL+  +K+   WI TGG  TGV+K VG+A     +  +++T  V  +GI  WG    N E L    E      P +         + L+  H  F+L D+G+  K+G E+  R + E+ +S         +   VV L++EGG NTI+   E +  +  +PVVV  GS RAAD++  V + +SD  +  +   + ++     +K + +  D+ +  +Q        KNL+  +   +         +     LD  I+ A F    K Q L    +L LA+T+NR D+A   IF   V   E  N  L   M  AL  ++  FV   L  G++++ FLT   L +LY  +   A+     L      I KG I      +L  IG +IN+L    +   Y                K+ +S +          Y++Y                 + G    + EM    +P             +L +WA+LT+R +MA + W  G++ +  +LV+  +  ++  +A     + EI      Y +EFE+    +L  +YR+D  +   LL   L  W  +SCL +A        L H   Q  L ++W+G +    N  F++++ +   +     +I   +   K + Q + QT       + L  D S+  Q  +E ++   Y     +  +  K      D   F+    LS++ + +QH+ L           FYTAPITKF  + I+Y+ FL MFS+ +L+++  +      YS        I YI+ L  E  +  +  +      KF+ W  +MWN  D    I+F I    R   NT++    IYC     +    +Y+R +    V + +GP V M+ +M+K++++F+ +  + L ++G    ++LYPN   T  L++ + + PY+ L+G+V   D     G       C T + +  +  + +LL  N+LL++LLIA+F   F +V   S++VW F R+ ++ E+  +P+LPPPF     FY+  K  + K      +S  +F+
Sbjct:   51 PGIESGSPGDLWLPTKHTRPQPTDAYGTIEFQG-----GAHPTKAQYVRLSFD---TRPELLVQLFTKEWNLELPKLLITVQGGKANF-DLQAKLKKEIRKGLLKAAKTTGAWIFTGGTNTGVTKQVGDA---LLLEGQQRTGRVVSIGIAPWGIVERNHELLGHNRE-----VPCHSISSPRSKLAVLNNRHAYFLLVDNGTQAKYGAELILRRKLEKFISNLKLHPFTHSSTPVVCLVIEGGTNTIRAVLEYVTDSPPVPVVVCDGSGRAADLLAFVHKYASDGEEQPVLESMRDYLIGTIQKTFEVGLDQSEKLYQELLQCTRNKNLITVFRIQE-------KPEGEAQELDQTILTALF----KSQHLSPPEQLSLALTWNRVDIARSEIF---VYGQEWPNGALDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELYNTKHGPANTLGYILRDVRPHIPKGYI-----YTLHDIGLVINKLMGGAYRSYYTRRKFRPIYA------KVMNSYANACRKSSTYQYQRY---------AGANSLSLVTGLLPFTSEMALFEFPF-----------NELLIWAVLTKRQQMALLMWTHGEEALAKSLVSCKLYKAMAHEAAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDAEKAQRLLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGLRTRKNTNFKVILGLAMPF-----YIRQLDFKSKEELQQMPQTEEEHLENQNLDNDDSDRSQPDAEALLADTYSVRDTKVHENGKVSLTDSDTAQFREFFNLSEYNEVKQHQPLR---LKKKFYEFYTAPITKFWADSIAYMFFLIMFSFTVLVKMEQMPRWQEWYS--------IAYITTLGFEKVREIISSEPVAITHKFSVWAWNMWNPCDGAAIILFVIGLAFRFRENTMDIGRVIYC-----VDSIYWYLRILNILGVNKYLGPLVTMMGKMVKNMIYFVVLLAVVLMSFGVSRQAILYPNKQPTWSLIKEVTFQPYFMLYGEVFAGDIDPPCGEDPSQPGCVTGHWVTPITMSMYLLIANILLINLLIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPPFIALCHFYSLLKYCVRKAKGEPGMSKFSFV 1121          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339079)

HSP 1 Score: 309.686 bits (792), Expect = 4.170e-86
Identity = 317/1190 (26.64%), Postives = 534/1190 (44.87%), Query Frame = 1
Query:   97 PSVESDC-SEFW---RHEKFQ----YGAIQLSGYRVIAGKNP---KYVRVHKDLSNIKGELY-KLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTV--LGIGTWG-ATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSK-------EADCSVVQLIVEGGKNTIQTGAEALKSN--IPVVVMKGSKRAADVICDVVESSSDMFQDTIKLKLEEF-----EKEWNITTDEEKGNFQ--------KNLVIFYECYQIGKVHLFNMKDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNE-ININLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKANAH-----LHTAVNFIFKGTIDSPEKQSLKMIGRLINQLTDNLFPQMYQEANSDSCSCCCWKSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKG-EIEIMNNWMRYQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNI-FQILINVPFGYLTSRIFIFPYNLLGKRQTQAV-QTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXED---FKRTEYLSKFRK-EQHESLDEVGFCSAIRFFYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILR---NTVNDSDFIYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQV---DTSYMEGSQCLFGYCATPNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKLNICKNSNNGRLSVDAFIANLIHEEDLE-CSGFEQQCMETY-----LITNQLLD 3480
            P +ES    + W   +H + Q    YG I+  G     G +P   +YVR+  D    + EL  +L T  W  + PKL+I++ GG  N   L    K   ++GL+  +K+   WI TGG  TGV+K VG+A     +  +++T  V  +GI  WG    N E L    E      P +         + L+  H  F+L D+G+  K+G E+  R + E+ +S         +   VV L++EGG NTI+   E +  +  +PVVV  GS RAAD++  V + +SD  +  +   + ++     +K + +  D+ +  +Q        KNL+  +   +         +     LD  I+ A F    K Q L    +L LA+T+NR D+A   IF   V   E  N  L   M  AL  ++  FV   L  G++++ FLT   L +LY  +   A+     L      I KG I      +L  IG +IN+L    +   Y                K+ +S +          Y++Y                 + G    + EM    +P             +L +WA+LT+R +MA + W  G++ +  +LV+  +  ++  +A     + EI      Y +EFE+    +L  +YR+D  +   LL   L  W  +SCL +A        L H   Q  L ++W+G +    N  F++++ +   +     +I   +   K + Q + QT       + L  D S+  Q  +E ++   Y     +  +  K      D   F+    LS++ + +QH+ L           FYTAPITKF  + I+Y+ FL MFS+ +L+++  +      YS        I YI+ L  E  +  +  +      KF+ W  +MWN  D    I+F I    R   NT++    IYC     +    +Y+R +    V + +GP V M+ +M+K++++F+ +  + L ++G    ++LYPN   T  L++ + + PY+ L+G+V   D     G       C T + +  +  + +LL  N+LL++LLIA+F   F +V   S++VW F R+ ++ E+  +P+LPPPF     FY+  K  + + +    +  D  +   + ++DLE    FE++C+E +     +I NQ  D
Sbjct:   58 PGIESGSPGDLWLPTKHTRPQPTDAYGTIEFQG-----GAHPTKAQYVRLSFD---TRPELLVQLFTKEWNLELPKLLITVQGGKAN-FDLQAKLKKEIRKGLLKAAKTTGAWIFTGGTNTGVTKQVGDA---LLLEGQQRTGRVVSIGIAPWGIVERNHELLGHNRE-----VPCHSISSPRSKLAVLNNRHAYFLLVDNGTQAKYGAELILRRKLEKFISNLKLHPFTHSSTPVVCLVIEGGTNTIRAVLEYVTDSPPVPVVVCDGSGRAADLLAFVHKYASDGEEQPVLESMRDYLIGTIQKTFEVGLDQSEKLYQELLQCTRNKNLITVFRIQE-------KPEGEAQELDQTILTALF----KSQHLSPPEQLSLALTWNRVDIARSEIF---VYGQEWPNGALDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELYNTKHGPANTLGYILRDVRPHIPKGYI-----YTLHDIGLVINKLMGGAYRSYYTRRKFRPIYA------KVMNSYANACRKSSTYQYQRY---------AGANSLSLVTGLLPFTSEMALFEFPF-----------NELLIWAVLTKRQQMALLMWTHGEEALAKSLVSCKLYKAMAHEAAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDAEKAQRLLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGLRTRKNTNFKVILGLAMPF-----YIRQLDFKSKEELQQMPQTEEEHLENQNLDNDDSDRSQPDAEALLADTYSVRDTKVHENGKVSLTDSDTAQFREFFNLSEYNEVKQHQPLR---LKKKFYEFYTAPITKFWADSIAYMFFLIMFSFTVLVKMEQMPRWQEWYS--------IAYITTLGFEKVREIISSEPVAITHKFSVWAWNMWNPCDGAAIILFVIGLAFRFRENTMDIGRVIYC-----VDSIYWYLRILNILGVNKYLGPLVTMMGKMVKNMIYFVVLLAVVLMSFGVSRQAILYPNKQPTWSLIKEVTFQPYFMLYGEVFAGDIDPPCGEDPSQPGCVTGHWVTPITMSMYLLIANILLINLLIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPPFIALCHFYSLLKYCV-RKAKGLEVQRDNGLKLFLEKDDLERLYDFEEECVEGFFHEQEIILNQSTD 1163          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339076)

HSP 1 Score: 309.686 bits (792), Expect = 4.835e-86
Identity = 317/1190 (26.64%), Postives = 534/1190 (44.87%), Query Frame = 1
Query:   97 PSVESDC-SEFW---RHEKFQ----YGAIQLSGYRVIAGKNP---KYVRVHKDLSNIKGELY-KLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTV--LGIGTWG-ATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSK-------EADCSVVQLIVEGGKNTIQTGAEALKSN--IPVVVMKGSKRAADVICDVVESSSDMFQDTIKLKLEEF-----EKEWNITTDEEKGNFQ--------KNLVIFYECYQIGKVHLFNMKDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNE-ININLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKANAH-----LHTAVNFIFKGTIDSPEKQSLKMIGRLINQLTDNLFPQMYQEANSDSCSCCCWKSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKG-EIEIMNNWMRYQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNI-FQILINVPFGYLTSRIFIFPYNLLGKRQTQAV-QTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXED---FKRTEYLSKFRK-EQHESLDEVGFCSAIRFFYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILR---NTVNDSDFIYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQV---DTSYMEGSQCLFGYCATPNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKLNICKNSNNGRLSVDAFIANLIHEEDLE-CSGFEQQCMETY-----LITNQLLD 3480
            P +ES    + W   +H + Q    YG I+  G     G +P   +YVR+  D    + EL  +L T  W  + PKL+I++ GG  N   L    K   ++GL+  +K+   WI TGG  TGV+K VG+A     +  +++T  V  +GI  WG    N E L    E      P +         + L+  H  F+L D+G+  K+G E+  R + E+ +S         +   VV L++EGG NTI+   E +  +  +PVVV  GS RAAD++  V + +SD  +  +   + ++     +K + +  D+ +  +Q        KNL+  +   +         +     LD  I+ A F    K Q L    +L LA+T+NR D+A   IF   V   E  N  L   M  AL  ++  FV   L  G++++ FLT   L +LY  +   A+     L      I KG I      +L  IG +IN+L    +   Y                K+ +S +          Y++Y                 + G    + EM    +P             +L +WA+LT+R +MA + W  G++ +  +LV+  +  ++  +A     + EI      Y +EFE+    +L  +YR+D  +   LL   L  W  +SCL +A        L H   Q  L ++W+G +    N  F++++ +   +     +I   +   K + Q + QT       + L  D S+  Q  +E ++   Y     +  +  K      D   F+    LS++ + +QH+ L           FYTAPITKF  + I+Y+ FL MFS+ +L+++  +      YS        I YI+ L  E  +  +  +      KF+ W  +MWN  D    I+F I    R   NT++    IYC     +    +Y+R +    V + +GP V M+ +M+K++++F+ +  + L ++G    ++LYPN   T  L++ + + PY+ L+G+V   D     G       C T + +  +  + +LL  N+LL++LLIA+F   F +V   S++VW F R+ ++ E+  +P+LPPPF     FY+  K  + + +    +  D  +   + ++DLE    FE++C+E +     +I NQ  D
Sbjct:   51 PGIESGSPGDLWLPTKHTRPQPTDAYGTIEFQG-----GAHPTKAQYVRLSFD---TRPELLVQLFTKEWNLELPKLLITVQGGKANF-DLQAKLKKEIRKGLLKAAKTTGAWIFTGGTNTGVTKQVGDA---LLLEGQQRTGRVVSIGIAPWGIVERNHELLGHNRE-----VPCHSISSPRSKLAVLNNRHAYFLLVDNGTQAKYGAELILRRKLEKFISNLKLHPFTHSSTPVVCLVIEGGTNTIRAVLEYVTDSPPVPVVVCDGSGRAADLLAFVHKYASDGEEQPVLESMRDYLIGTIQKTFEVGLDQSEKLYQELLQCTRNKNLITVFRIQE-------KPEGEAQELDQTILTALF----KSQHLSPPEQLSLALTWNRVDIARSEIF---VYGQEWPNGALDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELYNTKHGPANTLGYILRDVRPHIPKGYI-----YTLHDIGLVINKLMGGAYRSYYTRRKFRPIYA------KVMNSYANACRKSSTYQYQRY---------AGANSLSLVTGLLPFTSEMALFEFPF-----------NELLIWAVLTKRQQMALLMWTHGEEALAKSLVSCKLYKAMAHEAAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDAEKAQRLLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGLRTRKNTNFKVILGLAMPF-----YIRQLDFKSKEELQQMPQTEEEHLENQNLDNDDSDRSQPDAEALLADTYSVRDTKVHENGKVSLTDSDTAQFREFFNLSEYNEVKQHQPLR---LKKKFYEFYTAPITKFWADSIAYMFFLIMFSFTVLVKMEQMPRWQEWYS--------IAYITTLGFEKVREIISSEPVAITHKFSVWAWNMWNPCDGAAIILFVIGLAFRFRENTMDIGRVIYC-----VDSIYWYLRILNILGVNKYLGPLVTMMGKMVKNMIYFVVLLAVVLMSFGVSRQAILYPNKQPTWSLIKEVTFQPYFMLYGEVFAGDIDPPCGEDPSQPGCVTGHWVTPITMSMYLLIANILLINLLIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPPFIALCHFYSLLKYCV-RKAKGLEVQRDNGLKLFLEKDDLERLYDFEEECVEGFFHEQEIILNQSTD 1156          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339074)

HSP 1 Score: 309.301 bits (791), Expect = 5.703e-86
Identity = 317/1190 (26.64%), Postives = 534/1190 (44.87%), Query Frame = 1
Query:   97 PSVESDC-SEFW---RHEKFQ----YGAIQLSGYRVIAGKNP---KYVRVHKDLSNIKGELY-KLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTV--LGIGTWG-ATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSK-------EADCSVVQLIVEGGKNTIQTGAEALKSN--IPVVVMKGSKRAADVICDVVESSSDMFQDTIKLKLEEF-----EKEWNITTDEEKGNFQ--------KNLVIFYECYQIGKVHLFNMKDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNE-ININLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKANAH-----LHTAVNFIFKGTIDSPEKQSLKMIGRLINQLTDNLFPQMYQEANSDSCSCCCWKSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKG-EIEIMNNWMRYQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNI-FQILINVPFGYLTSRIFIFPYNLLGKRQTQAV-QTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXED---FKRTEYLSKFRK-EQHESLDEVGFCSAIRFFYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILR---NTVNDSDFIYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQV---DTSYMEGSQCLFGYCATPNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKLNICKNSNNGRLSVDAFIANLIHEEDLE-CSGFEQQCMETY-----LITNQLLD 3480
            P +ES    + W   +H + Q    YG I+  G     G +P   +YVR+  D    + EL  +L T  W  + PKL+I++ GG  N   L    K   ++GL+  +K+   WI TGG  TGV+K VG+A     +  +++T  V  +GI  WG    N E L    E      P +         + L+  H  F+L D+G+  K+G E+  R + E+ +S         +   VV L++EGG NTI+   E +  +  +PVVV  GS RAAD++  V + +SD  +  +   + ++     +K + +  D+ +  +Q        KNL+  +   +         +     LD  I+ A F    K Q L    +L LA+T+NR D+A   IF   V   E  N  L   M  AL  ++  FV   L  G++++ FLT   L +LY  +   A+     L      I KG I      +L  IG +IN+L    +   Y                K+ +S +          Y++Y                 + G    + EM    +P             +L +WA+LT+R +MA + W  G++ +  +LV+  +  ++  +A     + EI      Y +EFE+    +L  +YR+D  +   LL   L  W  +SCL +A        L H   Q  L ++W+G +    N  F++++ +   +     +I   +   K + Q + QT       + L  D S+  Q  +E ++   Y     +  +  K      D   F+    LS++ + +QH+ L           FYTAPITKF  + I+Y+ FL MFS+ +L+++  +      YS        I YI+ L  E  +  +  +      KF+ W  +MWN  D    I+F I    R   NT++    IYC     +    +Y+R +    V + +GP V M+ +M+K++++F+ +  + L ++G    ++LYPN   T  L++ + + PY+ L+G+V   D     G       C T + +  +  + +LL  N+LL++LLIA+F   F +V   S++VW F R+ ++ E+  +P+LPPPF     FY+  K  + + +    +  D  +   + ++DLE    FE++C+E +     +I NQ  D
Sbjct:   69 PGIESGSPGDLWLPTKHTRPQPTDAYGTIEFQG-----GAHPTKAQYVRLSFD---TRPELLVQLFTKEWNLELPKLLITVQGGKAN-FDLQAKLKKEIRKGLLKAAKTTGAWIFTGGTNTGVTKQVGDA---LLLEGQQRTGRVVSIGIAPWGIVERNHELLGHNRE-----VPCHSISSPRSKLAVLNNRHAYFLLVDNGTQAKYGAELILRRKLEKFISNLKLHPFTHSSTPVVCLVIEGGTNTIRAVLEYVTDSPPVPVVVCDGSGRAADLLAFVHKYASDGEEQPVLESMRDYLIGTIQKTFEVGLDQSEKLYQELLQCTRNKNLITVFRIQE-------KPEGEAQELDQTILTALF----KSQHLSPPEQLSLALTWNRVDIARSEIF---VYGQEWPNGALDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELYNTKHGPANTLGYILRDVRPHIPKGYI-----YTLHDIGLVINKLMGGAYRSYYTRRKFRPIYA------KVMNSYANACRKSSTYQYQRY---------AGANSLSLVTGLLPFTSEMALFEFPF-----------NELLIWAVLTKRQQMALLMWTHGEEALAKSLVSCKLYKAMAHEAAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDAEKAQRLLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGLRTRKNTNFKVILGLAMPF-----YIRQLDFKSKEELQQMPQTEEEHLENQNLDNDDSDRSQPDAEALLADTYSVRDTKVHENGKVSLTDSDTAQFREFFNLSEYNEVKQHQPLR---LKKKFYEFYTAPITKFWADSIAYMFFLIMFSFTVLVKMEQMPRWQEWYS--------IAYITTLGFEKVREIISSEPVAITHKFSVWAWNMWNPCDGAAIILFVIGLAFRFRENTMDIGRVIYC-----VDSIYWYLRILNILGVNKYLGPLVTMMGKMVKNMIYFVVLLAVVLMSFGVSRQAILYPNKQPTWSLIKEVTFQPYFMLYGEVFAGDIDPPCGEDPSQPGCVTGHWVTPITMSMYLLIANILLINLLIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPPFIALCHFYSLLKYCV-RKAKGLEVQRDNGLKLFLEKDDLERLYDFEEECVEGFFHEQEIILNQSTD 1174          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339077)

HSP 1 Score: 308.916 bits (790), Expect = 8.454e-86
Identity = 318/1192 (26.68%), Postives = 533/1192 (44.71%), Query Frame = 1
Query:   97 PSVESDC-SEFW---RHEKFQ----YGAIQLSGYRVIAGKNP---KYVRVHKDLSNIKGELY-KLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFT----VLGIGTWG-ATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSK-------EADCSVVQLIVEGGKNTIQTGAEALKSN--IPVVVMKGSKRAADVICDVVESSSDMFQDTIKLKLEEF-----EKEWNITTDEEKGNFQ--------KNLVIFYECYQIGKVHLFNMKDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNE-ININLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKANAH-----LHTAVNFIFKGTIDSPEKQSLKMIGRLINQLTDNLFPQMYQEANSDSCSCCCWKSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKG-EIEIMNNWMRYQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNI-FQILINVPFGYLTSRIFIFPYNLLGKRQTQAV-QTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXED---FKRTEYLSKFRK-EQHESLDEVGFCSAIRFFYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILR---NTVNDSDFIYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQV---DTSYMEGSQCLFGYCATPNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKLNICKNSNNGRLSVDAFIANLIHEEDLE-CSGFEQQCMETY-----LITNQLLD 3480
            P +ES    + W   +H + Q    YG I+  G     G +P   +YVR+  D    + EL  +L T  W  + PKL+I++ GG  N   L    K   ++GL+  +K+   WI TGG  TGV+K VG+A     +L + Q  T     +GI  WG    N E L    E      P +         + L+  H  F+L D+G+  K+G E+  R + E+ +S         +   VV L++EGG NTI+   E +  +  +PVVV  GS RAAD++  V + +SD  +  +   + ++     +K + +  D+ +  +Q        KNL+  +   +         +     LD  I+ A F    K Q L    +L LA+T+NR D+A   IF   V   E  N  L   M  AL  ++  FV   L  G++++ FLT   L +LY  +   A+     L      I KG I      +L  IG +IN+L    +   Y                K+ +S +          Y++Y                 + G    + EM    +P             +L +WA+LT+R +MA + W  G++ +  +LV+  +  ++  +A     + EI      Y +EFE+    +L  +YR+D  +   LL   L  W  +SCL +A        L H   Q  L ++W+G +    N  F++++ +   +     +I   +   K + Q + QT       + L  D S+  Q  +E ++   Y     +  +  K      D   F+    LS++ + +QH+ L           FYTAPITKF  + I+Y+ FL MFS+ +L+++  +      YS        I YI+ L  E  +  +  +      KF+ W  +MWN  D    I+F I    R   NT++    IYC     +    +Y+R +    V + +GP V M+ +M+K++++F+ +  + L ++G    ++LYPN   T  L++ + + PY+ L+G+V   D     G       C T + +  +  + +LL  N+LL++LLIA+F   F +V   S++VW F R+ ++ E+  +P+LPPPF     FY+  K  + + +    +  D  +   + ++DLE    FE++C+E +     +I NQ  D
Sbjct:  153 PGIESGSPGDLWLPTKHTRPQPTDAYGTIEFQG-----GAHPTKAQYVRLSFD---TRPELLVQLFTKEWNLELPKLLITVQGGKANF-DLQAKLKKEIRKGLLKAAKTTGAWIFTGGTNTGVTKQVGDA-----LLLEGQQRTGRVVSIGIAPWGIVERNHELLGHNRE-----VPCHSISSPRSKLAVLNNRHAYFLLVDNGTQAKYGAELILRRKLEKFISNLKLHPFTHSSTPVVCLVIEGGTNTIRAVLEYVTDSPPVPVVVCDGSGRAADLLAFVHKYASDGEEQPVLESMRDYLIGTIQKTFEVGLDQSEKLYQELLQCTRNKNLITVFRIQE-------KPEGEAQELDQTILTALF----KSQHLSPPEQLSLALTWNRVDIARSEIF---VYGQEWPNGALDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELYNTKHGPANTLGYILRDVRPHIPKGYI-----YTLHDIGLVINKLMGGAYRSYYTRRKFRPIYA------KVMNSYANACRKSSTYQYQRY---------AGANSLSLVTGLLPFTSEMALFEFPF-----------NELLIWAVLTKRQQMALLMWTHGEEALAKSLVSCKLYKAMAHEAAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDAEKAQRLLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGLRTRKNTNFKVILGLAMPF-----YIRQLDFKSKEELQQMPQTEEEHLENQNLDNDDSDRSQPDAEALLADTYSVRDTKVHENGKVSLTDSDTAQFREFFNLSEYNEVKQHQPLR---LKKKFYEFYTAPITKFWADSIAYMFFLIMFSFTVLVKMEQMPRWQEWYS--------IAYITTLGFEKVREIISSEPVAITHKFSVWAWNMWNPCDGAAIILFVIGLAFRFRENTMDIGRVIYC-----VDSIYWYLRILNILGVNKYLGPLVTMMGKMVKNMIYFVVLLAVVLMSFGVSRQAILYPNKQPTWSLIKEVTFQPYFMLYGEVFAGDIDPPCGEDPSQPGCVTGHWVTPITMSMYLLIANILLINLLIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPPFIALCHFYSLLKYCV-RKAKGLEVQRDNGLKLFLEKDDLERLYDFEEECVEGFFHEQEIILNQSTD 1258          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Zebrafish
Match: trpm1b (transient receptor potential cation channel, subfamily M, member 1b [Source:ZFIN;Acc:ZDB-GENE-070424-31])

HSP 1 Score: 294.278 bits (752), Expect = 4.530e-81
Identity = 324/1210 (26.78%), Postives = 528/1210 (43.64%), Query Frame = 1
Query:  202 YVRVHKDLSNIKGELYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKEA-------DCSVVQLIVEGGKNTIQTGAEALKSN--IPVVVMKGSKRAADVICDVVESSSDMFQDTIKLKLEEFEKEWNITTDEEKGNFQKN-----LVIFYECYQIGK-VHLFNM-KDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIF-----------------------------------------------------ENQVRKNEININLRPFMETAL----IRNQWQFVDFFLRQGLTVESFLTNSMLRDLY-FKEKANAHLHTAVNFIFKGTIDSPEKQSLKMIGRLINQLTDNLFPQMYQEANSDSC--SCCCWKSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMR----YQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKI-----PNFVNIFQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXEDFKRTEYLSKFRKEQHESLDEVGFCSAIRFFYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFMG--GQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDFIYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQV-----DTSYME-------------GSQ---CLFGYCATPNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKLNICKNSNN--GRLS-VDAFIANLIHEEDLE-CSGFEQQCMETYLITNQLLDLSAHD 3495
            Y+RV  D       L  LM   W  + P L+IS++GG +N   L    K  F +GLI  + +   WI TGG  TGV + VG+A KD+S  S+ +   + GI  WG   NKE L  +     +  P           + L+  H  FIL D+G+  K+G E+K R + E+ +S +           VV LIVEGG N I    E+L+    +PVVV  GS RA+D+I     S +  + +   L + E  KE  + T ++  N+ K      L++  EC +  + + +F M  + +++++ AI+ A   GT    P     +L LA+ +NR D+A  +IF                                                     E   RK E+ +N    +E A+    + ++  FV   +  G+ +  FLT   L +LY  K      LH  V  + KG +    + +L  IG ++  L    +   Y   N  +   +    K PK        D            EP +           +    +    E+    YP             +L +WA+L +R +MA   W+ G++ +  ALVA   C  L+  A    + E++++  +      +EF TLA  +L ++Y+ D+     LL   L  W   +CL +A   +  +F+ H+  Q  L ++W+G +     P    I   LI  PF      I +  +  LG   +  V   + +  T+   +   +    ++ K                      +ED  +     K R+        +   + I  FY AP TKF  N ISYL +L +++Y +L+++         +    E+ +  + I+  L ++ Q  M   G++K    K N W    WN  DL    VF +  +LR   N+    Y R ++ + +  +YIR ++ + V + +GP V+MI +M+ D+L+F+ I L+ L ++G    ++L+P+   T  L RNIFY PYW ++G+V     D   ME             G +   C+ G   TP AI+    A +LL  N+LL++LLIA+F  TF +V+  SN+VW F RY++I  F+ RP+LPPP  +    Y  F+   C+ S    G L   D  +  ++  ++L+    FE+QC+E Y    +   LS++D
Sbjct:    2 YIRVSHDTK--PDSLLHLMVKEWQLELPTLLISVHGGLQN-FDLQPKLKQVFGKGLIKAAVTTGAWIFTGGVSTGVIRHVGDALKDHSSKSRGKVCAI-GIAPWGILENKEDLIGKD----VNKPYQAISNPLSKLAVLNNSHSHFILSDNGTCGKYGAEVKLRRQLEKHISLQKINTRLGQGVPVVCLIVEGGPNVISIALESLREEPPVPVVVCDGSGRASDII-----SFAHKYSEVEGL-VNEDAKEQLLVTIQKTFNYNKMQSGQILLMVLECMKKRELITVFRMGAEGQDDIEMAILTALLKGTNASAP----DQLSLALAWNRVDIARNQIFVYGHNLPPASALASAITISAPSQEKQKGATQRNKGKARGKKGKGGKAKPEQPEETDPRKLEL-LNWVNSLEQAMMDALVLDRTDFVKLLIENGVNIHHFLTIPRLEELYNTKLGPGNTLHILVRDVKKGNLPPDYQITLIDIGLVVEYLMGGAYRCNYTRKNFRALYNNLYGLKRPKALKLLGMEDD-----------EPRSKGKKKQKKKKEEEEDIDVDDPEVSRFHYPF-----------HELMVWAVLMKRQKMALFLWQRGEEGMAKALVA---CKLLKGMAHESSQSEMVDDISQDLDNNSKEFGTLAYELLDQSYKHDEQLAMKLLTYELKNWSNSTCLKLAVAAKHRDFIAHTCSQMLLTDMWMGSLRMGKNPGLKVILS-LIFPPF------ILLLDFR-LGDDTSHQVAVADEDKKTKDDERSTRDANADAASK-------------------KGDEEDGNK-----KMRR--------IPIGTKIFEFYNAPFTKFWFNTISYLGYLMLYNYVVLVKMER-------WPSLQEWIVISYIITLGLEKVRQILMSEPGKLKQ---KINVWLEEYWNITDLVAISVFLLGLLLRLQ-NEPYMGYGRVIYCVDIIFWYIRVLDIFGVNKYLGPYVMMIGKMMIDMLYFVVIMLVVLMSFGVARQAILHPDEEPTWRLARNIFYMPYWMIYGEVFADSIDLYAMEINPPCGENLYDEDGKKLPPCIPGAWLTP-AIM----ACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHDRPVLPPPLIILSHLYILFRKLCCRCSKKKEGELDEKDKGLKLILTPDELKMLYEFEEQCVEEYFREKEDEQLSSND 1111          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Zebrafish
Match: trpm5 (transient receptor potential cation channel, subfamily M, member 5 [Source:ZFIN;Acc:ZDB-GENE-060503-736])

HSP 1 Score: 289.656 bits (740), Expect = 1.543e-80
Identity = 285/1125 (25.33%), Postives = 489/1125 (43.47%), Query Frame = 1
Query:  103 VESDCSEFWRHEKFQYGAIQLSGYRVIAGKNPKYVRVHKDLSNIKGELYKLMTNVWGFKKPKLIISLNGG--AKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSIL--SKKQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKEA---------DCSVVQLIVEGGKNTIQTGAEALKSNIPVVVMKGSKRAADVICDVVESS---SDMFQDTIKLKLEEFEKEWNITTDEEKGNFQKNLVIFYECYQ--IGKVHLFNMKDFKNN--LDT----AIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEININLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKANAHLHTAVNFIFKGTIDSPEKQSLKMIGRLINQLTDNLFPQMYQEANSDSCSCCCWKSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMRYQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNIFQILIN--VPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXEDFKRTEYLSKFRKEQHESLDEVGFCSAIRFFYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDFIYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQVDTSYMEGSQCLFGYCAT-----------------PNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPF----NVFEVFYNFFK 3336
            VE     F +    + G I  +G     GK   +VRV    S    E+Y+++T  WG   P L+++L GG     + P   D     ++GL+  ++S   WI+T G   G++K +G+A +D+S+   S K     +GI  W    N++ L     D   TYP  D    G   S LD  H  FIL D+   R  G   + R +  + +S +          +  V+ L+V G    +Q   + ++++IP +++ GS   AD++  +++     +D+ Q+   L +  F            G     +  + +  Q  +   HL  + D + +  LDT    A+++A  S + + Q   DE K  LA+ +NR D+A+  IF   V+ +    +L   M  AL+ ++  FV  F+  G+ ++ FLT   L++LY        LHT +  + K      +    +M G   N+L D  F   + E            S  + D   F D +C+   Y+                  K+  +      + ++   + + +++  +  +DLFLWA+L  R EMA  FW  G + + +ALV   +   +   A        M N      ++E  A+++ SE Y   + R + LL+R    W + + L+IA   +   F  H   Q  L  +W G +    +I ++++   +P    TS I   P         + V  +  EP  EL S +       + + ++  +      +             F R   L ++ +                 F++AP+T F+ N+I Y AFL +FSY LL++       P       E  +Y +  + +L EI Q F   +  + + K   +    WN  D+    +F +    R  +  S +   RT+ ++   +F +R +  + + + +GPK+I++ RM+KD+ FFL    + L AYG  + +LL+PN      + R   Y PY  +FGQ+    ++ ++     C T                  N +V +    +LL TNVLLL+LLIAMF  TF  V+EN++  W F RY +I E++ RP L PPF    ++ +   +F K
Sbjct:    2 VEKSSERFDKQMAGRLGDIDFTGVSRTRGK---FVRVTS--STDPAEIYQILTKQWGLAPPHLVVALMGGDEVAQLKPWLRD---TLRKGLVKAAQSTGAWILTSGLRFGITKNLGQAVRDHSLASTSPKVRVVAIGIAPWNMIQNRDLLLSAKPDHPATYPTED-LPYGAVYS-LDCNHSHFILVDEDPKRP-GATGEMRVKMLKHISLQRTGYGGTGSIEIPVLCLLVHGEPRILQKMYKNIQNSIPWLILAGSGGVADILVTLMDRGCWDADIVQE---LLINTF----------PDGLHSTEITSWTKLIQRILDHGHLLTVHDPEQDSELDTVILKALVKACKSQSQEAQDFLDELK--LAVAWNRVDIAKSEIFSGDVQWSA--QDLEEVMMEALVNDKPDFVRLFVDNGVNIKQFLTYGRLQELYCSVSEKNLLHTLL--LKKNQERQAQLARKRMSGNPNNELGDRKFRFTFHEV-----------SKVLKD---FLDDTCKGF-YQ------------------KLPAERMGKGRLFHSQKNLPDMDRRCEHPWRDLFLWAILQNRQEMANYFWAMGPEAVAAALVGCKIMKEMAHLATEAESARSMKN-----AKYEQFAMDLFSECYSNSEDRAYSLLVRKTCCWSKATVLNIATLAEAKCFFAHDGVQALLTKVWWGAMRTDTSISRLVLTFFIPPLVWTSLIKFNP--------EEQVSKDEGEPFAELDSLE-------TEQALLLTDGDPVAGEGSAETAARSCSATFIRV-VLRRWNR-----------------FWSAPVTVFMGNVIMYFAFLILFSYVLLLDFRP---PPPYGPSAAEIILYFWVFTLVLEEIRQSFFTDEDMSILKKMKLYVEDNWNKCDMVAISLFVVGLSCRMAM--STYEAGRTVLALDFMVFTLRLIHIFAIHKQLGPKIIIVERMIKDVFFFLFFLSVWLIAYGVTTQALLHPNDPRIDWVFRRALYRPYLHIFGQIPLEEIDAAKMPDDNCTTDVQEIILGTLPPCPNIYANWLVILLLVIYLLVTNVLLLNLLIAMFSYTFQVVQENADIFWKFQRYNLIVEYHSRPALAPPFIIISHITQALLSFIK 1020          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Zebrafish
Match: trpm5 (transient receptor potential cation channel, subfamily M, member 5 [Source:ZFIN;Acc:ZDB-GENE-060503-736])

HSP 1 Score: 289.656 bits (740), Expect = 2.078e-80
Identity = 284/1123 (25.29%), Postives = 488/1123 (43.46%), Query Frame = 1
Query:  103 VESDCSEFWRHEKFQYGAIQLSGYRVIAGKNPKYVRVHKDLSNIKGELYKLMTNVWGFKKPKLIISLNGG--AKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSIL--SKKQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKEA---------DCSVVQLIVEGGKNTIQTGAEALKSNIPVVVMKGSKRAADVICDVVESS---SDMFQDTIKLKLEEFEKEWNITTDEEKGNFQKNLVIFYECYQIGKVHLFNMKDFKNN--LDT----AIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEININLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKANAHLHTAVNFIFKGTIDSPEKQSLKMIGRLINQLTDNLFPQMYQEANSDSCSCCCWKSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMRYQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNIFQILIN--VPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXEDFKRTEYLSKFRKEQHESLDEVGFCSAIRFFYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDFIYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQVDTSYMEGSQCLFGYCAT-----------------PNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPF----NVFEVFYNFFK 3336
            VE     F +    + G I  +G     GK   +VRV    S    E+Y+++T  WG   P L+++L GG     + P   D     ++GL+  ++S   WI+T G   G++K +G+A +D+S+   S K     +GI  W    N++ L     D   TYP  D    G   S LD  H  FIL D+   R  G   + R +  + +S +          +  V+ L+V G    +Q   + ++++IP +++ GS   AD++  +++     +D+ Q+   L +  F    + T         + +        +   HL  + D + +  LDT    A+++A  S + + Q   DE K  LA+ +NR D+A+  IF   V+ +    +L   M  AL+ ++  FV  F+  G+ ++ FLT   L++LY        LHT +  + K      +    +M G   N+L D  F   + E            S  + D   F D +C+   Y+                  K+  +      + ++   + + +++  +  +DLFLWA+L  R EMA  FW  G + + +ALV   +   +   A        M N      ++E  A+++ SE Y   + R + LL+R    W + + L+IA   +   F  H   Q  L  +W G +    +I ++++   +P    TS I   P         + V  +  EP  EL S +       + + ++  +      +             F R   L ++ +                 F++AP+T F+ N+I Y AFL +FSY LL++       P       E  +Y +  + +L EI Q F   +  + + K   +    WN  D+    +F +    R  +  S +   RT+ ++   +F +R +  + + + +GPK+I++ RM+KD+ FFL    + L AYG  + +LL+PN      + R   Y PY  +FGQ+    ++ ++     C T                  N +V +    +LL TNVLLL+LLIAMF  TF  V+EN++  W F RY +I E++ RP L PPF    ++ +   +F K
Sbjct:   51 VEKSSERFDKQMAGRLGDIDFTGVSRTRGK---FVRVTS--STDPAEIYQILTKQWGLAPPHLVVALMGGDEVAQLKPWLRD---TLRKGLVKAAQSTGAWILTSGLRFGITKNLGQAVRDHSLASTSPKVRVVAIGIAPWNMIQNRDLLLSAKPDHPATYPTED-LPYGAVYS-LDCNHSHFILVDEDPKRP-GATGEMRVKMLKHISLQRTGYGGTGSIEIPVLCLLVHGEPRILQKMYKNIQNSIPWLILAGSGGVADILVTLMDRGCWDADIVQE---LLINTFPDGLHSTEITSWTKLIQRI--------LDHGHLLTVHDPEQDSELDTVILKALVKACKSQSQEAQDFLDELK--LAVAWNRVDIAKSEIFSGDVQWSA--QDLEEVMMEALVNDKPDFVRLFVDNGVNIKQFLTYGRLQELYCSVSEKNLLHTLL--LKKNQERQAQLARKRMSGNPNNELGDRKFRFTFHEV-----------SKVLKD---FLDDTCKGF-YQ------------------KLPAERMGKGRLFHSQKNLPDMDRRCEHPWRDLFLWAILQNRQEMANYFWAMGPEAVAAALVGCKIMKEMAHLATEAESARSMKN-----AKYEQFAMDLFSECYSNSEDRAYSLLVRKTCCWSKATVLNIATLAEAKCFFAHDGVQALLTKVWWGAMRTDTSISRLVLTFFIPPLVWTSLIKFNP--------EEQVSKDEGEPFAELDSLE-------TEQALLLTDGDPVAGEGSAETAARSCSATFIRV-VLRRWNR-----------------FWSAPVTVFMGNVIMYFAFLILFSYVLLLDFRP---PPPYGPSAAEIILYFWVFTLVLEEIRQSFFTDEDMSILKKMKLYVEDNWNKCDMVAISLFVVGLSCRMAM--STYEAGRTVLALDFMVFTLRLIHIFAIHKQLGPKIIIVERMIKDVFFFLFFLSVWLIAYGVTTQALLHPNDPRIDWVFRRALYRPYLHIFGQIPLEEIDAAKMPDDNCTTDVQEIILGTLPPCPNIYANWLVILLLVIYLLVTNVLLLNLLIAMFSYTFQVVQENADIFWKFQRYNLIVEYHSRPALAPPFIIISHITQALLSFIK 1069          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Zebrafish
Match: trpm5 (transient receptor potential cation channel, subfamily M, member 5 [Source:ZFIN;Acc:ZDB-GENE-060503-736])

HSP 1 Score: 288.886 bits (738), Expect = 2.304e-80
Identity = 289/1125 (25.69%), Postives = 488/1125 (43.38%), Query Frame = 1
Query:  103 VESDCSEFWRHEKFQYGAIQLSGYRVIAGKNPKYVRVHKDLSNIKGELYKLMTNVWGFKKPKLIISLNGG--AKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSIL--SKKQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKEA---------DCSVVQLIVEGGKNTIQTGAEALKSNIPVVVMKGSKRAADVICDVVESS---SDMFQDTIKLKLEEFEKEWNITTDEEKGNFQKNLVIFYECYQ--IGKVHLFNMKDFKNN--LDT----AIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEININLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKANAHLHTAVNFIFKGTIDSPEKQSLKMIGRLINQLTDNLFPQMYQEANSDSCSCCCWKSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMRYQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNIFQILIN--VPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXEDFKRTEYLSKFRKEQHESLDEVGFCSAIRFFYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDFIYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQVDTSYMEGSQCLFGYCAT-----------------PNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPF----NVFEVFYNFFK 3336
            VE     F +    + G I  +G     GK   +VRV    S    E+Y+++T  WG   P L+++L GG     + P   D     ++GL+  ++S   WI+T G   G++K +G+A +D+S+   S K     +GI  W    N++ L     D   TYP  D    G   S LD  H  FIL D+   R  G   + R +  + +S +          +  V+ L+V G    +Q   + ++++IP +++ GS   AD++  +++     +D+ Q+   L +  F            G     +  + +  Q  +   HL  + D + +  LDT    A+++A  S + + Q   DE K  LA+ +NR D+A+  IF   V+ +    +L   M  AL+ ++  FV  F+  G+ ++ FLT   L++LY        LHT +  + K      +    +M G   N+L D  F   + E            S  + D   F D +C+   Y+K        P                SK +     P  + +++  +  +DLFLWA+L  R EMA  FW  G + + +ALV   +   +   A        M N      ++E  A+++ SE Y   + R + LL+R    W + + L+IA   +   F  H   Q  L  +W G +    +I ++++   +P    TS I   P         + V  +  EP  EL S +       + + ++  +      +             F R   L ++ +                 F++AP+T F+ N+I Y AFL +FSY LL++       P       E  +Y +  + +L EI Q F   +  + + K   +    WN  D+    +F +    R  +  S +   RT+ ++   +F +R +  + + + +GPK+I++ RM+KD+ FFL    + L AYG  + +LL+PN      + R   Y PY  +FGQ+    ++ ++     C T                  N +V +    +LL TNVLLL+LLIAMF  TF  V+EN++  W F RY +I E++ RP L PPF    ++ +   +F K
Sbjct:    2 VEKSSERFDKQMAGRLGDIDFTGVSRTRGK---FVRVTS--STDPAEIYQILTKQWGLAPPHLVVALMGGDEVAQLKPWLRD---TLRKGLVKAAQSTGAWILTSGLRFGITKNLGQAVRDHSLASTSPKVRVVAIGIAPWNMIQNRDLLLSAKPDHPATYPTED-LPYGAVYS-LDCNHSHFILVDEDPKRP-GATGEMRVKMLKHISLQRTGYGGTGSIEIPVLCLLVHGEPRILQKMYKNIQNSIPWLILAGSGGVADILVTLMDRGCWDADIVQE---LLINTF----------PDGLHSTEITSWTKLIQRILDHGHLLTVHDPEQDSELDTVILKALVKACKSQSQEAQDFLDELK--LAVAWNRVDIAKSEIFSGDVQWSA--QDLEEVMMEALVNDKPDFVRLFVDNGVNIKQFLTYGRLQELYCSVSEKNLLHTLL--LKKNQERQAQLARKRMSGNPNNELGDRKFRFTFHEV-----------SKVLKD---FLDDTCKGF-YQKL-------PAV--------------SKALHQKNLP--DMDRRCEHPWRDLFLWAILQNRQEMANYFWAMGPEAVAAALVGCKIMKEMAHLATEAESARSMKN-----AKYEQFAMDLFSECYSNSEDRAYSLLVRKTCCWSKATVLNIATLAEAKCFFAHDGVQALLTKVWWGAMRTDTSISRLVLTFFIPPLVWTSLIKFNP--------EEQVSKDEGEPFAELDSLE-------TEQALLLTDGDPVAGEGSAETAARSCSATFIRV-VLRRWNR-----------------FWSAPVTVFMGNVIMYFAFLILFSYVLLLDFRP---PPPYGPSAAEIILYFWVFTLVLEEIRQSFFTDEDMSILKKMKLYVEDNWNKCDMVAISLFVVGLSCRMAM--STYEAGRTVLALDFMVFTLRLIHIFAIHKQLGPKIIIVERMIKDVFFFLFFLSVWLIAYGVTTQALLHPNDPRIDWVFRRALYRPYLHIFGQIPLEEIDAAKMPDDNCTTDVQEIILGTLPPCPNIYANWLVILLLVIYLLVTNVLLLNLLIAMFSYTFQVVQENADIFWKFQRYNLIVEYHSRPALAPPFIIISHITQALLSFIK 1015          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Zebrafish
Match: trpm1a (transient receptor potential cation channel, subfamily M, member 1a [Source:ZFIN;Acc:ZDB-GENE-070112-1372])

HSP 1 Score: 276.559 bits (706), Expect = 1.866e-75
Identity = 311/1211 (25.68%), Postives = 519/1211 (42.86%), Query Frame = 1
Query:  148 YGAIQLSGYRVIAGKNPKYVRVHKDLSNIKGELYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKEA-------DCSVVQLIVEGGKNTIQTGAEALKSN--IPVVVMKGSKRAADVICDVVESSSD--MFQDTIKLKLEEFEKEWNITTDEEKGNFQKN-----LVIFYECYQIGKVHLFNM----KDFKNNLDTAIIEAAFSGT---IKDQ-------------------------PLG----------DEAKLWLAMTFNRADVAEQRIF-----------ENQVRK----NEININLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKANAH-LHTAVNFIFKGTIDSPEKQSLKMIGRLINQLTDNLFPQMYQEANSDSC--SCCCWKSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEI--EIMNNWMRYQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIP-NFVNIFQILINVPFGYLTSRIFIFPYN--LLGKRQTQAVQTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXEDFKRTEYLSKFRKEQHESLDEVGFCSAIRFFYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFMG--GQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDFIYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQV-----DTSYME-------------GSQ---CLFGYCATPNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKLNICKNSNNGRLSVD----AFIANLIHEEDLECSGFEQQCMETY 3456
            YG I+  G   I      Y+RV  D       L  LM   W  + P L+IS++GG +N   L    K  F +GLI  + +   WI TGG  TGV + VG+A KD+S  S+ +   + GI  WG   NKE L  +     +T P           S L+  H  FIL D+G+  K+G E++ R + E+ +S +           +V LI+EGG N I    E+L+ +  +PVVV  GS RA+D+I    + S    +  D+++ +L        + T ++  N+ +N      ++  EC +  K  L  +     + + +++ AI+ A   GT     DQ                         P G          D+ K  +A   ++   A  +             E   RK    N +N +L   M  AL+ ++  FV   +  G+ +  FLT   L +LY       + LH  V  + KG +    + +L  IG ++  L    +   Y   +  +   +    K PK        D                 +          I+ D+      +Y  +              +L +WA+L +R +MA   W+ G++ +  ALVA  +  ++  ++ ++ E+  +I  +     ++F  LA  +L ++Y+ D+     LL   L  W   +CL +A   +  +F+ H+  Q  L ++W+G +     N  ++++ +          IFP    LL  R    +   NS+   E+  KD      K           + T+      KK   ++  K+ + L   +K              I +F+ AP TKF  N  +YL +L +++Y +L+++         +    E+ +  + I+  L ++ Q  M   G++K    K N W    WN  DL     F +  +LR   N+    Y R ++ + +  +YIR ++ + V + +GP V+MI +M+ D+L+F+ I L+ L ++G    ++L+P+   T  L RNIFY PYW ++G+V     D   ME             G +   C+ G   TP AI+    A +LL  N+LL++LLIA+F  TF +V+  SN++W F RY++I  F+ RP+LPPP  +F   Y   K   C+        +D         L  EE      FE+Q +E Y
Sbjct:    6 YGIIEFQGGGHI--NKAMYIRVSYDTK--PDNLLHLMVKDWQLELPTLLISVHGGLQN-FDLQPKLKQVFGKGLIKAAVTTGAWIFTGGVSTGVIRHVGDALKDHSSKSRGKVCAI-GIAPWGIVENKEDLIGRD----VTRPYQTMSNPLSKLSVLNNSHSHFILADNGTHGKYGAEVRLRRQLEKHISLQKINTRLGQGVPLVCLILEGGPNVISIVLESLREDPPVPVVVCDGSGRASDIISFAHKYSEQDGLVNDSVRDQL--------LVTIQKTFNYNRNQAQQIYLMVMECMK--KRELITVFRTASEGQQDIEMAILTALLKGTNASAPDQLSLALAWNRVDIARSQIFVHGQHWPPAGSLPTSSTGQQDKPKSPIATRVSKGKPARGKKGKGAKSKPEPPEETDPRKLELLNWVN-SLEQAMMDALVLDRVDFVKLLIENGVNIHHFLTIPRLEELYNTRLGPINTLHFVVRDVKKGNLPPDYQITLIDIGLVLEYLMGGAYRCNYTRKSFRTLYNNLYGLKRPKALKLLGMEDDDPRPK--------GKKKMKKKKEEEIDIDVDDPEVSRFQYPFH--------------ELMVWAVLMKRQKMALFLWQRGEEAMAKALVACKLYKAMAHES-SRSELVDDISQDLDNNSKDFGQLAYELLDQSYKHDEHMAMKLLTYELKNWSNSTCLKLAVAAKHRDFIAHTCSQMLLTDMWMGCLRVGKSNGLKVILGI----------IFPPAILLLDFRTGDDLSYQNSKDKEEVKDKDDDTKSTK-----------DGTVSMDATSKKGDEEDGKKKQKRLPVGKK--------------IYYFFNAPYTKFWFNTTAYLVYLMLYNYIILVKMER-------WPSLQEWIVISYIITLGLEKVRQILMSEPGKLKQ---KINVWLEEYWNITDLAAITTFLMGLLLR-LQNEPYMGYGRVIYCVDIIFWYIRVLDIFGVNKYLGPYVMMIGKMMIDMLYFVVIMLVVLMSFGVARQAILHPDEEPTWRLARNIFYMPYWMIYGEVFADSIDLYAMEINPPCGENMYDEDGKKLPPCIPGAWLTP-AIM----ACYLLVANILLVNLLIAVFNNTFFEVKSISNQIWKFQRYQLIMTFHDRPVLPPPLIIFSHIYIVLKRLCCRCRKKQEGELDDRDHGLKLTLSAEELKSLYEFEEQNVEEY 1121          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Xenopus
Match: aldh3a2 (aldehyde dehydrogenase 3 family member A2 [Source:Xenbase;Acc:XB-GENE-942662])

HSP 1 Score: 329.717 bits (844), Expect = 1.838e-93
Identity = 305/1144 (26.66%), Postives = 534/1144 (46.68%), Query Frame = 1
Query:  148 YGAIQLSGYRVIAGKNPKYVRVHKDLSNIKGELYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKEA-------DCSVVQLIVEGGKNTIQTGAEALKSN--IPVVVMKGSKRAADVICDVVESSSD--MFQDTIKLK-LEEFEKEWNITTDEEKGNFQKNLVIFYECYQIGK-VHLFNM-KDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEINI-NLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKANA----HLHTAVNFI---FKGTIDSPEKQSLKMIGRLINQLTDNLFPQMYQEANSDSCSCCCW--KSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMRY-QEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNIFQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXEDFKRTEYLSKFRKEQHESLDEVGFCSAIRFFYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDF-IYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQV-----------DTSYMEGSQCLFGYCATPNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKLNICKNSNNGRLSVDAFIANL---IHEEDL-ECSGFEQQCMETY 3456
            +G I+  G     G + K + V          L  LMT  W  + PKL+IS++GG +N   L    K  F +GLI  + +   WI TGG  TGV + VG++ KD++  S+ +  T+ GI  WG   N+E L  +     +  P           + L+  H  FIL D+G+  K+G E+K R + E+ +S +           VV LIVEGG N I    E L+ N  +PVVV  GS RA+D++    + S +  +  ++++ + L   +K +  T  + +  F    +I  EC +  + + +F M  +   ++D AI+ A   G     P     +L LA+ +NR D+A  +IF   +   +  + +L   M  AL+ ++  FV   +  G+++  FLT S L +LY      +    HL   V  +    +G +    + SL  IG +I  L    +   Y      +     +  K PK          + +++  E  I P+ +   T      +I+ D +   E+ +  +P             +L +WA+L +R +MA  FW+ G++ +  ALVA  +C ++  +A     ++ ++  + +   EF  LA+ +L ++Y++D+     LL   L  W   +CL +A   +  +F+ H+  Q  L ++W+G++    N     + V  G L       P ++L        +        E+   D  E   +  +K ++   +++ ++   +  +       K+ E       ++H     +     I  FY API KF    ++Y+ +L +F+Y +L++++            ++  I I YI  L  E  +  +  +    + KF  W    WN  DL   ++F+I  +LR  + +  F  Y R ++ +++  +YIR ++ + V + +GP V+MI +M+ D+++F+ I L+ L ++G    ++L+P+   +  L +NIFY PYW ++G+V           + +  +G       C T   IV    A +LL  N+LL++LLIA+F  TF +V+  SN+VW F RY++I  F+ RP+LPPP  +F  F    K ++C       L  D     L   I E+DL +   FE+QC+E Y
Sbjct:  109 FGTIEFQG----GGHSNKAMYVRLSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQN-FELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDSLKDHASKSRGKICTI-GIAPWGIVENQEDLVGKD----VVRPYQTMSNPMSKLTVLNSMHSHFILADNGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDNPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLF----IILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASAP----DQLSLALAWNRVDIARSQIF---IYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKVRVRHQGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPK----------ALKLLGMEDDI-PIRSGRKTTKKREEEIDIDLDDP-EINHFPFPF-----------HELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSREFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSS---LKVILGIL------LPPSILSLEFKNKDEMPYMSQANEM---DLQEKEVEEPDKTVKEKEEDD-MELTAMLARGNGDSSRKKDE-------DEHPRHRLIPIGRKIYEFYNAPIVKFWFFTMAYMGYLMLFNYIVLVKMDRWP--------SMQEWIVISYIFTLGIEKMREILMSEPGKLLQKFKVWLQEYWNLADLVSILLFSIGMVLR--LQEQPFSSYGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPSEEPSWNLAKNIFYMPYWMIYGEVFADQIDPPCGYNVTGEDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHFTMICK-HLCCRWRKRELDQDERDYGLKLFITEDDLKKVHDFEEQCIEEY 1177          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Xenopus
Match: aldh3a2 (aldehyde dehydrogenase 3 family member A2 [Source:Xenbase;Acc:XB-GENE-942662])

HSP 1 Score: 328.176 bits (840), Expect = 5.492e-92
Identity = 309/1149 (26.89%), Postives = 537/1149 (46.74%), Query Frame = 1
Query:  148 YGAIQLSGYRVIAGKNPKYVRVHKDLSNIKGELYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKEA-------DCSVVQLIVEGGKNTIQTGAEALKSN--IPVVVMKGSKRAADVICDVVESSSD--MFQDTIKLK-LEEFEKEWNITTDEEKGNFQKNLVIFYECYQIGK-VHLFNM-KDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIF--ENQVRKNEININLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKANAH-LHTAVNFIFKGTIDSPEKQSLKMIGRLINQLTDNLFPQMYQEANSDSCSCCCW--KSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMRY-QEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVN-IFQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXEDFKRTEYLSKFRKEQHESLDE--------VGFCSAIRFFYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLG-EIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDF-IYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQV-----------DTSYMEGSQCLFGYCATPNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKLNICKNSNNGRLSVDAFIANL---IHEEDL-ECSGFEQQCMETY 3456
            +G I+  G     G + K + V          L  LMT  W  + PKL+IS++GG +N   L    K  F +GLI  + +   WI TGG  TGV + VG++ KD++  S+ +  T+ GI  WG   N+E L  +     +  P           + L+  H  FIL D+G+  K+G E+K R + E+ +S +           VV LIVEGG N I    E L+ N  +PVVV  GS RA+D++    + S +  +  ++++ + L   +K +  T  + +  F    +I  EC +  + + +F M  +   ++D AI+ A   G     P     +L LA+ +NR D+A  +IF    Q   +    +L   M  AL+ ++  FV   +  G+++  FLT S L +LY      ++ L+  V  + KG +    + SL  IG +I  L    +   Y      +     +  K PK          + +++  E  I P+ +   T      +I+ D +   E+ +  +P             +L +WA+L +R +MA  FW+ G++ +  ALVA  +C ++  +A     ++ ++  + +   EF  LA+ +L ++Y++D+     LL   L  W   +CL +A   +  +F+ H+  Q  L ++W+G++    N   ++++ +          + P ++L                 E  +KD   +  +++E  +Q                 K  E+  +T  L++   +     DE        +     I  FY API KF    ++Y+ +L +F+Y +L++++            ++  I I YI F LG E  +  +  +    + KF  W    WN  DL   ++F+I  +LR  + +  F  Y R ++ +++  +YIR ++ + V + +GP V+MI +M+ D+++F+ I L+ L ++G    ++L+P+   +  L +NIFY PYW ++G+V           + +  +G       C T   IV    A +LL  N+LL++LLIA+F  TF +V+  SN+VW F RY++I  F+ RP+LPPP  +F  F    K ++C       L  D     L   I E+DL +   FE+QC+E Y
Sbjct:  109 FGTIEFQG----GGHSNKAMYVRLSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQN-FELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDSLKDHASKSRGKICTI-GIAPWGIVENQEDLVGKD----VVRPYQTMSNPMSKLTVLNSMHSHFILADNGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDNPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLF----IILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASAP----DQLSLALAWNRVDIARSQIFIYGQQWPFSGRVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPK----------ALKLLGMEDDI-PIRSGRKTTKKREEEIDIDLDDP-EINHFPFPF-----------HELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSREFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSSLKVILGI----------LLPPSIL---------------SLEFKNKDEMPYMSQANEMDLQ----------------EKEVEEPDKTAMLARGNGDSSRKKDEDEHPRHRLIPIGRKIYEFYNAPIVKFWFFTMAYMGYLMLFNYIVLVKMDRWP--------SMQEWIVISYI-FTLGIEKMREILMSEPGKLLQKFKVWLQEYWNLADLVSILLFSIGMVLR--LQEQPFSSYGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPSEEPSWNLAKNIFYMPYWMIYGEVFADQIDPPCGYNVTGEDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHFTMICK-HLCCRWRKRELDQDERDYGLKLFITEDDLKKVHDFEEQCIEEY 1163          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Xenopus
Match: aldh3a2 (aldehyde dehydrogenase 3 family member A2 [Source:Xenbase;Acc:XB-GENE-942662])

HSP 1 Score: 327.02 bits (837), Expect = 1.477e-91
Identity = 304/1146 (26.53%), Postives = 538/1146 (46.95%), Query Frame = 1
Query:  148 YGAIQLSGYRVIAGKNPKYVRVHKDLSNIKGELYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKEA-------DCSVVQLIVEGGKNTIQTGAEALKSN--IPVVVMKGSKRAADVICDVVESSSD--MFQDTIKLK-LEEFEKEWNITTDEEKGNFQKNLVIFYECYQIGK-VHLFNM-KDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEINI-NLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKANA----HLHTAVNFI---FKGTIDSPEKQSLKMIGRLINQLTDNLFPQMYQEANSDSCSCCCW--KSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMRY-QEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVN-IFQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXEDFKRTEYLSKFRKEQHESLDEVGFCSAIRFFYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLG-EIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDF-IYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQV-----------DTSYMEGSQCLFGYCATPNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKLNICKNSNNGRLSVDAFIANL---IHEEDL-ECSGFEQQCMETY 3456
            +G I+  G     G + K + V          L  LMT  W  + PKL+IS++GG +N   L    K  F +GLI  + +   WI TGG  TGV + VG++ KD++  S+ +  T+ GI  WG   N+E L  +     +  P           + L+  H  FIL D+G+  K+G E+K R + E+ +S +           VV LIVEGG N I    E L+ N  +PVVV  GS RA+D++    + S +  +  ++++ + L   +K +  T  + +  F    +I  EC +  + + +F M  +   ++D AI+ A   G     P     +L LA+ +NR D+A  +IF   +   +  + +L   M  AL+ ++  FV   +  G+++  FLT S L +LY      +    HL   V  +    +G +    + SL  IG +I  L    +   Y      +     +  K PK          + +++  E  I P+ +   T      +I+ D +   E+ +  +P             +L +WA+L +R +MA  FW+ G++ +  ALVA  +C ++  +A     ++ ++  + +   EF  LA+ +L ++Y++D+     LL   L  W   +CL +A   +  +F+ H+  Q  L ++W+G++    N   ++++ +          + P ++L        +        E+   D  E   +  +K ++   +++ ++   +  +       K+ E       ++H     +     I  FY API KF    ++Y+ +L +F+Y +L++++            ++  I I YI F LG E  +  +  +    + KF  W    WN  DL   ++F+I  +LR  + +  F  Y R ++ +++  +YIR ++ + V + +GP V+MI +M+ D+++F+ I L+ L ++G    ++L+P+   +  L +NIFY PYW ++G+V           + +  +G       C T   IV    A +LL  N+LL++LLIA+F  TF +V+  SN+VW F RY++I  F+ RP+LPPP  +F  F    K ++C       L  D     L   I E+DL +   FE+QC+E Y
Sbjct:  109 FGTIEFQG----GGHSNKAMYVRLSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQN-FELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDSLKDHASKSRGKICTI-GIAPWGIVENQEDLVGKD----VVRPYQTMSNPMSKLTVLNSMHSHFILADNGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDNPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLF----IILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASAP----DQLSLALAWNRVDIARSQIF---IYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKVRVRHQGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPK----------ALKLLGMEDDI-PIRSGRKTTKKREEEIDIDLDDP-EINHFPFPF-----------HELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSREFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSSLKVILGI----------LLPPSILSLEFKNKDEMPYMSQANEM---DLQEKEVEEPDKTVKEKEEDD-MELTAMLARGNGDSSRKKDE-------DEHPRHRLIPIGRKIYEFYNAPIVKFWFFTMAYMGYLMLFNYIVLVKMDRWP--------SMQEWIVISYI-FTLGIEKMREILMSEPGKLLQKFKVWLQEYWNLADLVSILLFSIGMVLR--LQEQPFSSYGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPSEEPSWNLAKNIFYMPYWMIYGEVFADQIDPPCGYNVTGEDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHFTMICK-HLCCRWRKRELDQDERDYGLKLFITEDDLKKVHDFEEQCIEEY 1177          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Xenopus
Match: aldh3a2 (aldehyde dehydrogenase 3 family member A2 [Source:Xenbase;Acc:XB-GENE-942662])

HSP 1 Score: 326.635 bits (836), Expect = 1.598e-91
Identity = 304/1146 (26.53%), Postives = 538/1146 (46.95%), Query Frame = 1
Query:  148 YGAIQLSGYRVIAGKNPKYVRVHKDLSNIKGELYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKEA-------DCSVVQLIVEGGKNTIQTGAEALKSN--IPVVVMKGSKRAADVICDVVESSSD--MFQDTIKLK-LEEFEKEWNITTDEEKGNFQKNLVIFYECYQIGK-VHLFNM-KDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEINI-NLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKANA----HLHTAVNFI---FKGTIDSPEKQSLKMIGRLINQLTDNLFPQMYQEANSDSCSCCCW--KSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMRY-QEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVN-IFQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXEDFKRTEYLSKFRKEQHESLDEVGFCSAIRFFYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLG-EIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDF-IYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQV-----------DTSYMEGSQCLFGYCATPNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKLNICKNSNNGRLSVDAFIANL---IHEEDL-ECSGFEQQCMETY 3456
            +G I+  G     G + K + V          L  LMT  W  + PKL+IS++GG +N   L    K  F +GLI  + +   WI TGG  TGV + VG++ KD++  S+ +  T+ GI  WG   N+E L  +     +  P           + L+  H  FIL D+G+  K+G E+K R + E+ +S +           VV LIVEGG N I    E L+ N  +PVVV  GS RA+D++    + S +  +  ++++ + L   +K +  T  + +  F    +I  EC +  + + +F M  +   ++D AI+ A   G     P     +L LA+ +NR D+A  +IF   +   +  + +L   M  AL+ ++  FV   +  G+++  FLT S L +LY      +    HL   V  +    +G +    + SL  IG +I  L    +   Y      +     +  K PK          + +++  E  I P+ +   T      +I+ D +   E+ +  +P             +L +WA+L +R +MA  FW+ G++ +  ALVA  +C ++  +A     ++ ++  + +   EF  LA+ +L ++Y++D+     LL   L  W   +CL +A   +  +F+ H+  Q  L ++W+G++    N   ++++ +          + P ++L        +        E+   D  E   +  +K ++   +++ ++   +  +       K+ E       ++H     +     I  FY API KF    ++Y+ +L +F+Y +L++++            ++  I I YI F LG E  +  +  +    + KF  W    WN  DL   ++F+I  +LR  + +  F  Y R ++ +++  +YIR ++ + V + +GP V+MI +M+ D+++F+ I L+ L ++G    ++L+P+   +  L +NIFY PYW ++G+V           + +  +G       C T   IV    A +LL  N+LL++LLIA+F  TF +V+  SN+VW F RY++I  F+ RP+LPPP  +F  F    K ++C       L  D     L   I E+DL +   FE+QC+E Y
Sbjct:  115 FGTIEFQG----GGHSNKAMYVRLSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQN-FELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDSLKDHASKSRGKICTI-GIAPWGIVENQEDLVGKD----VVRPYQTMSNPMSKLTVLNSMHSHFILADNGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDNPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLF----IILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASAP----DQLSLALAWNRVDIARSQIF---IYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKVRVRHQGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPK----------ALKLLGMEDDI-PIRSGRKTTKKREEEIDIDLDDP-EINHFPFPF-----------HELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSREFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSSLKVILGI----------LLPPSILSLEFKNKDEMPYMSQANEM---DLQEKEVEEPDKTVKEKEEDD-MELTAMLARGNGDSSRKKDE-------DEHPRHRLIPIGRKIYEFYNAPIVKFWFFTMAYMGYLMLFNYIVLVKMDRWP--------SMQEWIVISYI-FTLGIEKMREILMSEPGKLLQKFKVWLQEYWNLADLVSILLFSIGMVLR--LQEQPFSSYGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPSEEPSWNLAKNIFYMPYWMIYGEVFADQIDPPCGYNVTGEDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHFTMICK-HLCCRWRKRELDQDERDYGLKLFITEDDLKKVHDFEEQCIEEY 1183          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Xenopus
Match: aldh3a2 (aldehyde dehydrogenase 3 family member A2 [Source:Xenbase;Acc:XB-GENE-942662])

HSP 1 Score: 326.25 bits (835), Expect = 2.056e-91
Identity = 312/1149 (27.15%), Postives = 538/1149 (46.82%), Query Frame = 1
Query:  148 YGAIQLSGYRVIAGKNPKYVRVHKDLSNIKGELYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKEA-------DCSVVQLIVEGGKNTIQTGAEALKSN--IPVVVMKGSKRAADVICDVVESSSD--MFQDTIKLK-LEEFEKEWNITTDEEKGNFQKNLVIFYECYQIGK-VHLFNM-KDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIF--ENQVRKNEININLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKANAH-LHTAVNFIFKGTIDSPEKQSLKMIGRLINQLTDNLFPQMYQEANSDSCSCCCW--KSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMRY-QEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVN-IFQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXEDFKRTEYLSKFRKEQHESLDEVGFCSAIRFFYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLG-EIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDF-IYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFG-----QVDTSYMEGSQCLFGY--------------CATPNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKLNICKNSNNGRLSVDAFIANL---IHEEDL-ECSGFEQQCMETY 3456
            +G I+  G     G + K + V          L  LMT  W  + PKL+IS++GG +N   L    K  F +GLI  + +   WI TGG  TGV + VG++ KD++  S+ +  T+ GI  WG   N+E L  +     +  P           + L+  H  FIL D+G+  K+G E+K R + E+ +S +           VV LIVEGG N I    E L+ N  +PVVV  GS RA+D++    + S +  +  ++++ + L   +K +  T  + +  F    +I  EC +  + + +F M  +   ++D AI+ A   G     P     +L LA+ +NR D+A  +IF    Q   +    +L   M  AL+ ++  FV   +  G+++  FLT S L +LY      ++ L+  V  + KG +    + SL  IG +I  L    +   Y      +     +  K PK          + +++  E  I P+ +   T      +I+ D +   E+ +  +P             +L +WA+L +R +MA  FW+ G++ +  ALVA  +C ++  +A     ++ ++  + +   EF  LA+ +L ++Y++D+     LL   L  W   +CL +A   +  +F+ H+  Q  L ++W+G++    N   ++++ +          + P ++L                 E  +KD   +  +++E  +Q          +K     +   D  R     K  +++H     +     I  FY API KF    ++Y+ +L +F+Y +L++++            ++  I I YI F LG E  +  +  +    + KF  W    WN  DL   ++F+I  +LR  + +  F  Y R ++ +++  +YIR ++ + V + +GP V+MI +M+ D+++F+ I L+ L ++G    ++L+P+   +  L +NIFY PYW ++G     Q+D +    S C  GY              C T   IV    A +LL  N+LL++LLIA+F  TF +V+  SN+VW F RY++I  F+ RP+LPPP  +F  F    K ++C       L  D     L   I E+DL +   FE+QC+E Y
Sbjct:   76 FGTIEFQG----GGHSNKAMYVRLSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQN-FELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDSLKDHASKSRGKICTI-GIAPWGIVENQEDLVGKD----VVRPYQTMSNPMSKLTVLNSMHSHFILADNGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDNPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLF----IILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASAP----DQLSLALAWNRVDIARSQIFIYGQQWPFSGRVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPK----------ALKLLGMEDDI-PIRSGRKTTKKREEEIDIDLDDP-EINHFPFPF-----------HELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSREFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSSLKVILGI----------LLPPSIL---------------SLEFKNKDEMPYMSQANEMDLQ----------EKEAMLARGNGDSSR-----KKDEDEHPRHRLIPIGRKIYEFYNAPIVKFWFFTMAYMGYLMLFNYIVLVKMDRWP--------SMQEWIVISYI-FTLGIEKMREILMSEPGKLLQKFKVWLQEYWNLADLVSILLFSIGMVLR--LQEQPFSSYGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPSEEPSWNLAKNIFYMPYWMIYGEVFADQIDRNRKHISPC--GYNVTGEDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHFTMICK-HLCCRWRKRELDQDERDYGLKLFITEDDLKKVHDFEEQCIEEY 1129          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Mouse
Match: Trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:MGI Symbol;Acc:MGI:2443101])

HSP 1 Score: 322.783 bits (826), Expect = 2.377e-90
Identity = 306/1148 (26.66%), Postives = 536/1148 (46.69%), Query Frame = 1
Query:  148 YGAIQLSGYRVIAGKNPKYVRVHKDLSNIKGELYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKEA-------DCSVVQLIVEGGKNTIQTGAEALKSN--IPVVVMKGSKRAADVICDVVESSSD--MFQDTIKLK-LEEFEKEWNITTDEEKGNFQKNLVIFYECYQIGK-VHLFNM-KDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEINI-NLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKANAH-LHTAVNFIFKGTIDSPEKQSLKMIGRLINQLTDNLFPQMYQEANSDSCSCCCW--KSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMRY-QEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNI-FQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXEDFKRTEYLSKFRKEQHESLDEVGFCSAIRF---------FYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLG-EIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDFIY-CRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQV-----------DTSYMEGSQCLFGYCATPNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKLNIC--KNSNNGRLSVDAFIANLIHEEDL-ECSGFEQQCMETY 3456
            +G I+  G     G + K + V          L  LMT  W  + PKL+IS++GG +N   L    K  F +GLI  + +   WI TGG  TGV + VG+A KD++  S+ +  T+ GI  WG   N+E L  +     +  P           + L+  H  FIL D+G+  K+G E+K R + E+ +S +           VV LIVEGG N I    E L+    +PVVV  GS RA+D++    + S +  +  ++++ + L   +K +  T  + +  F    +I  EC +  + + +F M  +   ++D AI+ A   G     P     +L LA+ +NR D+A  +IF   +   +  + +L   M  AL+ ++  FV   +  G+++  FLT S L +LY      ++ L+  V  + KG +    + SL  IG +I  L    +   Y      +     +  K PK          + +++  E  I P+     T      +++ D +   E+ +  +P             +L +WA+L +R +MA  FW+ G++ +  ALVA  +C ++  +A     ++ ++  + +   +F  LA+ +L ++Y++D+     LL   L  W   +CL +A   +  +F+ H+  Q  L ++W+G++    N   ++++ +          + P ++L                 E  +KD   +  ++ E     + Q    +  +   K K +ED + T  L +   E     DE    S  R          FY API KF    ++Y+ +L +F+Y +L+++         +    E+ I I YI F LG E  +  +  +    + K   W    WN  DL   ++F++  ILR  + D  F    R ++ +++  +YIR ++ + V + +GP V+MI +M+ D+++F+ I L+ L ++G    ++L+PN   +  L +NIFY PYW ++G+V           + +  +G       C T   IV    A +LL  N+LL++LLIA+F  TF +V+  SN+VW F RY++I  F+ RP+LPPP  +F      F+   C  +   + +   D  +   I +++L +   FE+QC+E Y
Sbjct:  141 FGTIEFQG----GGHSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQN-FELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALKDHASKSRGKICTI-GIAPWGIVENQEDLIGRD----VVRPYQTMSNPMSKLTVLNSMHSHFILADNGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLF----IILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASAP----DQLSLALAWNRVDIARSQIF---IYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPK----------ALKLLGMEDDI-PLRRGRKTTKKREEEVDIDLDDP-EINHFPFPF-----------HELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGI----------LLPPSIL---------------SLEFKNKDDMPYMTQAQEI----HLQEKEPEEPEKPTKEKDEEDMELTAMLGRSNGESSRKKDEEEVQSRHRLIPVGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKMER-------WPSTQEW-IVISYI-FTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILR--LQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKTIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHVCCRWRKHESDQDERDYGLKLFITDDELKKVHDFEEQCIEEY 1204          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Mouse
Match: Trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:MGI Symbol;Acc:MGI:2443101])

HSP 1 Score: 320.472 bits (820), Expect = 2.377e-90
Identity = 307/1164 (26.37%), Postives = 530/1164 (45.53%), Query Frame = 1
Query:  148 YGAIQLSGYRVIAGKNPKYVRVHKDLSNIKGELYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKEA-------DCSVVQLIVEGGKNTIQTGAEALKSN--IPVVVMKGSKRAADVICDVVESSSD--MFQDTIKLK-LEEFEKEWNITTDEEKGNFQKNLVIFYECYQIGK-VHLFNM-KDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEINI-NLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKANA----HLHTAVN---------FIFKGTIDSPEKQSLKMIGRLINQLTDNLFPQMYQEANSDSCSCCCW--KSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEE-----SSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMRY-QEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNI-FQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXEDFKRTEYLSKFRKEQHESLDEVGFCSAIRF---------FYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDFIY-CRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQV-----------DTSYMEGSQCLFGYCATPNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKLNIC--KNSNNGRLSVDAFIANLIHEEDL-ECSGFEQQCMETY 3456
            +G I+  G     G + K + V          L  LMT  W  + PKL+IS++GG +N   L    K  F +GLI  + +   WI TGG  TGV + VG+A KD++  S+ +  T+ GI  WG   N+E L  +     +  P           + L+  H  FIL D+G+  K+G E+K R + E+ +S +           VV LIVEGG N I    E L+    +PVVV  GS RA+D++    + S +  +  ++++ + L   +K +  T  + +  F    +I  EC +  + + +F M  +   ++D AI+ A   G     P     +L LA+ +NR D+A  +IF   +   +  + +L   M  AL+ ++  FV   +  G+++  FLT S L +LY      +    HL   V            FKG +    + SL  IG +I  L    +   Y      +     +  K PK          + +++  E  I       TT          +EE        E+ +  +P             +L +WA+L +R +MA  FW+ G++ +  ALVA  +C ++  +A     ++ ++  + +   +F  LA+ +L ++Y++D+     LL   L  W   +CL +A   +  +F+ H+  Q  L ++W+G++    N   ++++ +          + P ++L                 E  +KD   +  ++ E     + Q    +  +   K K +ED + T  L +   E     DE    S  R          FY API KF    ++Y+ +L +F+Y +L+++      P+      +  I I YI  L  E  +  +  +    + K   W    WN  DL   ++F++  ILR  + D  F    R ++ +++  +YIR ++ + V + +GP V+MI +M+ D+++F+ I L+ L ++G    ++L+PN   +  L +NIFY PYW ++G+V           + +  +G       C T   IV    A +LL  N+LL++LLIA+F  TF +V+  SN+VW F RY++I  F+ RP+LPPP  +F      F+   C  +   + +   D  +   I +++L +   FE+QC+E Y
Sbjct:  139 FGTIEFQG----GGHSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQN-FELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALKDHASKSRGKICTI-GIAPWGIVENQEDLIGRD----VVRPYQTMSNPMSKLTVLNSMHSHFILADNGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLF----IILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASAP----DQLSLALAWNRVDIARSQIF---IYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKREYPGFGWIYFKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPK----------ALKLLGMEDDIPLRRGRKTTK-------KREEEVDIDLDDPEINHFPFPF-----------HELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGI----------LLPPSIL---------------SLEFKNKDDMPYMTQAQEI----HLQEKEPEEPEKPTKEKDEEDMELTAMLGRSNGESSRKKDEEEVQSRHRLIPVGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKMERW---PST-----QEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILR--LQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKTIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHVCCRWRKHESDQDERDYGLKLFITDDELKKVHDFEEQCIEEY 1214          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Mouse
Match: Trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:MGI Symbol;Acc:MGI:2443101])

HSP 1 Score: 317.39 bits (812), Expect = 1.397e-88
Identity = 305/1160 (26.29%), Postives = 533/1160 (45.95%), Query Frame = 1
Query:  148 YGAIQLSGYRVIAGKNPKYVRVHKDLSNIKGELYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKEA-------DCSVVQLIVEGGKNTIQTGAEALKSN--IPVVVMKGSKRAADVIC--DVVESSSDMFQDTIKLK-LEEFEKEWNITTDEEKGNFQKNLVIFYECYQIGK-VHLFNM-KDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEINI-NLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKANAH-LHTAVNFIFKGTIDSPEKQSLKMIGRLINQLTDNLFPQMYQEANSDSCSCCCW--KSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMRY-QEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNI-FQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXEDFKRTEYLSKFRKEQHESLDEVGFCSAIRF---------FYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLG-EIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDFIY-CRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQV-----------------------DTSYMEGSQCLFGYCATPNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKLNIC--KNSNNGRLSVDAFIANLIHEEDL-ECSGFEQQCMETY 3456
            +G I+  G     G + K + V          L  LMT  W  + PKL+IS++GG +N   L    K  F +GLI  + +   WI TGG  TGV + VG+A KD++  S+ +  T+ GI  WG   N+E L  +     +  P           + L+  H  FIL D+G+  K+G E+K R + E+ +S +           VV LIVEGG N I    E L+    +PVVV  GS RA+D++           +  ++++ + L   +K +  T  + +  F    +I  EC +  + + +F M  +   ++D AI+ A   G     P     +L LA+ +NR D+A  +IF   +   +  + +L   M  AL+ ++  FV   +  G+++  FLT S L +LY      ++ L+  V  + KG +    + SL  IG +I  L    +   Y      +     +  K PK          + +++  E  I P+     T      +++ D +   E+ +  +P             +L +WA+L +R +MA  FW+ G++ +  ALVA  +C ++  +A     ++ ++  + +   +F  LA+ +L ++Y++D+     LL   L  W   +CL +A   +  +F+ H+  Q  L ++W+G++    N   ++++ +          + P ++L                 E  +KD   +  ++ E     + Q    +  +   K K +ED + T  L +   E     DE    S  R          FY API KF    ++Y+ +L +F+Y +L+++         +    E+ I I YI F LG E  +  +  +    + K   W    WN  DL   ++F++  ILR  + D  F    R ++ +++  +YIR ++ + V + +GP V+MI +M+ D+++F+ I L+ L ++G    ++L+PN   +  L +NIFY PYW ++G+V                       + +  +G       C T   IV    A +LL  N+LL++LLIA+F  TF +V+  SN+VW F RY++I  F+ RP+LPPP  +F      F+   C  +   + +   D  +   I +++L +   FE+QC+E Y
Sbjct:  141 FGTIEFQG----GGHSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQN-FELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALKDHASKSRGKICTI-GIAPWGIVENQEDLIGRD----VVRPYQTMSNPMSKLTVLNSMHSHFILADNGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLF----IILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASAP----DQLSLALAWNRVDIARSQIF---IYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPK----------ALKLLGMEDDI-PLRRGRKTTKKREEEVDIDLDDP-EINHFPFPF-----------HELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGI----------LLPPSIL---------------SLEFKNKDDMPYMTQAQEI----HLQEKEPEEPEKPTKEKDEEDMELTAMLGRSNGESSRKKDEEEVQSRHRLIPVGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKMER-------WPSTQEW-IVISYI-FTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILR--LQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDRKQVYDSHTPKSAPCGQNETREDGKTIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHVCCRWRKHESDQDERDYGLKLFITDDELKKVHDFEEQCIEEY 1216          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Mouse
Match: Trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:MGI Symbol;Acc:MGI:2443101])

HSP 1 Score: 313.153 bits (801), Expect = 2.757e-87
Identity = 306/1155 (26.49%), Postives = 532/1155 (46.06%), Query Frame = 1
Query:  202 YVRVHKDLSNIKGELYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKE---------------------ADC-----------SVVQLIVEGGKNTIQTGAEALKSN--IPVVVMKGSKRAADVICDVVESSSD--MFQDTIKLKL-EEFEKEWNITTDEEKGNFQKNLVIFYECYQIGK-VHLFNM-KDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEINI-NLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKANAH-LHTAVNFIFKGTIDSPEKQSLKMIGRLINQLTDNLFPQMYQEANSDSCSCCCW--KSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMRY-QEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNI-FQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXEDFKRTEYLSKFRKEQHESLDEVGFCSAIRF---------FYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLG-EIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDFIY-CRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQV-----------DTSYMEGSQCLFGYCATPNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKLNIC--KNSNNGRLSVDAFIANLIHEEDL-ECSGFEQQCMETY 3456
            YVRV  D       L  LMT  W  + PKL+IS++GG +N   L    K  F +GLI  + +   WI TGG  TGV + VG+A KD++  S+ +  T+ GI  WG   N+E L  +     +  P           + L+  H  FIL D+G+  K+G E+K R + E+ +S +                       C            VV LIVEGG N I    E L+    +PVVV  GS RA+D++    + S +  +  ++++ +L    +K +  T  + +  F    +I  EC +  + + +F M  +   ++D AI+ A   G     P     +L LA+ +NR D+A  +IF   +   +  + +L   M  AL+ ++  FV   +  G+++  FLT S L +LY      ++ L+  V  + KG +    + SL  IG +I  L    +   Y      +     +  K PK          + +++  E  I P+     T      +++ D +   E+ +  +P             +L +WA+L +R +MA  FW+ G++ +  ALVA  +C ++  +A     ++ ++  + +   +F  LA+ +L ++Y++D+     LL   L  W   +CL +A   +  +F+ H+  Q  L ++W+G++    N   ++++ +          + P ++L                 E  +KD   +  ++ E     + Q    +  +   K K +ED + T  L +   E     DE    S  R          FY API KF    ++Y+ +L +F+Y +L+++         +    E+ I I YI F LG E  +  +  +    + K   W    WN  DL   ++F++  ILR  + D  F    R ++ +++  +YIR ++ + V + +GP V+MI +M+ D+++F+ I L+ L ++G    ++L+PN   +  L +NIFY PYW ++G+V           + +  +G       C T   IV    A +LL  N+LL++LLIA+F  TF +V+  SN+VW F RY++I  F+ RP+LPPP  +F      F+   C  +   + +   D  +   I +++L +   FE+QC+E Y
Sbjct:    2 YVRVSFDTK--PDLLLHLMTKEWQLELPKLLISVHGGLQN-FELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALKDHASKSRGKICTI-GIAPWGIVENQEDLIGRD----VVRPYQTMSNPMSKLTVLNSMHSHFILADNGTTGKYGAEVKLRRQLEKHISLQKINTRCLPFFSLDSRLFYSFWGSCQLDPIGIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLF----IILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASAP----DQLSLALAWNRVDIARSQIF---IYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPK----------ALKLLGMEDDI-PLRRGRKTTKKREEEVDIDLDDP-EINHFPFPF-----------HELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGI----------LLPPSILS---------------LEFKNKDDMPYMTQAQEI----HLQEKEPEEPEKPTKEKDEEDMELTAMLGRSNGESSRKKDEEEVQSRHRLIPVGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKMER-------WPSTQEW-IVISYI-FTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILR--LQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKTIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHVCCRWRKHESDQDERDYGLKLFITDDELKKVHDFEEQCIEEY 1074          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Mouse
Match: Trpm7 (transient receptor potential cation channel, subfamily M, member 7 [Source:MGI Symbol;Acc:MGI:1929996])

HSP 1 Score: 310.457 bits (794), Expect = 3.591e-86
Identity = 289/1156 (25.00%), Postives = 531/1156 (45.93%), Query Frame = 1
Query:  148 YGAIQLSG----YRVIAGKNPKYVRVHKDLSNIKGEL-YKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKE-------ADCSVVQLIVEGGKNTIQTGAEALKSN--IPVVVMKGSKRAADVICDV---VESSSDMFQDTIKLKLEEFEKEWNITTDEEKGNFQKNLVIFYECYQIGKVHLFNMKDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEININLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKA--NAHLHTAVNFIFKGTIDSPEKQSLKMIGRLINQLTDNLFPQMYQEA------------NSDSCSCCCWKSPKISDS-QSFNDSS--CEVIDYEKYIEPVAT-EPTTNCCCCFKINGDEESSKEMKYTVYPIRN-KNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMR-YQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNI-FQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXEDFKRTEYL----SKFRKEQHESLDEVGFCSAIRFFYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILR-----NTVNDSD---FIYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQV---DTSYMEGSQCLFGYCATPNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKLNICKNSNNGRLSVDAFIANLIHEEDLECSGFEQQCMETY 3456
            YG I   G    YR       KYVR+  D    K E+  +L+   W  + PKL+IS++GG +    L+   K    +GLI  + +   WI+TGG  TGV+K VG+A K+++  S ++  T+ GI  WG   N+  L  +     +  P           + L+  H  FIL DDG+  K+G E++ R E E++++++           VV LI EGG N I T  E L+ +  +PVVV +G+ RAAD++  +    E   ++        +   +K +N    E    FQ  +    +   I   H+ +  +   ++D AI+ A   GT  +    D+  L L + ++R D+A+  +F     +  +  +L   M  AL+ ++  FV   +  G+++  FLT   L +LY  ++   N  L   +  + +G +    K +L  IG +I  L    +   Y               N  S       +P++  S ++F + +   E + +  +I+      P  +         +E   K  K  +  I + + K+  Y   +L +WA L +R  MA+  W+ G++ +  ALVA  +  S+  +A     ++  +  ++ Y  +F  LA+ +L +++R+D+     LL   L  W   +CL +A  ++L  F+ H+  Q  L+++W+G++    N  ++++++         I + P  L+ + +T+A  ++  +      S+D  +   + SE     N+ N T +           E FK  + L     K   E H    ++        FY API KF  N ++YL FL ++++ +L+++  +   P+      E+ +  +  ++ + ++ + FM  +      K   W S  +N  D    I F + + LR     N +N  D   F+  R ++ +++  +Y+R ++F  V Q  GP V+MI +M+ ++ + + I  + L ++G    ++LYP+   +  L ++I ++PYW +FG+V   +         L   C     +     A +L    +++++LLIA F   +++V+  SN VW + RY  I  ++ +P+LPPP  +     + F   +CK     + S D     L  E+  +   FE+QC+E Y
Sbjct:   92 YGVINFQGGSHSYRA------KYVRLSYD---TKPEIILQLLLKEWQMELPKLVISVHGGMQKF-ELHPRIKQLLGKGLIKAAVTTGAWILTGGVNTGVAKHVGDALKEHASRSSRKICTI-GIAPWGVIENRNDLVGRD----VVAPYQTLLNPLSKLNVLNNLHSHFILVDDGTVGKYGAEVRLRRELEKTINQQRIHARIGQGVPVVALIFEGGPNVILTVLEYLQESPPVPVVVCEGTGRAADLLAYIHKQTEEGGNLPDAAEPDIISTIKKTFNFGQSEAVHLFQTMMECMKKKELITVFHIGS--EDHQDIDVAILTALLKGT--NASAFDQ--LILTLAWDRVDIAKNHVF--VYGQQWLVGSLEQAMLDALVMDRVSFVKLLIENGVSMHKFLTIPRLEELYNTKQGPTNPMLFHLIRDVKQGNLPPGYKITLIDIGLVIEYLMGGTYRCTYTRKRFRLIYNSLGGNNRRSGRNTSSSTPQLRKSHETFGNRADKKEKMRHNHFIKTAQPYRPKMDASM------EEGKKKRTKDEIVDIDDPETKRFPYPLNELLIWACLMKRQVMARFLWQHGEESMAKALVACKIYRSMAYEAKQSDLVDDTSEELKQYSNDFGQLAVELLEQSFRQDETMAMKLLTYELKNWSNSTCLKLAVSSRLRPFVAHTCTQMLLSDMWMGRLNMRKNSWYKVILS---------ILVPPAILMLEYKTKAEMSHIPQ------SQDAHQMTMEDSEN----NFHNITEEIPM--------EVFKEVKILDSSDGKNEMEIHIKSKKLPITRKFYAFYHAPIVKFWFNTLAYLGFLMLYTFVVLVKMEQL---PSVQ----EWIVIAYIFTYAIEKVREVFMS-EAGKISQKIKVWFSDYFNVSDTIAIISFFVGFGLRFGAKWNYINAYDNHVFVAGRLIYCLNIIFWYVRLLDFLAVNQQAGPYVMMIGKMVANMFYIVVIMALVLLSFGVPRKAILYPHEEPSWSLAKDIVFHPYWMIFGEVYAYEIDVCANDSTLPTICGPGTWLTPFLQAVYLFVQYIIMVNLLIAFFNNVYLQVKAISNIVWKYQRYHFIMAYHEKPVLPPPLIILSHIVSLF-CCVCKRRKKDKTS-DGPKLFLTEEDQKKLHDFEEQCVEMY 1181          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. UniProt/SwissProt
Match: sp|A7T1N0|TMP2L_NEMVE (Transient receptor potential cation channel subfamily M member-like 2 OS=Nematostella vectensis OX=45351 GN=TRPM2 PE=1 SV=1)

HSP 1 Score: 365.54 bits (937), Expect = 3.766e-104
Identity = 306/1156 (26.47%), Postives = 556/1156 (48.10%), Query Frame = 1
Query:  130 RHEKFQYGAIQLSGYRVIAGKNPKYVRVHKDL-SNIKGELYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQT-FTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSK-------EAD---CSVVQLIVEGGKNTIQTGAEALKSNIPVVVMKGSKRAADVICDVVESS--SDMFQDTIKLKLEEFEKEWNITTDEEKG--NFQKNLVIFYECYQIGK-VHLFNMK-DFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIF-ENQVRKNEININLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKANAHLHTAVNFIFKGTIDSPEKQSLKM--IGRLINQLTDNLFPQMYQEANSDSCSCCCWKSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEI-EIMNNWMRYQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNIFQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFX-----XXXXXXXXXEDFKRTEYLSKFRKEQHESL----DEVGFCSAIRFFYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYS-RKIEYCIYIFYISFLLGEIYQFFMGGQVKNFI-SKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDFIYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINI-----TSPLMRNIFYNPYWQLFGQVDTSYMEGSQCLFGYCATPNA--IVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFK--LNICKNSNNGRLSVDAFIANLIHEEDLECSGFEQQCMETYLITNQ 3471
            +H    YG I   GY     K   Y+R+  D  +N+   +  LM   W  + P L+IS+ GGAK+ + L    +  F+RGLI  +K+   WI+TGG  TGV K VGEA K+  ++    T   V+GI TWG    +  L  +         + +P    +G + LDP H  F L DDG++ K+G EI  R+  EE++ K       EA      VV L++EGG NT+ T  E +K  +P VV+ GS RAA V+      +   ++   TI +   ++E E      E  G     K   +  +  +  K + ++++  +   ++D AI++A      +  P+   A+L LA+ +NR D+A+  IF E Q    E    L   M TAL+ ++ +F + FL+ GL++  FL+  +L  LY +   N    T +  + +  +   + +++ M  +G +I +L  ++F   Y++                 D   F + +        Y E +  +             + +SSK++   +    N+   +     D+FLWA+L  R E+A++ W+ G++ + +AL+A+ +   +  +A     I +I ++   +   FE  A+ +L E +  ++  +  LL+R L ++ R + L++A   +  +F+ H++CQ  L  +W+G +      +++L+ +   YL   IF   Y +  ++  +       +      S     H++K+   ++ P Y++   +               +EDF+  +Y+ + R++    +     ++GFC  I  FY+AP +KFV N++ YLAF+ +++Y +L        + T       E  +Y +  + L+ EI Q  +  +   +I  K + + S  WN+ D+    VF IA ILR   N   F   R + S+ +  F +R ++ + V + +GPK++MI +M++D+  F+ I  +   AYG    ++++P+  I     T   + ++   PYWQ++G++    ++G +        P+   +  +  A +++FTN+LLL+LLIA+F  TF +V+E+S++VW F RY +++E++ RP+  PP  +      F +    +C+  +  R S       L   E  +   +E Q  E Y+   Q
Sbjct:   89 KHPTNAYGEIDFEGYG--GQKRAPYLRMSHDTDANL---VITLMLKRWNLEIPNLVISVTGGAKSFV-LKPRLREMFRRGLIKAAKTTGAWIITGGTNTGVMKHVGEAVKEQQLMFGSDTQVNVIGIATWGIVDKQSDLISEKNGKYPALYSMEPTPGHQG-AMLDPNHSHFFLVDDGTEGKYGVEIGMRSRIEEAIMKVKTDSRSEAGSIGVPVVLLVLEGGPNTVATMYELIKKKVPAVVIDGSGRAASVVGFAYNHTIKRNVDGQTINVIDPQYEDEVRAKVVEVFGAKGADKTYSMIKDVLEDEKMISVYSLDGEISQDIDLAILKALLKAN-RSSPV---AQLNLALAWNRIDLAKSDIFTEEQQWTTE---TLSAAMLTALLDDKAEFAELFLQNGLSMREFLSLDILCKLYAEVPGN----TTIKPLLQKEMGKRQVKTIDMDVVGEVIEELMGDMFESYYRK-----------------DGHYFGELAS-------YAEGLVLK-------------NRKSSKDLLANI----NRIDPLPTPYLDVFLWAVLCNRRELARVLWEAGREPMAAALMASRLLKRMASRAQEDNTITDISSDLYDHARLFEERAVGVLDECFNENETLSQTLLVRELDHYSRMTALELAVSAESQDFIAHTSCQVLLTRLWMGTMAMNTRWWKVLVCL---YLPVLIFPIIYFVPDEQHERQAAEREHQKSLNQKSSKVKSHKEKNDAPVV-PVYRSKEEKAVSNDEEARVGTENEEEDFQLEDYIPEIREDDSMEVIMRNKKLGFCDRIMHFYSAPFSKFVGNVVGYLAFIFLYAYVVLFNFPRFDPAKTLGGIHPTEIVLYFWVFTILIEEIRQ--LAAKPPKYIKDKVSVYFSDTWNFVDIFSLTVFIIAIILRFFTNSRIFTASRIILSLDIIFFIVRSLQIFSVNRLLGPKLVMIQKMMQDLAQFIIILAVFTIAYGIALHAVMFPSPGIYARNNTWVTITSVVQYPYWQMYGELFLDEIQGEKPKEFGEVDPDGRWLSPLLLAIYMVFTNILLLNLLIAIFNYTFERVQEDSDKVWKFQRYDLVQEYHSRPVFAPPLVLLGHILIFIRWVWRMCRCGHPPRGST--MKIGLSPAEMEQMDNWEFQAAEMYIHQQQ 1177          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. UniProt/SwissProt
Match: sp|Q96QT4|TRPM7_HUMAN (Transient receptor potential cation channel subfamily M member 7 OS=Homo sapiens OX=9606 GN=TRPM7 PE=1 SV=1)

HSP 1 Score: 313.538 bits (802), Expect = 2.449e-86
Identity = 295/1160 (25.43%), Postives = 534/1160 (46.03%), Query Frame = 1
Query:  148 YGAIQLSG----YRVIAGKNPKYVRVHKDLSNIKGE-LYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKE-------ADCSVVQLIVEGGKNTIQTGAEALKSN--IPVVVMKGSKRAADVICDV---VESSSDMFQDTIKLKLEEFEKEWNITTDEEKGNFQKNLVIFYECYQIGK-VHLFNM-KDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEININLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKA--NAHLHTAVNFIFKGTIDSPEKQSLKMIGRLINQLTDNLFPQMYQEA------------NSDSCSCCCWKSPKISDS-QSFNDSS--CEVIDYEKYIEPVAT-EPTTNCCCCFKINGDEESSKEMKYTVYPIRN-KNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMR-YQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNI-FQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXEDFKRTEYL----SKFRKEQHESLDEVGFCSAIRFFYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFM--GGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILR--------NTVNDSDFIYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQV---DTSYMEGSQCLFGYCATPNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKLNICKNSNNGRLSVDAFIANLIHEEDLECSGFEQQCMETY 3456
            YG I   G    YR       KYVR+  D    K E + +L+   W  + PKL+IS++GG +    L+   K    +GLI  + +   WI+TGG  TGV+K VG+A K+++  S ++  T+ GI  WG   N+  L  +     +  P           + L+  H  FIL DDG+  K+G E++ R E E++++++           VV LI EGG N I T  E L+ +  +PVVV +G+ RAAD++  +    E   ++        +   +K +N   +E    FQ       EC +  + + +F++  D   ++D AI+ A   GT  +    D+  L L + ++R D+A+  +F     +  +  +L   M  AL+ ++  FV   +  G+++  FLT   L +LY  ++   N  L   V  + +G +    K +L  IG +I  L    +   Y               N  S       +P++  S +SF + +   E + +  +I+      P  +         +E   K  K  +  I + + K+  Y   +L +WA L +R  MA+  W+ G++ +  ALVA  +  S+  +A     ++  +  ++ Y  +F  LA+ +L +++R+D+     LL   L  W   +CL +A  ++L  F+ H+  Q  L+++W+G++    N  ++++++         I + P  LL + +T+A  ++  +      S+D  +     SE     N+QN T +           E FK    L     K   E      ++        FY API KF  N ++YL FL ++++ +L+++  +   P+      E+ +  +  ++ + ++ + FM   G+V     K   W S  +N  D    I F I + LR        N  ++  F+  R ++ +++  +Y+R ++F  V Q  GP V+MI +M+ ++ + + I  + L ++G    ++LYP+   +  L ++I ++PYW +FG+V   +         +   C     +     A +L    +++++LLIA F   +++V+  SN VW + RY  I  ++ +P+LPPP  +     + F   ICK     + S D     L  E+  +   FE+QC+E Y
Sbjct:   92 YGVINFQGGSHSYRA------KYVRLSYD---TKPEVILQLLLKEWQMELPKLVISVHGGMQKF-ELHPRIKQLLGKGLIKAAVTTGAWILTGGVNTGVAKHVGDALKEHASRSSRKICTI-GIAPWGVIENRNDLVGRD----VVAPYQTLLNPLSKLNVLNNLHSHFILVDDGTVGKYGAEVRLRRELEKTINQQRIHARIGQGVPVVALIFEGGPNVILTVLEYLQESPPVPVVVCEGTGRAADLLAYIHKQTEEGGNLPDAAEPDIISTIKKTFNFGQNEALHLFQ----TLMECMKRKELITVFHIGSDEHQDIDVAILTALLKGT--NASAFDQ--LILTLAWDRVDIAKNHVF--VYGQQWLVGSLEQAMLDALVMDRVAFVKLLIENGVSMHKFLTIPRLEELYNTKQGPTNPMLFHLVRDVKQGNLPPGYKITLIDIGLVIEYLMGGTYRCTYTRKRFRLIYNSLGGNNRRSGRNTSSSTPQLRKSHESFGNRADKKEKMRHNHFIKTAQPYRPKIDTVM------EEGKKKRTKDEIVDIDDPETKRFPYPLNELLIWACLMKRQVMARFLWQHGEESMAKALVACKIYRSMAYEAKQSDLVDDTSEELKQYSNDFGQLAVELLEQSFRQDETMAMKLLTYELKNWSNSTCLKLAVSSRLRPFVAHTCTQMLLSDMWMGRLNMRKNSWYKVILS---------ILVPPAILLLEYKTKAEMSHIPQ------SQDAHQMTMDDSEN----NFQNITEEIPM--------EVFKEVRILDSNEGKNEMEIQMKSKKLPITRKFYAFYHAPIVKFWFNTLAYLGFLMLYTFVVLVQMEQL---PSVQ----EWIVIAYIFTYAIEKVREIFMSEAGKVNQ---KIKVWFSDYFNISDTIAIISFFIGFGLRFGAKWNFANAYDNHVFVAGRLIYCLNIIFWYVRLLDFLAVNQQAGPYVMMIGKMVANMFYIVVIMALVLLSFGVPRKAILYPHEAPSWTLAKDIVFHPYWMIFGEVYAYEIDVCANDSVIPQICGPGTWLTPFLQAVYLFVQYIIMVNLLIAFFNNVYLQVKAISNIVWKYQRYHFIMAYHEKPVLPPPLIILSHIVSLF-CCICKRRKKDKTS-DGPKLFLTEEDQKKLHDFEEQCVEMY 1181          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. UniProt/SwissProt
Match: sp|Q925B3|TRPM7_RAT (Transient receptor potential cation channel subfamily M member 7 OS=Rattus norvegicus OX=10116 GN=Trpm7 PE=1 SV=2)

HSP 1 Score: 311.227 bits (796), Expect = 1.191e-85
Identity = 291/1156 (25.17%), Postives = 531/1156 (45.93%), Query Frame = 1
Query:  148 YGAIQLSG----YRVIAGKNPKYVRVHKDLSNIKGEL-YKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKE-------ADCSVVQLIVEGGKNTIQTGAEALKSN--IPVVVMKGSKRAADVICDV---VESSSDMFQDTIKLKLEEFEKEWNITTDEEKGNFQKNLVIFYECYQIGKVHLFNMKDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEININLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKA--NAHLHTAVNFIFKGTIDSPEKQSLKMIGRLINQLTDNLFPQMYQEA------------NSDSCSCCCWKSPKISDS-QSFNDSS--CEVIDYEKYIEPVAT-EPTTNCCCCFKINGDEESSKEMKYTVYPIRN-KNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMR-YQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNI-FQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXEDFKRTEYL----SKFRKEQHESLDEVGFCSAIRFFYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILR-----NTVNDSD---FIYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQV---DTSYMEGSQCLFGYCATPNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKLNICKNSNNGRLSVDAFIANLIHEEDLECSGFEQQCMETY 3456
            YG I   G    YR       KYVR+  D    K E+  +L+   W  + PKL+IS++GG +    L+   K    +GLI  + +   WI+TGG  TGV+K VG+A K+++  S ++  T+ GI  WG   N+  L  +     +  P           + L+  H  FIL DDG+  K+G E++ R E E++++++           VV LI EGG N I T  E L+ +  +PVVV +G+ RAAD++  +    E   ++        +   +K +N    E    FQ  +    +   I   H+ +  +   ++D AI+ A   GT  +    D+  L L + ++R D+A+  +F     +  +  +L   M  AL+ ++  FV   +  G+++  FLT   L +LY  ++   N  L   +  + +G +    K +L  IG +I  L    +   Y               N  S       +P++  S ++F + +   E + +  +I+      P  +         +E   K  K  +  I + + K+  Y   +L +WA L +R  MA+  W+ G++ +  ALVA  +  S+  +A     ++  +  ++ Y  +F  LA+ +L +++R+D+     LL   L  W   +CL +A  ++L  F+ H+  Q  L+++W+G++    N  ++++++         I + P  L+ + +T+A  ++  +      S+D  +   + SE     N+ N T +           E FK  + L     K   E H    ++        FY API KF  N ++YL FL ++++ +L+++  +   P+      E+ +  +  ++ + +I + FM  +      K   W S  +N  D    I F + + LR     N +N  D   F+  R ++ +++  +Y+R ++F  V Q  GP V+MI +M+ ++ + + I  + L ++G    ++LYP+   +  L ++I ++PYW +FG+V   +         L   C     +     A +L    +++++LLIA F   +++V+  SN VW + RY  I  ++ +P+LPPP  +     + F   ICK     + S D     L  E+  +   FE+QC+E Y
Sbjct:   92 YGVINFQGGSHSYRA------KYVRLSYD---TKPEIILQLLLKEWQMELPKLVISVHGGMQKF-ELHPRIKQLLGKGLIKAAVTTGAWILTGGVNTGVAKHVGDALKEHASRSSRKICTI-GIAPWGVIENRNDLVGRD----VVAPYQTLLNPLSKLNVLNNLHSHFILVDDGTVGKYGAEVRLRRELEKTINQQRIHARIGQGVPVVALIFEGGPNVILTVLEYLQESPPVPVVVCEGTGRAADLLAYIHKQTEEGGNLPDAAEPDIISTIKKTFNFGQSEAVHLFQTMMECMKKKELITVFHIGS--EDHQDIDVAILTALXXGT--NASAFDQ--LILTLAWDRVDIAKNHVF--VYGQQWLVGSLEQAMLDALVMDRVSFVKLLIENGVSMHKFLTIPRLEELYNTKQGPTNPMLFHLIRDVKQGNLPPGYKITLIDIGLVIEYLMGGTYRCTYTRKRFRLIYNSLGGNNRRSGRNASSSTPQLRKSHETFGNRADKKEKMRHNHFIKTAQPYRPKMDASM------EEGKKKRTKDEIVDIDDPETKRFPYPLNELLIWACLMKRQVMARFLWQHGEESMAKALVACKIYRSMAYEAKQSDLVDDTSEELKQYSNDFGQLAVELLEQSFRQDETMAMKLLTYELKNWSNSTCLKLAVSSRLRPFVAHTCTQMLLSDMWMGRLNMRKNSWYKVILS---------ILVPPAILMLEYKTKAEMSHIPQ------SQDAHQMTMEDSEN----NFHNITEEIPM--------EVFKEVKILDSSEGKNEMEIHIKSKKLPITRKFYAFYHAPIVKFWFNTLAYLGFLMLYTFVVLVQMEQL---PSVQ----EWIVIAYIFTYAIEKIREVFMS-EAGKISQKIKVWFSDYFNVSDTIAIISFFVGFGLRFGAKWNYINAYDNHVFVAGRLIYCLNIIFWYVRLLDFLAVNQQAGPYVMMIGKMVANMFYIVVIMALVLLSFGVPRKAILYPHEEPSWSLAKDIVFHPYWMIFGEVYAYEIDVCANDSALPTICGPGTWLTPFLQAVYLFVQYIIMVNLLIAFFNNVYLQVKAISNIVWKYQRYHFIMAYHEKPVLPPPLIILSHIVSLF-CCICKRRKKDKTS-DGPKLFLTEEDQKKLHDFEEQCVEMY 1181          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. UniProt/SwissProt
Match: sp|Q9HCF6|TRPM3_HUMAN (Transient receptor potential cation channel subfamily M member 3 OS=Homo sapiens OX=9606 GN=TRPM3 PE=2 SV=4)

HSP 1 Score: 310.842 bits (795), Expect = 1.531e-85
Identity = 308/1181 (26.08%), Postives = 533/1181 (45.13%), Query Frame = 1
Query:  148 YGAIQLSGYRVIAGKNPKYVRVHKDLSNIKGELYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKE---------------------ADC-----------SVVQLIVEGGKNTIQTGAEALKSN--IPVVVMKGSKRAADVICDVVESSSD--MFQDTIKLKL-EEFEKEWNITTDEEKGNFQKNLVIFYECYQIGK-VHLFNM-KDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEINI-NLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKANAH-LHTAVNFIFKGTIDSPEKQSLKMIGRLINQLTDNLFPQMYQEANSDSCSCCCW--KSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEE-----SSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMRY-QEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNI-FQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXEDFKRTEYLSKFRKEQHESLDEVGFCSAIRF---------FYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLG-EIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDFIY-CRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQV-----------DTSYMEGSQCLFGYCATPNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKLNICK------NSNNGRLSVDAFIANLIHEEDLECSGFEQQCMETY 3456
            +G I+  G     G + K + V          L  LMT  W  + PKL+IS++GG +N   L    K  F +GLI  + +   WI TGG  TGV + VG+A KD++  S+ +  T+ GI  WG   N+E L  +     +  P           + L+  H  FIL D+G+  K+G E+K R + E+ +S +                       C            VV LIVEGG N I    E L+    +PVVV  GS RA+D++    + S +  +  ++++ +L    +K +  T  + +  F    +I  EC +  + + +F M  +   ++D AI+ A   G     P     +L LA+ +NR D+A  +IF   +   +  + +L   M  AL+ ++  FV   +  G+++  FLT S L +LY      ++ L+  V  + KG +    + SL  IG +I  L    +   Y      +     +  K PK          + +++  E  I       TT          +EE        E+ +  +P             +L +WA+L +R +MA  FW+ G++ +  ALVA  +C ++  +A     ++ ++  + +   +F  LA+ +L ++Y++D+     LL   L  W   +CL +A   +  +F+ H+  Q  L ++W+G++    N   ++++ +          + P ++L                 E  +KD   +  ++ E     + Q    +  +   K K +ED + T  L +   E     DE    S  R          FY API KF    ++Y+ +L +F+Y +L+++         +    E+ I I YI F LG E  +  +  +    + K   W    WN  DL   ++F++  ILR  + D  F    R ++ +++  +YIR ++ + V + +GP V+MI +M+ D+++F+ I L+ L ++G    ++L+PN   +  L +NIFY PYW ++G+V           + +  +G       C T   IV    A +LL  N+LL++LLIA+F  TF +V+  SN+VW F RY++I  F+ RP+LPPP  +F      F+   C+      + +     +  FI +   +E  +   FE+QC+E Y
Sbjct:  139 FGTIEFQG----GGHSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQN-FELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALKDHASKSRGKICTI-GIAPWGIVENQEDLIGRD----VVRPYQTMSNPMSKLTVLNSMHSHFILADNGTTGKYGAEVKLRRQLEKHISLQKINTRCLPFFSLDSRLFYSFWGSCQLDSVGIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQKTFTYTRTQAQHLF----IILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASAP----DQLSLALAWNRVDIARSQIF---IYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPK----------ALKLLGMEDDIPLRRGRKTTK-------KREEEVDIDLDDPEINHFPFPF-----------HELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGI----------LLPPSILS---------------LEFKNKDDMPYMSQAQEI----HLQEKEAEEPEKPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKMER-------WPSTQEW-IVISYI-FTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVGMILR--LQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHLCCRWRKHESDPDERDYGLKLFITD---DELKKVHDFEEQCIEEY 1227          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. UniProt/SwissProt
Match: sp|Q923J1|TRPM7_MOUSE (Transient receptor potential cation channel subfamily M member 7 OS=Mus musculus OX=10090 GN=Trpm7 PE=1 SV=1)

HSP 1 Score: 310.071 bits (793), Expect = 2.903e-85
Identity = 289/1156 (25.00%), Postives = 531/1156 (45.93%), Query Frame = 1
Query:  148 YGAIQLSG----YRVIAGKNPKYVRVHKDLSNIKGEL-YKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKE-------ADCSVVQLIVEGGKNTIQTGAEALKSN--IPVVVMKGSKRAADVICDV---VESSSDMFQDTIKLKLEEFEKEWNITTDEEKGNFQKNLVIFYECYQIGKVHLFNMKDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEININLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKA--NAHLHTAVNFIFKGTIDSPEKQSLKMIGRLINQLTDNLFPQMYQEA------------NSDSCSCCCWKSPKISDS-QSFNDSS--CEVIDYEKYIEPVAT-EPTTNCCCCFKINGDEESSKEMKYTVYPIRN-KNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMR-YQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNI-FQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXEDFKRTEYL----SKFRKEQHESLDEVGFCSAIRFFYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILR-----NTVNDSD---FIYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQV---DTSYMEGSQCLFGYCATPNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKLNICKNSNNGRLSVDAFIANLIHEEDLECSGFEQQCMETY 3456
            YG I   G    YR       KYVR+  D    K E+  +L+   W  + PKL+IS++GG +    L+   K    +GLI  + +   WI+TGG  TGV+K VG+A K+++  S ++  T+ GI  WG   N+  L  +     +  P           + L+  H  FIL DDG+  K+G E++ R E E++++++           VV LI EGG N I T  E L+ +  +PVVV +G+ RAAD++  +    E   ++        +   +K +N    E    FQ  +    +   I   H+ +  +   ++D AI+ A   GT  +    D+  L L + ++R D+A+  +F     +  +  +L   M  AL+ ++  FV   +  G+++  FLT   L +LY  ++   N  L   +  + +G +    K +L  IG +I  L    +   Y               N  S       +P++  S ++F + +   E + +  +I+      P  +         +E   K  K  +  I + + K+  Y   +L +WA L +R  MA+  W+ G++ +  ALVA  +  S+  +A     ++  +  ++ Y  +F  LA+ +L +++R+D+     LL   L  W   +CL +A  ++L  F+ H+  Q  L+++W+G++    N  ++++++         I + P  L+ + +T+A  ++  +      S+D  +   + SE     N+ N T +           E FK  + L     K   E H    ++        FY API KF  N ++YL FL ++++ +L+++  +   P+      E+ +  +  ++ + ++ + FM  +      K   W S  +N  D    I F + + LR     N +N  D   F+  R ++ +++  +Y+R ++F  V Q  GP V+MI +M+ ++ + + I  + L ++G    ++LYP+   +  L ++I ++PYW +FG+V   +         L   C     +     A +L    +++++LLIA F   +++V+  SN VW + RY  I  ++ +P+LPPP  +     + F   +CK     + S D     L  E+  +   FE+QC+E Y
Sbjct:   92 YGVINFQGGSHSYRA------KYVRLSYD---TKPEIILQLLLKEWQMELPKLVISVHGGMQKF-ELHPRIKQLLGKGLIKAAVTTGAWILTGGVNTGVAKHVGDALKEHASRSSRKICTI-GIAPWGVIENRNDLVGRD----VVAPYQTLLNPLSKLNVLNNLHSHFILVDDGTVGKYGAEVRLRRELEKTINQQRIHARIGQGVPVVALIFEGGPNVILTVLEYLQESPPVPVVVCEGTGRAADLLAYIHKQTEEGGNLPDAAEPDIISTIKKTFNFGQSEAVHLFQTMMECMKKKELITVFHIGS--EDHQDIDVAILTALLKGT--NASAFDQ--LILTLAWDRVDIAKNHVF--VYGQQWLVGSLEQAMLDALVMDRVSFVKLLIENGVSMHKFLTIPRLEELYNTKQGPTNPMLFHLIRDVKQGNLPPGYKITLIDIGLVIEYLMGGTYRCTYTRKRFRLIYNSLGGNNRRSGRNTSSSTPQLRKSHETFGNRADKKEKMRHNHFIKTAQPYRPKMDASM------EEGKKKRTKDEIVDIDDPETKRFPYPLNELLIWACLMKRQVMARFLWQHGEESMAKALVACKIYRSMAYEAKQSDLVDDTSEELKQYSNDFGQLAVELLEQSFRQDETMAMKLLTYELKNWSNSTCLKLAVSSRLRPFVAHTCTQMLLSDMWMGRLNMRKNSWYKVILS---------ILVPPAILMLEYKTKAEMSHIPQ------SQDAHQMTMEDSEN----NFHNITEEIPM--------EVFKEVKILDSSDGKNEMEIHIKSKKLPITRKFYAFYHAPIVKFWFNTLAYLGFLMLYTFVVLVKMEQL---PSVQ----EWIVIAYIFTYAIEKVREVFMS-EAGKISQKIKVWFSDYFNVSDTIAIISFFVGFGLRFGAKWNYINAYDNHVFVAGRLIYCLNIIFWYVRLLDFLAVNQQAGPYVMMIGKMVANMFYIVVIMALVLLSFGVPRKAILYPHEEPSWSLAKDIVFHPYWMIFGEVYAYEIDVCANDSTLPTICGPGTWLTPFLQAVYLFVQYIIMVNLLIAFFNNVYLQVKAISNIVWKYQRYHFIMAYHEKPVLPPPLIILSHIVSLF-CCVCKRRKKDKTS-DGPKLFLTEEDQKKLHDFEEQCVEMY 1181          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. TrEMBL
Match: A0A077LAN8 (Transient receptor potential ion channel M b (Fragment) OS=Dugesia japonica OX=6161 GN=DjTRPMb PE=2 SV=1)

HSP 1 Score: 1124.77 bits (2908), Expect = 0.000e+0
Identity = 553/845 (65.44%), Postives = 681/845 (80.59%), Query Frame = 1
Query:  376 VSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKEADCSVVQLIVEGGKNTIQTGAEALKSNIPVVVMKGSKRAADVICDVVESSSDMFQDTIKLKLEEFEKEWNITTDEEKGNFQKNLVIFYECYQ--IGKVHLFNMKDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEININLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKANAHLHTAVNFIFKGTIDSPEKQSLKMIGRLINQLTDNLFPQMYQEANSDSCSCCCWKSPKISDSQSFNDSSC--EVIDYEKYIEPVATEPTTNCCCCFKI-NGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMRYQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNIFQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSK------DFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXEDFKRTEYLSKFRKEQHESLDEVGFCSAIRFFYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDFIYCRTLFSISLSMFYIRFMEFYYVQQSVG 2877
            VSKSA TWIVTGGFE GVSKLVGEASKDYSILSK+QTFTVLGIGTWG TYN +KL M +E+D++TY N D QKV KGQS L+P+HDAFILYDDG+D+KFG+EI+FR +FEE +SK A CSVVQLIVEGGKNTI+TGAEAL SNIPVVVMKGS+RAADVICDVVE+S DM  +TI+LK  EF  EWN+ + ++K NFQ+NL  F + Y+    +VHLFNM+DFKNNLDTAIIEAAFSGTI D+ LGD+AKL LAMTFNRADVAE+RIFE++      +INLR +M+ AL+RNQWQFVDFFLRQG+TVESFLT  +L DLYF ++A  +   A   IF G ++S E Q+LK +G++I++LT N+FP MY+EA  DSCSCCCW + KI+D+Q   D+S   EV D+EKYIEP     ++NCC   +  N + ++   +KYT++P RN+ K+IIYTEQDLFLWALLTQRIEMAKIFWK GKDHIGSALVA+++C+SLQKKAGAKGEIEI NN  ++QE+FET++I+ILSEAYRRDQIRTHLLLIR LPYWGRESCLDIANKNQ+INFLFHSACQTRLN+IWLGKIPN VN FQIL+N+PFG+LTSR+FIFPYNL GK+Q  +     +E    + +K      +F+  +Q SS+   Q +YQ   L+ K  KK  K +E+ KRTEYLSKFRKE+H S+D++ FCSA+++FYTAP+TKFVMNIISYLAFLT+FSYFLLIELN ++LSP   +R  EY +Y+++IS+++GEI QFFMGGQ  N  SKFNNWKSSMWNWFDL  YIVFT+ YILR +  +S+ +YCRTLF++SLSMF+I        ++++G
Sbjct:    1 VSKSAPTWIVTGGFEAGVSKLVGEASKDYSILSKQQTFTVLGIGTWGCTYNNKKLLMNSENDKVTYHNDDIQKVKKGQSQLNPHHDAFILYDDGTDKKFGQEIEFRAQFEEFISKTAKCSVVQLIVEGGKNTIRTGAEALDSNIPVVVMKGSRRAADVICDVVEASDDMLDETIELKYSEFVDEWNMKSKDDKANFQQNLRNFAKRYKDKHKQVHLFNMRDFKNNLDTAIIEAAFSGTIDDKNLGDDAKLKLAMTFNRADVAEERIFEDKT-----DINLRLYMKQALVRNQWQFVDFFLRQGITVESFLTKKLLHDLYFDKEAIGYFIPAALLIF-GNMNSKEIQNLKTVGKIISRLTSNIFPAMYREAEPDSCSCCCWNNVKITDTQLSIDNSTDYEVKDHEKYIEPKVITESSNCCHVKRDGNSNGDNGNRIKYTIHPTRNREKEIIYTEQDLFLWALLTQRIEMAKIFWKNGKDHIGSALVASLICNSLQKKAGAKGEIEIQNNLKKFQEDFETMSIDILSEAYRRDQIRTHLLLIRGLPYWGRESCLDIANKNQMINFLFHSACQTRLNHIWLGKIPNIVNNFQILVNIPFGFLTSRLFIFPYNLFGKKQNDSANEKLNEEQQSISNKFQSPESEFNISKQTSSDNFFQNDYQIVNLKSKNWKKNKKSQEELKRTEYLSKFRKEEHFSMDKIHFCSAVKYFYTAPVTKFVMNIISYLAFLTIFSYFLLIELNIMSLSPNPINRATEYSVYVYFISYVIGEIRQFFMGGQANNLASKFNNWKSSMWNWFDLLTYIVFTVGYILRCS-GESNIVYCRTLFAMSLSMFFISLWNSIMFKKALG 838          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. TrEMBL
Match: R7TUH6 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_199955 PE=4 SV=1)

HSP 1 Score: 462.611 bits (1189), Expect = 4.976e-138
Identity = 341/1173 (29.07%), Postives = 587/1173 (50.04%), Query Frame = 1
Query:  148 YGAIQLSGYRVIAGKNPKYVRV-HKDLSNIKGELYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSK--KQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPN-YDPQKVG----KGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKEADCSV----------VQLIVEGGKNTIQTGAEALKSNIPVVVMKGSKRAADVIC---------DVVESSSDMFQ--DTIKLKLEEFEKEWN-----ITTDEEKGNFQKNLVIFYECYQIGKVHLFNMKDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEININLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKANAHLHTAVNFIFKGTIDSPEKQSLKMIGRLINQLTDNLFPQMYQEANSDSCSCCCWKSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCCC-CFKINGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMRYQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNIFQIL------INVPFGYLTSRIFIFPYNLLGKRQTQAVQ--------TNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXEDFKRTEYLSKFRKEQHESLDEVGFCSAIRFFYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDFIYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQVDTSYMEGSQCLFGY-------------CATPNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKLNICKNSNNGRLSVDAFIANLIHEEDL-ECSGFEQQCMETYLITNQLL 3477
            +G I+  G+     KN  +VRV HK   ++   +++L+   W  K PKL+IS+ GGAK    + +    AFKRGL+  + +   WI+TGG  TGV K VGEA  ++ + +   +     LGI TWG   N+E L    +DD   +P  Y+ +++     +G SPLDP H  FIL D+G++ KFG EIKF    ++ +S+  +  V          V L++EGG+NT++   +++K   P+VV+ GS RAAD I          DV E  S      D   L    +  +W+     +T + +      N+ +     ++  V      D  N++D AI++A       D     + +L LA+ +NR D+A + IF  + R     +NL   M TAL++++  FV  FL  G+ ++ FL+   LRDLY    ++ +   A +                ++  L+ +  D  F  +    +  S     +    +    S          +EKYI        +N      +   + +S+     +  P   K  ++    ++LF+WA+L  R ++A +FWKCG D IG AL A+ V SSL   A ++ EI++        + FE LA+ +L+  Y+++++ +H LL+R LP WG  + L +A+   L++F+ H+ CQTRLNNIW+GK+  + + ++IL      + +PF    S  F    + +   + Q VQ                E LS        +   K ++    N     +K K          R  + + F+    +S   +    AI F++T P+ KF  + ISY+ FL ++S+F+L +L+   +S        E  ++ + ++ ++ EI Q ++   V +  ++  ++  S+WN FD  +Y +  I+ I+R T+ +  F++ R +++++L+MF++RF+  ++V +++GPKVIMI RML D+LFF++I ++ + A+G  S SL YPN  ++  +++N+ Y PYWQ++G++    + G      +             C     +V +  A +++  N+LLL+LLIAMF  TF KV++NS +VW F RY +I E++ +P L PP  +   F    K  I +  N   +S D    N++ ++D  + + FE+  M+ +L+  Q+L
Sbjct:   86 FGTIRFQGFGQEVSKNAPFVRVDHKTEESV---VWELLNEYWHIKAPKLMISVTGGAKRFF-MKDRLTTAFKRGLMRAATTTGAWIITGGTNTGVMKFVGEAVHEHMLTTSDAESNVVALGIATWGIVDNRESLT--ADDDAGLFPAFYNIEELSSPHTRGSSPLDPNHTHFILVDNGTETKFGVEIKFSVALQQYISENMETGVARNQSVNVPTVLLVLEGGENTLEMTVQSVKKFTPIVVIHGSGRAADYIALAYRKTRSVDVSEEKSVYPSNFDEEMLGHAAYMFDWSREKDPVTKEAKIKKCLDNIKLLLASRRLITVFALEDGDTSNDIDQAILQALLKANRADA----QTQLNLALAWNRCDIARREIFTPENRACWQKMNLYEAMHTALVQDRTDFVQLFLDNGVDLKRFLSIRRLRDLYDDVLSDPYSGAASD----------------LLKHLLQE--DTQFSFLCNPKDDLSVETSAYLLRSVGQLLSGMGQHSNFYAHEKYIVHDDNLGFSNAAYDTLRTPREMDSTNPFASSKKPC--KAAELSNPHRELFVWAVLLNRKDLALLFWKCGSDQIGGALFASHVLSSLSNIANSEEEIDLSQELHANADMFEELAVGVLNACYQKNKLMSHRLLVRVLPKWGDSTLLTMADSGALMHFMGHTCCQTRLNNIWMGKLALYTSSWKILAALFLPVIIPFLKFNSTDF----HSITFGEIQNVQEEEEEEEEEVGGGSKEEGLSSAVKAQPNQVVPKQVETEQCNAFTAMRKRKPPNMNIRKLYRVNFFNLFK----DSDSSINVLKAIYFYHTTPLVKFCYHTISYVIFLAVYSFFVLTDLHPERISAC------EGLVWAWSLTLIMEEIRQVWVKRAV-SLSARLASYFDSVWNRFDFMLYGLLIISIIIRYTLTEYSFLWARRIYAVNLAMFFLRFLHTFFVDRNIGPKVIMIRRMLVDLLFFISILVVFILAFGVASHSLRYPNAELSWSILKNVVYMPYWQMYGELFLEDLTGDVGPCSHNSTVYTSSEDIVRCPETEWLVLLLLAIYMIVINILLLNLLIAMFSYTFEKVQDNSEKVWRFYRYGLIYEYFDKPTLAPPIIIISHFIRLLKYCIRRKRNITDVSND--FRNIVSKDDYNKLTAFEKAGMDNFLLREQVL 1211          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. TrEMBL
Match: A0A210PMT1 (Transient receptor potential cation channel subfamily M member 3 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT05997 PE=4 SV=1)

HSP 1 Score: 467.233 bits (1201), Expect = 2.219e-137
Identity = 369/1186 (31.11%), Postives = 597/1186 (50.34%), Query Frame = 1
Query:  148 YGAIQLSGYRVIAGKNPKYVRVHKDLSNIKGEL-YKLMTNVWGFKKPKLIISLNGGAK--NMIPLNNDQKL--AFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTV-LGIGTWGATYNKEKLAMQTEDDRITYP------NYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSK------------EADCSVVQLIVEGGKNTIQTGAEALKSNIPVVVMKGSKRAADVIC-------DVVESSSDMFQDTIKLKLEEFEK---EWNITTDEEKGNFQKNLVIFYECYQIGK-VHLFNMKDFKN-NLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEININLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYF-----KEKANAHLHTAVNFIFKGTIDS-----------PEKQSLKMIGRLINQLTDNLFPQMYQEANSDSCSCCCWKSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMRYQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNIFQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXEDFKRTEYLSKFRKEQHESLDEVGFCSAIRFFYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDFIYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQVDTSYMEG---SQCLF----------GYCATPNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKLNICKNSNNGRLSV-DAFIANLIHEEDLECSGFEQQCMETYLITNQLLDLSAHDASKT 3507
            YG I+  GY      +P Y+R+  D    + EL   ++ N W    PKL+IS+ GGAK  +M P     KL   FKRGLI+ + S   WI+TGG  TGV ++VGE  ++Y +   KQ   V LG+  WG   NK+ L    ED+   +P        D +K GK   PLD  H  F++ DDGS  KFG EI+FR   E+++S             + +  V+ LIVEGG  T++T +E++K+ IPV+V++G+ RAAD I        D++      F    +  +EE      EW      +       L     C +  + + +FN+ D +N +LD AI+ A       +Q     A+L LA+ +NR+DVA   IF +  +K     +L   M TALI+N+  FV  FL  G+ ++ FLT   L +LY      K   +A L   +    K T  +            + + ++++G+ I  +  +     Y  + +D    C                          ++P          C   I  D+ + K M    +  R+        E++LFLWALL  R+++AK+FWK GKDH+G+AL+A  +   L K A  + EIE+  +       FE LA+++LS  Y+ ++   H LL+R L  +G  + L +A+ ++L++F+ H++CQT+LN++W G++  + + ++IL  +   +L   I  F  N   K  T+ +  +++     L      E     S   + P  ++ + Q              KR  Y            D +   SAI  FYTAP+TKF    ++YLAFL +FSYF+L  L+    S       IEY  + + I+ ++ E+ Q     Q ++ + K  +W SS+WN FDL +Y++F ++ ILR  +++ +F + R  +SI+L+M+++RFM+ ++V++++GPKVIMI +ML D++FF AI  + + ++G    + L+PN   +  L+R + Y PYWQ++G++    MEG   S C              CA  NAIV +  A ++L TN+LL++LLIAMF  TF KV++NS +VW F ++ ++ E+Y RP + PPF +    + F  +    + +  +L+  D F  +L   ++   + FE++ +E YL T + L     D+  T
Sbjct:  354 YGEIEFHGYGHDTESSP-YIRLAND---TQPELVLDIILNYWKLPTPKLLISVTGGAKRFDMKP-----KLLEKFKRGLINAATSTGAWIITGGTHTGVMEIVGEGVQEYVLTYGKQKDIVCLGVPLWGVIANKDAL---DEDENGNFPAIYSKEGLDAEK-GKKTIPLDHNHTHFVIVDDGSRDKFGGEIEFRANLEKTISHMSCDSEGMSSNLQVNTPVISLIVEGGVGTMKTVSESIKNGIPVLVLEGTGRAADFIAAGYLFTKDIMNEDRSHFPPHYQQTMEEIATNNFEWKPGETNKPAKISLCLKQLESCLKSRRMITVFNLGDAENKDLDKAILNALLKANKSNQ----SAQLSLALAWNRSDVARNTIFSSS-KKTIFGASLHDAMTTALIQNKKTFVKLFLENGVELKDFLTVKNLWNLYANCLNDKTDRSAQLFNNLIMYLKQTWGAYLCCRPVEHLGNQPELVELVGKTIVHIVGDEAINPYDGSKTDRFKVCD-------------------------VDP----------CMGYIVDDKATEKSMAGKKW--RHVKHDFELPERELFLWALLLNRMDLAKLFWKLGKDHLGTALLAAALLKGLAKVADGEEEIELSVSLEESALMFEKLAVDVLSHCYKHNKALAHQLLVRQLVDYGNTTLLLLADAHELMDFMDHTSCQTKLNSVWKGRMALYTSTYKILAAMVIPFLIPAI-KFTSN---KNPTEYLDDDDALDYDNLGEAMAGEGTAIISNSRVAPETESRSKQI-------------KRKLYQVSL---AGTGKDGISLVSAIYHFYTAPVTKFYWYTVAYLAFLAIFSYFVLTNLHPT--SSVNSPSNIEYVTWGWTITMVIEEVRQVLTRDQ-RSLVHKLRSWYSSVWNRFDLIMYLLFMLSVILRFVLSEDNFTWARMTYSITLAMYFLRFMQAFFVEKNIGPKVIMIRKMLTDLMFFFAILAVFVLSFGIAYQANLFPNDPPSWKLLRQVVYLPYWQMYGELFLENMEGEEPSSCTTNETLWRSGAQARCAENNAIVPLLLAVYMLLTNILLVNLLIAMFSDTFQKVQDNSLKVWRFYKFSLVYEYYERPSVFPPFIILN--HAFRGVRWLMHKSFRKLNYHDDFKLHLSARDNTRLTLFEREAVEDYLHTTRELKREQLDSKVT 1459          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. TrEMBL
Match: A0A1S3HH51 (transient receptor potential cation channel subfamily M member 2 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106154535 PE=4 SV=1)

HSP 1 Score: 452.595 bits (1163), Expect = 2.483e-132
Identity = 369/1203 (30.67%), Postives = 601/1203 (49.96%), Query Frame = 1
Query:  148 YGAIQLSGYRVIAGKNPKYVRVHKDLSNIKGELYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTV--LGIGTWGATYNKEKLAMQTEDDRITYP----NYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKEADCSV----------VQLIVEGGKNTIQTGAEALKSNIPVVVMKGSKRAAD-VICDVVESSSDM------------FQDTIKLKLEEFEKEWNITTDEEKGNFQK---NLVIFYECYQIGKVHLFNMKDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEININLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYF---------------KEKANAHLHTAVNFIFKGTIDS---PEKQSLKMIGRLINQLTDNLFPQMYQEANSDSCSCCCWKSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMRYQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNIFQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSKDFSEHRQ---KSSEKIIQPNYQNNTLQFXXXXXXXXXXEDFKRTE-YLSKFRKEQHESLDEVGFCS----------AIRFFYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDFIYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQ--VDTSYMEGSQC-----LFGYCATPNAIVQ-------VANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFN-----VFEVFYNFFKLNICKNSNNGRLSVDAFIANLIHEEDLECSGFEQQCMETYLI-TNQLLDLSAHDASK 3504
            +G I  SG+         Y+RV  D +  +  L+ L+ + W    P+LII++ GGA+    L      AFK GLI+ +     W+V+GG  TGV KLVGEA +D+S  S  ++  +  LG+ TWG   NKE L    E++   +P    + D +  G G + LDP H  +I  DDG++ K+G EIK R + E+ +S++ +  +          + L++EGG NT+QT AEA+K + PVV++ GS RAAD +IC    + S              F+D +  + +       +  +E + N +K   NL I  +  ++  V   N      ++D AI+ A       D       +L LA+ +NR DVA Q+IF    R+N   ++L P M TAL++++ +FV  FL  G+ ++ FLT S L++LY+               KEK      +  + +  G  D     +   L  IGR+IN+   +    +Y       C         +++  + N    EV + ++ +  ++           +    EE   E +                E+ L LWA+L  R E+AK+FWK GKDHIG+AL A+ +   + K A    E+++  +   +  EFE LA+ +L+E Y +D+I  H L+ R LP++G ++ + IA+  + ++F+  + CQT+LN IWLGK+    +I++I   VP  ++    F+ P+     +         S+P      K FSE R     S  +I     + N  + ++         +F R++    K RK    S  +V  C           A  +F+TAPITKF+   I Y+ FL MFSYFL+++L+ +      +  +I   ++IF  + +L E+ Q       ++   K  +W  S+WN  DL +Y +F I+ +LR T+ ++DF++ R  + ++L + ++RF++ + + + +GPKVIMI RM+ D++FF+ I L+ L AYG    +LLYPN      +++++ Y PYWQ++G   +D +  +  QC     L+     P    Q       V    ++L TNVLLL+LLIA+F  TF  +++NS  VW F R+ +I E++ RP LPPP       V  + Y   K    KNS+      D+F   L  +E  + + FE+  ME+YL+ T+Q  +  AH A+K
Sbjct:  309 FGEILFSGFGYDNKVPAPYIRV--DHTTERSTLWHLLDDYWKLPAPRLIITVTGGAQKFF-LRPRLLHAFKTGLINAATGTGAWVVSGGTNTGVMKLVGEAVRDHSFASDVESSKIIALGVATWGIISNKESLV--GEENMGCFPALYRSEDLRHGGAGTAALDPNHTHYIFVDDGTENKYGAEIKLRAKLEQYISEKVETGISKTESVPVPIILLVLEGGINTLQTVAEAVKQDTPVVIIGGSGRAADYLICGYKMTRSKEKGKEEESQYPSNFEDEMAEEAKSLFDLHGLDQEEVEKNIKKCLKNLKICLDHRKLLTVFRLNDSTSARDMDKAILYALLKANKSDA----RTQLNLALAWNRPDVARQQIFTQDNRENWQKVDLYPAMYTALVQDRLEFVHLFLDMGVDLKKFLTASKLQELYYDVLKDRFSGAGAFYLKEKVQQLQQSFASRLRSGDGDHGDLDQNSVLYNIGRVINRCVQDQQDNLYASQKPGMCENQPSAEAGLAEDMT-NQRYTEVNEVDERVNTISQCAPGAKMKKKRTKLKEEQKCEFERP--------------EKHLMLWAVLLNRKELAKLFWKMGKDHIGAALFASAILKRMSKDAAGDEEVDLAEDLKNHGVEFEELAVGVLNECYSKDKILGHRLVTRQLPHFGHDTVMTIADTARQMHFMEQACCQTKLNMIWLGKMVQHTSIWKI---VPSLFIP---FVIPFIKFRIK---------SKP-----LKSFSEVRGIDLGSVNRIAPEAEKKNGDEEEENSDPDGDGVEFTRSKTRREKNRKGAKHSYFQVNCCGLDKDSISIFRAFYYFHTAPITKFLYQQIMYIVFLCMFSYFLMVDLHPMNTPDNLHIWEI--FVWIFSGTSILEEVRQVLTKDS-RSLWYKLADWWKSVWNKLDLIMYTLFIISVVLRFTLTEADFVHARRAYCLTLILHFVRFLQGFMIHKDMGPKVIMIRRMITDVIFFVMILLVFLLAYGVAVQALLYPNHKRDWSILKDVVYIPYWQMYGDLFLDETSGKIDQCTSNATLYLQDNGPQMCPQQNEWMTIVLMVIYMLLTNVLLLNLLIAIFNYTFQNIQDNSLTVWRFYRFGLIYEYHDRPPLPPPAIIISHIVRGIMYIVKKCRGIKNSD------DSFKRVLSVDEQEKLTVFEKAGMESYLLRTHQ--ENEAHMANK 1456          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. TrEMBL
Match: A0A1S3HED0 (transient receptor potential cation channel subfamily M member 2 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106154535 PE=4 SV=1)

HSP 1 Score: 447.203 bits (1149), Expect = 2.676e-130
Identity = 374/1211 (30.88%), Postives = 599/1211 (49.46%), Query Frame = 1
Query:  148 YGAIQLSGYRVIAGKNPKYVRVHKDLSNIKGELYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTV--LGIGTWGATYNKEKLAMQTEDDRITYP----NYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKEADCSV----------VQLIVEGGKNTIQTGAEALKSNIPVVVMKGSKRAAD-VICDVVESSSDMFQDTIKLKLEE------FEKEWNITTDEEKGNFQ-----------------KNLVIFYECYQIGKVHLFNMKDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEININLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYF---------------KEKANAHLHTAVNFIFKGTIDS---PEKQSLKMIGRLINQLTDNLFPQMYQEANSDSCSCCCWKSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMRYQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNIFQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSKDFSEHRQ---KSSEKIIQPNYQNNTLQFXXXXXXXXXXEDFKRTE-YLSKFRKEQHESLDEVGFCS----------AIRFFYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDFIYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQ--VDTSYMEGSQC-----LFGYCATPNAIVQ-------VANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFN-----VFEVFYNFFKLNICKNSNNGRLSVDAFIANLIHEEDLECSGFEQQCMETYLI-TNQLLDLSAHDASK 3504
            +G I  SG+         Y+RV  D +     L+ L+ + W    P+LII++ GGA+    L      AFK GLI+ +     W+V+GG  TGV KLVGEA +D+S  S  ++  +  LG+ TWG   NKE L    E++   +P    + D +  G G + LDP H  +I  D+G++ K+G EIK R + E+ +S++ +  +          + L++EGG NT+QT AEA+K + PVV++ GS RAAD +IC        M +   K K EE      FE E     +E K  F                  KNL I  +  ++  V   N      ++D AI+ A       D       +L LA+ +NR DVA Q+IF    R+N   ++L P M TAL++++ +FV  FL  G+ ++ FLT S L++LY+               KEK      +  + +  G  D     +   L  IGR+IN+   +    +Y       C         +++  + N    EV + ++ +  ++           +    EE   E +                E+ L LWA+L  R E+AK+FWK GKDHIG+AL A+ +   + K A    E+++  +   +  EFE LA+ +L+E Y +D+I  H L+ R LP++G ++ + IA+  + ++F+  + CQT+LN IWLGK+    +I++I   VP  ++    F+ P+     +         S+P      K FSE R     S  +I     + N  + ++         +F R++    K RK    S  +V  C           A  +F+TAPITKF+   I Y+ FL MFSYFL+++L+ +      +  +I   ++IF  + +L E+ Q       ++   K  +W  S+WN  DL +Y +F I+ +LR T+ ++DF++ R  + ++L + ++RF++ + + + +GPKVIMI RM+ D++FF+ I L+ L AYG    +LLYPN      +++++ Y PYWQ++G   +D +  +  QC     L+     P    Q       V    ++L TNVLLL+LLIA+F  TF  +++NS  VW F R+ +I E++ RP LPPP       V  + Y   K    KNS+      D+F   L  +E  + + FE+  ME+YL+ T+Q  +  AH A+K
Sbjct:  309 FGEILFSGFGYDNKVPAPYIRV--DHTTELSTLWHLLDDYWKLPAPRLIITVTGGAQKFF-LRPRLLHAFKTGLINAATGTGAWVVSGGTNTGVMKLVGEAVRDHSFASDVESSKIIALGVATWGIISNKESLV--GEENMGCFPALYRSEDLRNGGAGTAALDPNHTHYIFVDNGTENKYGAEIKLRAKLEQYISEQVETGISITESVPVPIILLVLEGGINTLQTVAEAVKQDTPVVIIGGSGRAADYLIC-----GYKMTRSKEKGKEEESQYPSNFEDE---MAEEAKSLFDLHGLDQEEVEKIIKKCLKNLKICLDHRKLLTVFRLNDSTSARDMDKAILYALLKANKSDA----RTQLNLALAWNRPDVARQQIFTQDNRENWQKVDLYPAMYTALVQDRLEFVHLFLDMGVDLKKFLTASKLQELYYDVLKDRFSGAGAFYLKEKVQQLQQSFASRLRSGDGDHGDLDQNSVLYNIGRVINRCVQDQQDNLYASQKPGMCENQPSAEAGLAEDMT-NQRYTEVNEVDERVNTISQCAPGAKMKKKRTKLKEEQKCEFERP--------------EKHLMLWAVLLNRKELAKLFWKMGKDHIGAALFASAILKRMSKDAAGDEEVDLAEDLKNHGVEFEELAVGVLNECYSKDKILGHRLVTRQLPHFGHDTVMTIADTARQMHFMEQACCQTKLNMIWLGKMVQHTSIWKI---VPSLFIP---FVIPFIKFRIK---------SKP-----LKSFSEVRGIDLGSVNRIAPEAEKKNGDEEEENSDPDGDGVEFTRSKTRREKNRKGAKHSYFQVNCCGLDKDSISIFRAFYYFHTAPITKFLYQQIMYIVFLCMFSYFLMVDLHPMNTPDNLHIWEI--FVWIFSGTSILEEVRQVLTKDS-RSLWYKLADWWKSVWNKLDLIMYTLFIISVVLRFTLTEADFVHARRAYCLTLILHFVRFLQGFMIHKDMGPKVIMIRRMITDVIFFVMILLVFLLAYGVAVQALLYPNHKRDWSILKDVVYIPYWQMYGDLFLDETSGKIDQCTSNATLYLQDNGPQMCPQQNEWMTIVLMVIYMLLTNVLLLNLLIAIFNYTFQNIQDNSLTVWRFYRFGLIYEYHDRPPLPPPAIIISHIVRGIMYIVKKCRGIKNSD------DSFKRVLSVDEQEKLTVFEKAGMESYLLRTHQ--ENEAHMANK 1456          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Cavefish
Match: trpm7 (transient receptor potential cation channel subfamily M member 7 [Source:NCBI gene;Acc:111197571])

HSP 1 Score: 318.161 bits (814), Expect = 7.026e-89
Identity = 292/1147 (25.46%), Postives = 537/1147 (46.82%), Query Frame = 1
Query:  148 YGAIQLSG----YRVIAGKNPKYVRVHKDLSNIKGELYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKE-------ADCSVVQLIVEGGKNTIQTGAEALKSN--IPVVVMKGSKRAADVICDVVESSSD--MFQDTIKLKL-EEFEKEWNITTDEEKGNFQKNLVIFYECYQIGK-VHLFNM-KDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEININ-LRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKA--NAHLHTAVNFIFKGTIDSPEKQSLKMIGRLINQL---------TDNLFPQMYQ--EANSDSCSCCCWKSPKISDSQ---SFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMR-YQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNI-FQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXEDFKRTEYLSKFRKEQHESLDEVGFCSAIRFFYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFM--GGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDFIYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQV-----DTSYMEGSQCLFGYCATPNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKLNICKNSNNGRLSVDAFIANLIHEEDLECSGFEQQCMETY 3456
            YG I   G    YR       KYVR+  D  +    + +LM   W  + PK++IS++GG +N   L+   K    +GLI  + +   WI+TGG  TGV+K VG+A K++S  S ++  T+ GI  WG   N+  L  +     +  P           + L+  H  FIL D+G+  K+G E+  R + E+ ++ +           VV LI EGG N I T  E L+ +  +PVVV +G+ RAAD++  V + + D     D ++  +    +K +N++ ++    FQ       EC +  + + +F++  +   ++D AI++A   GT  D    D+  L L + ++R D+A+  +F   V   ++ ++ L   M  AL+ ++  FV   +  G+++  FLT S L +LY  +++  N +L   V  + +G +    K +L  +G +I  L         T   F  +Y     N+          P +  +    S      E   +  +I+    +P        K+   + S +E+     P   + ++  Y   +L +WA+L +R +M+  FW+ G++ +  ALVA  +C S+  +A     ++  +  ++ Y  EF TLA+++L +++R+D++ +  LL   L  W   +CL +A  ++L  F+ H+  Q  L+++W+ ++    N  +++++++    +   I    Y    K + +      S+   ++  +D SEH  ++ + I    ++   +            E    TE +++ R+        +        FY API KF  N + YL FL ++SY +L++L  I  SP       E+ + ++  +  + +I + FM  GG++     K   W S  +N  D    ++F + + LR    +  FI  R ++ +++  +Y+R ++   V Q  GP V+MI +M+ ++ + + I  + L  YG    ++LYPN      L+ ++ + PYW ++G+V     D         +   C T   +     A +L    +L+++LLIA F   +++V   SN VW + RY  I  ++ +P+LPPP  +F    +F      +   +       F   L  E+  +   FE+QC+ETY
Sbjct:   70 YGIINFQGGSHSYRA------KYVRLSHD--SRPEAILRLMLKEWQMELPKIVISVHGGIQNF-DLHPRIKQVVGKGLIKAAVTTGAWILTGGVNTGVAKHVGDALKEHSSRSARKICTI-GIAPWGVIENRNDLIGRD----VVAPYQTLLNPLSKLNVLNNLHSHFILVDNGTVGKYGAEVNLRRDLEKHINLQRIHARIGQGVPVVALIFEGGPNVILTVLEYLQESPPVPVVVCEGTGRAADILSFVHKQTEDDGGLPDGVETDIIATVKKTFNLSQNDAVHLFQ----TLMECMKNKELITVFHVGSEDHQDIDVAILKALLKGT--DASAFDQ--LVLTLAWDRVDIAKDHVF---VYGQKLLVDSLEQAMLDALVMDRVDFVKLLIENGVSMHRFLTISRLEELYNTKQSPTNPNLFQLVRDVKQGNLPPNYKITLIDVGLVIEYLMGGTYRCNYTRKRFRIIYNNLHGNNRRSGRAPSSGPPLRKNHEPFSIQADKKEKTRHNHFIK--TAQPYKP-----KVEKQKRSREEVVDIDDP---ETRRFPYPFNELLVWAVLMKRQKMSLFFWQHGEESMAKALVACKLCRSMCYEAKKSDVVDDTSEELKEYSNEFGTLAVDLLEQSFRQDELMSMKLLTYELKNWSNSTCLKLAVSSRLRPFVAHTCTQMLLSDMWMERLNMRKNSWYKVILSI---LVPPAILALEY----KSKAEMAHIPQSQDAHQMTMED-SEHNLQNPDDIQMDVFKETRIN--------DHVEVKHETEVVTRSRR--------LPIMRKFHAFYHAPIVKFWTNTLFYLVFLMLYSYVVLVKL-PIFPSPQ------EWAVILYIFTSAIEKIREMFMSEGGKISQ---KIKVWFSDYFNRSDFIAIVMFAVGFGLRFGSGNV-FIAGRLIYCLNIIFWYVRLLDILAVNQQAGPYVMMIGKMVANMFYIVVIMCVVLVTYGVPRKAILYPNSEAEWSLIIDVVFQPYWMMYGEVYAYEIDVCANSTENNMDHLCTTGVWLTPALQAVYLFIQYILMVNLLIAFFNNVYLQVMSISNLVWKYQRYHFIMAYHDKPVLPPPLIIFYHISSFLSFLCKRRKKDSAYGPKLF---LTEEDQKKLHDFEEQCVETY 1143          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Cavefish
Match: trpm7 (transient receptor potential cation channel subfamily M member 7 [Source:NCBI gene;Acc:111197571])

HSP 1 Score: 316.235 bits (809), Expect = 4.113e-88
Identity = 288/1150 (25.04%), Postives = 535/1150 (46.52%), Query Frame = 1
Query:  148 YGAIQLSG----YRVIAGKNPKYVRVHKDLSNIKGELYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKE-------ADCSVVQLIVEGGKNTIQTGAEALKSN--IPVVVMKGSKRAADVICDVVESSSD--MFQDTIKLKL-EEFEKEWNITTDEEKGNFQKNLVIFYECYQIGK-VHLFNM-KDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEININ-LRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKA--NAHLHTAVNFIFKGTIDSPEKQSLKMIGRLINQLT-----------------DNLFPQMYQEANSDSCSCCCWKSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMR-YQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNI-FQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXEDFKRTEYLSKFRKEQHESLDEVGFCSAIRFFYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFM--GGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDFIYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQV-----DTSYMEGSQCLFGYCATPNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKLNICKNSNNGRLSVDAFIANLIHEEDLECSGFEQQCMETY 3456
            YG I   G    YR       KYVR+  D  +    + +LM   W  + PK++IS++GG +N   L+   K    +GLI  + +   WI+TGG  TGV+K VG+A K++S  S ++  T+ GI  WG   N+  L  +     +  P           + L+  H  FIL D+G+  K+G E+  R + E+ ++ +           VV LI EGG N I T  E L+ +  +PVVV +G+ RAAD++  V + + D     D ++  +    +K +N++ ++    FQ       EC +  + + +F++  +   ++D AI++A   GT  D    D+  L L + ++R D+A+  +F   V   ++ ++ L   M  AL+ ++  FV   +  G+++  FLT S L +LY  +++  N +L   V  + +G +    K +L  +G +I  L                  +NL     +   + S      K+ +    Q+          + K  +P   +         + + D +  +  +  V     + ++  Y   +L +WA+L +R +M+  FW+ G++ +  ALVA  +C S+  +A     ++  +  ++ Y  EF TLA+++L +++R+D++ +  LL   L  W   +CL +A  ++L  F+ H+  Q  L+++W+ ++    N  +++++++    +   I    Y    K + +      S+   ++  +D SEH  ++ + I    ++   +            E    TE +++ R+        +        FY API KF  N + YL FL ++SY +L++L  I  SP       E+ + ++  +  + +I + FM  GG++     K   W S  +N  D    ++F + + LR    +  FI  R ++ +++  +Y+R ++   V Q  GP V+MI +M+ ++ + + I  + L  YG    ++LYPN      L+ ++ + PYW ++G+V     D         +   C T   +     A +L    +L+++LLIA F   +++V   SN VW + RY  I  ++ +P+LPPP  +F    +F      +   +       F   L  E+  +   FE+QC+ETY
Sbjct:   91 YGIINFQGGSHSYRA------KYVRLSHD--SRPEAILRLMLKEWQMELPKIVISVHGGIQNF-DLHPRIKQVVGKGLIKAAVTTGAWILTGGVNTGVAKHVGDALKEHSSRSARKICTI-GIAPWGVIENRNDLIGRD----VVAPYQTLLNPLSKLNVLNNLHSHFILVDNGTVGKYGAEVNLRRDLEKHINLQRIHARIGQGVPVVALIFEGGPNVILTVLEYLQESPPVPVVVCEGTGRAADILSFVHKQTEDDGGLPDGVETDIIATVKKTFNLSQNDAVHLFQ----TLMECMKNKELITVFHVGSEDHQDIDVAILKALLKGT--DASAFDQ--LVLTLAWDRVDIAKDHVF---VYGQKLLVDSLEQAMLDALVMDRVDFVKLLIENGVSMHRFLTISRLEELYNTKQSPTNPNLFQLVRDVKQGNLPPNYKITLIDVGLVIEYLMGGTYRCNYTRKRFRIIYNNLHGNNRRSGRAPSSGPPLRKNHEPFSIQADKKEKTRHNHFIKTAQPYKPK--------LESSSDLQQKRSREEVVDIDDPETRRFPYPFNELLVWAVLMKRQKMSLFFWQHGEESMAKALVACKLCRSMCYEAKKSDVVDDTSEELKEYSNEFGTLAVDLLEQSFRQDELMSMKLLTYELKNWSNSTCLKLAVSSRLRPFVAHTCTQMLLSDMWMERLNMRKNSWYKVILSI---LVPPAILALEY----KSKAEMAHIPQSQDAHQMTMED-SEHNLQNPDDIQMDVFKETRIN--------DHVEVKHETEVVTRSRR--------LPIMRKFHAFYHAPIVKFWTNTLFYLVFLMLYSYVVLVKL-PIFPSPQ------EWAVILYIFTSAIEKIREMFMSEGGKISQ---KIKVWFSDYFNRSDFIAIVMFAVGFGLRFGSGNV-FIAGRLIYCLNIIFWYVRLLDILAVNQQAGPYVMMIGKMVANMFYIVVIMCVVLVTYGVPRKAILYPNSEAEWSLIIDVVFQPYWMMYGEVYAYEIDVCANSTENNMDHLCTTGVWLTPALQAVYLFIQYILMVNLLIAFFNNVYLQVMSISNLVWKYQRYHFIMAYHDKPVLPPPLIIFYHISSFLSFLCKRRKKDSAYGPKLF---LTEEDQKKLHDFEEQCVETY 1169          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Cavefish
Match: trpm7 (transient receptor potential cation channel subfamily M member 7 [Source:NCBI gene;Acc:111197571])

HSP 1 Score: 315.849 bits (808), Expect = 4.518e-88
Identity = 290/1147 (25.28%), Postives = 536/1147 (46.73%), Query Frame = 1
Query:  148 YGAIQLSG----YRVIAGKNPKYVRVHKDLSNIKGELYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKE-------ADCSVVQLIVEGGKNTIQTGAEALKSN--IPVVVMKGSKRAADVICDVVESSSD--MFQDTIKLKL-EEFEKEWNITTDEEKGNFQKNLVIFYECYQIGK-VHLFNM-KDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEININ-LRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKA--NAHLHTAVNFIFKGTIDSPEKQSLKMIGRLINQL---------TDNLFPQMYQ--EANSDSCSCCCWKSPKISDSQ---SFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMR-YQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNI-FQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXEDFKRTEYLSKFRKEQHESLDEVGFCSAIRFFYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFM--GGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDFIYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQV-----DTSYMEGSQCLFGYCATPNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKLNICKNSNNGRLSVDAFIANLIHEEDLECSGFEQQCMETY 3456
            YG I   G    YR       KYVR+  D  +    + +LM   W  + PK++IS++GG +N   L+   K    +GLI  + +   WI+TGG  TGV+K VG+A K++S  S ++  T+ GI  WG   N+  L  +     +  P           + L+  H  FIL D+G+  K+G E+  R + E+ ++ +           VV LI EGG N I T  E L+ +  +PVVV +G+ RAAD++  V + + D     D ++  +    +K +N++ ++    FQ       EC +  + + +F++  +   ++D AI++A   GT  D    D+  L L + ++R D+A+  +F   V   ++ ++ L   M  AL+ ++  FV   +  G+++  FLT S L +LY  +++  N +L   V  + +G +    K +L  +G +I  L         T   F  +Y     N+          P +  +    S      E   +  +I+    +P        + + D +  +  +  V     + ++  Y   +L +WA+L +R +M+  FW+ G++ +  ALVA  +C S+  +A     ++  +  ++ Y  EF TLA+++L +++R+D++ +  LL   L  W   +CL +A  ++L  F+ H+  Q  L+++W+ ++    N  +++++++    +   I    Y    K + +      S+   ++  +D SEH  ++ + I    ++   +            E    TE +++ R+        +        FY API KF  N + YL FL ++SY +L++L  I  SP       E+ + ++  +  + +I + FM  GG++     K   W S  +N  D    ++F + + LR    +  FI  R ++ +++  +Y+R ++   V Q  GP V+MI +M+ ++ + + I  + L  YG    ++LYPN      L+ ++ + PYW ++G+V     D         +   C T   +     A +L    +L+++LLIA F   +++V   SN VW + RY  I  ++ +P+LPPP  +F    +F      +   +       F   L  E+  +   FE+QC+ETY
Sbjct:  108 YGIINFQGGSHSYRA------KYVRLSHD--SRPEAILRLMLKEWQMELPKIVISVHGGIQNF-DLHPRIKQVVGKGLIKAAVTTGAWILTGGVNTGVAKHVGDALKEHSSRSARKICTI-GIAPWGVIENRNDLIGRD----VVAPYQTLLNPLSKLNVLNNLHSHFILVDNGTVGKYGAEVNLRRDLEKHINLQRIHARIGQGVPVVALIFEGGPNVILTVLEYLQESPPVPVVVCEGTGRAADILSFVHKQTEDDGGLPDGVETDIIATVKKTFNLSQNDAVHLFQ----TLMECMKNKELITVFHVGSEDHQDIDVAILKALLKGT--DASAFDQ--LVLTLAWDRVDIAKDHVF---VYGQKLLVDSLEQAMLDALVMDRVDFVKLLIENGVSMHRFLTISRLEELYNTKQSPTNPNLFQLVRDVKQGNLPPNYKITLIDVGLVIEYLMGGTYRCNYTRKRFRIIYNNLHGNNRRSGRAPSSGPPLRKNHEPFSIQADKKEKTRHNHFIK--TAQPYKPK---LESSSDLQQKRSREEVVDIDDPETRRFPYPFNELLVWAVLMKRQKMSLFFWQHGEESMAKALVACKLCRSMCYEAKKSDVVDDTSEELKEYSNEFGTLAVDLLEQSFRQDELMSMKLLTYELKNWSNSTCLKLAVSSRLRPFVAHTCTQMLLSDMWMERLNMRKNSWYKVILSI---LVPPAILALEY----KSKAEMAHIPQSQDAHQMTMED-SEHNLQNPDDIQMDVFKETRIN--------DHVEVKHETEVVTRSRR--------LPIMRKFHAFYHAPIVKFWTNTLFYLVFLMLYSYVVLVKL-PIFPSPQ------EWAVILYIFTSAIEKIREMFMSEGGKISQ---KIKVWFSDYFNRSDFIAIVMFAVGFGLRFGSGNV-FIAGRLIYCLNIIFWYVRLLDILAVNQQAGPYVMMIGKMVANMFYIVVIMCVVLVTYGVPRKAILYPNSEAEWSLIIDVVFQPYWMMYGEVYAYEIDVCANSTENNMDHLCTTGVWLTPALQAVYLFIQYILMVNLLIAFFNNVYLQVMSISNLVWKYQRYHFIMAYHDKPVLPPPLIIFYHISSFLSFLCKRRKKDSAYGPKLF---LTEEDQKKLHDFEEQCVETY 1186          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Cavefish
Match: trpm7 (transient receptor potential cation channel subfamily M member 7 [Source:NCBI gene;Acc:111197571])

HSP 1 Score: 315.464 bits (807), Expect = 5.680e-88
Identity = 290/1147 (25.28%), Postives = 536/1147 (46.73%), Query Frame = 1
Query:  148 YGAIQLSG----YRVIAGKNPKYVRVHKDLSNIKGELYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKE-------ADCSVVQLIVEGGKNTIQTGAEALKSN--IPVVVMKGSKRAADVICDVVESSSD--MFQDTIKLKL-EEFEKEWNITTDEEKGNFQKNLVIFYECYQIGK-VHLFNM-KDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEININ-LRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKA--NAHLHTAVNFIFKGTIDSPEKQSLKMIGRLINQL---------TDNLFPQMYQ--EANSDSCSCCCWKSPKISDSQ---SFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMR-YQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNI-FQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXEDFKRTEYLSKFRKEQHESLDEVGFCSAIRFFYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFM--GGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDFIYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQV-----DTSYMEGSQCLFGYCATPNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKLNICKNSNNGRLSVDAFIANLIHEEDLECSGFEQQCMETY 3456
            YG I   G    YR       KYVR+  D  +    + +LM   W  + PK++IS++GG +N   L+   K    +GLI  + +   WI+TGG  TGV+K VG+A K++S  S ++  T+ GI  WG   N+  L  +     +  P           + L+  H  FIL D+G+  K+G E+  R + E+ ++ +           VV LI EGG N I T  E L+ +  +PVVV +G+ RAAD++  V + + D     D ++  +    +K +N++ ++    FQ       EC +  + + +F++  +   ++D AI++A   GT  D    D+  L L + ++R D+A+  +F   V   ++ ++ L   M  AL+ ++  FV   +  G+++  FLT S L +LY  +++  N +L   V  + +G +    K +L  +G +I  L         T   F  +Y     N+          P +  +    S      E   +  +I+    +P        + + D +  +  +  V     + ++  Y   +L +WA+L +R +M+  FW+ G++ +  ALVA  +C S+  +A     ++  +  ++ Y  EF TLA+++L +++R+D++ +  LL   L  W   +CL +A  ++L  F+ H+  Q  L+++W+ ++    N  +++++++    +   I    Y    K + +      S+   ++  +D SEH  ++ + I    ++   +            E    TE +++ R+        +        FY API KF  N + YL FL ++SY +L++L  I  SP       E+ + ++  +  + +I + FM  GG++     K   W S  +N  D    ++F + + LR    +  FI  R ++ +++  +Y+R ++   V Q  GP V+MI +M+ ++ + + I  + L  YG    ++LYPN      L+ ++ + PYW ++G+V     D         +   C T   +     A +L    +L+++LLIA F   +++V   SN VW + RY  I  ++ +P+LPPP  +F    +F      +   +       F   L  E+  +   FE+QC+ETY
Sbjct:   91 YGIINFQGGSHSYRA------KYVRLSHD--SRPEAILRLMLKEWQMELPKIVISVHGGIQNF-DLHPRIKQVVGKGLIKAAVTTGAWILTGGVNTGVAKHVGDALKEHSSRSARKICTI-GIAPWGVIENRNDLIGRD----VVAPYQTLLNPLSKLNVLNNLHSHFILVDNGTVGKYGAEVNLRRDLEKHINLQRIHARIGQGVPVVALIFEGGPNVILTVLEYLQESPPVPVVVCEGTGRAADILSFVHKQTEDDGGLPDGVETDIIATVKKTFNLSQNDAVHLFQ----TLMECMKNKELITVFHVGSEDHQDIDVAILKALLKGT--DASAFDQ--LVLTLAWDRVDIAKDHVF---VYGQKLLVDSLEQAMLDALVMDRVDFVKLLIENGVSMHRFLTISRLEELYNTKQSPTNPNLFQLVRDVKQGNLPPNYKITLIDVGLVIEYLMGGTYRCNYTRKRFRIIYNNLHGNNRRSGRAPSSGPPLRKNHEPFSIQADKKEKTRHNHFIK--TAQPYKPK---LESSSDLQQKRSREEVVDIDDPETRRFPYPFNELLVWAVLMKRQKMSLFFWQHGEESMAKALVACKLCRSMCYEAKKSDVVDDTSEELKEYSNEFGTLAVDLLEQSFRQDELMSMKLLTYELKNWSNSTCLKLAVSSRLRPFVAHTCTQMLLSDMWMERLNMRKNSWYKVILSI---LVPPAILALEY----KSKAEMAHIPQSQDAHQMTMED-SEHNLQNPDDIQMDVFKETRIN--------DHVEVKHETEVVTRSRR--------LPIMRKFHAFYHAPIVKFWTNTLFYLVFLMLYSYVVLVKL-PIFPSPQ------EWAVILYIFTSAIEKIREMFMSEGGKISQ---KIKVWFSDYFNRSDFIAIVMFAVGFGLRFGSGNV-FIAGRLIYCLNIIFWYVRLLDILAVNQQAGPYVMMIGKMVANMFYIVVIMCVVLVTYGVPRKAILYPNSEAEWSLIIDVVFQPYWMMYGEVYAYEIDVCANSTENNMDHLCTTGVWLTPALQAVYLFIQYILMVNLLIAFFNNVYLQVMSISNLVWKYQRYHFIMAYHDKPVLPPPLIIFYHISSFLSFLCKRRKKDSAYGPKLF---LTEEDQKKLHDFEEQCVETY 1169          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Cavefish
Match: trpm7 (transient receptor potential cation channel subfamily M member 7 [Source:NCBI gene;Acc:111197571])

HSP 1 Score: 315.464 bits (807), Expect = 5.780e-88
Identity = 288/1150 (25.04%), Postives = 535/1150 (46.52%), Query Frame = 1
Query:  148 YGAIQLSG----YRVIAGKNPKYVRVHKDLSNIKGELYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKE-------ADCSVVQLIVEGGKNTIQTGAEALKSN--IPVVVMKGSKRAADVICDVVESSSD--MFQDTIKLKL-EEFEKEWNITTDEEKGNFQKNLVIFYECYQIGK-VHLFNM-KDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEININ-LRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKA--NAHLHTAVNFIFKGTIDSPEKQSLKMIGRLINQLT-----------------DNLFPQMYQEANSDSCSCCCWKSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMR-YQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNI-FQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXEDFKRTEYLSKFRKEQHESLDEVGFCSAIRFFYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFM--GGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDFIYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQV-----DTSYMEGSQCLFGYCATPNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKLNICKNSNNGRLSVDAFIANLIHEEDLECSGFEQQCMETY 3456
            YG I   G    YR       KYVR+  D  +    + +LM   W  + PK++IS++GG +N   L+   K    +GLI  + +   WI+TGG  TGV+K VG+A K++S  S ++  T+ GI  WG   N+  L  +     +  P           + L+  H  FIL D+G+  K+G E+  R + E+ ++ +           VV LI EGG N I T  E L+ +  +PVVV +G+ RAAD++  V + + D     D ++  +    +K +N++ ++    FQ       EC +  + + +F++  +   ++D AI++A   GT  D    D+  L L + ++R D+A+  +F   V   ++ ++ L   M  AL+ ++  FV   +  G+++  FLT S L +LY  +++  N +L   V  + +G +    K +L  +G +I  L                  +NL     +   + S      K+ +    Q+          + K  +P   +         + + D +  +  +  V     + ++  Y   +L +WA+L +R +M+  FW+ G++ +  ALVA  +C S+  +A     ++  +  ++ Y  EF TLA+++L +++R+D++ +  LL   L  W   +CL +A  ++L  F+ H+  Q  L+++W+ ++    N  +++++++    +   I    Y    K + +      S+   ++  +D SEH  ++ + I    ++   +            E    TE +++ R+        +        FY API KF  N + YL FL ++SY +L++L  I  SP       E+ + ++  +  + +I + FM  GG++     K   W S  +N  D    ++F + + LR    +  FI  R ++ +++  +Y+R ++   V Q  GP V+MI +M+ ++ + + I  + L  YG    ++LYPN      L+ ++ + PYW ++G+V     D         +   C T   +     A +L    +L+++LLIA F   +++V   SN VW + RY  I  ++ +P+LPPP  +F    +F      +   +       F   L  E+  +   FE+QC+ETY
Sbjct:  101 YGIINFQGGSHSYRA------KYVRLSHD--SRPEAILRLMLKEWQMELPKIVISVHGGIQN-FDLHPRIKQVVGKGLIKAAVTTGAWILTGGVNTGVAKHVGDALKEHSSRSARKICTI-GIAPWGVIENRNDLIGRD----VVAPYQTLLNPLSKLNVLNNLHSHFILVDNGTVGKYGAEVNLRRDLEKHINLQRIHARIGQGVPVVALIFEGGPNVILTVLEYLQESPPVPVVVCEGTGRAADILSFVHKQTEDDGGLPDGVETDIIATVKKTFNLSQNDAVHLFQ----TLMECMKNKELITVFHVGSEDHQDIDVAILKALLKGT--DASAFDQ--LVLTLAWDRVDIAKDHVF---VYGQKLLVDSLEQAMLDALVMDRVDFVKLLIENGVSMHRFLTISRLEELYNTKQSPTNPNLFQLVRDVKQGNLPPNYKITLIDVGLVIEYLMGGTYRCNYTRKRFRIIYNNLHGNNRRSGRAPSSGPPLRKNHEPFSIQADKKEKTRHNHFIKTAQPYKPK--------LESSSDLQQKRSREEVVDIDDPETRRFPYPFNELLVWAVLMKRQKMSLFFWQHGEESMAKALVACKLCRSMCYEAKKSDVVDDTSEELKEYSNEFGTLAVDLLEQSFRQDELMSMKLLTYELKNWSNSTCLKLAVSSRLRPFVAHTCTQMLLSDMWMERLNMRKNSWYKVILSI---LVPPAILALEY----KSKAEMAHIPQSQDAHQMTMED-SEHNLQNPDDIQMDVFKETRIN--------DHVEVKHETEVVTRSRR--------LPIMRKFHAFYHAPIVKFWTNTLFYLVFLMLYSYVVLVKL-PIFPSPQ------EWAVILYIFTSAIEKIREMFMSEGGKISQ---KIKVWFSDYFNRSDFIAIVMFAVGFGLRFGSGNV-FIAGRLIYCLNIIFWYVRLLDILAVNQQAGPYVMMIGKMVANMFYIVVIMCVVLVTYGVPRKAILYPNSEAEWSLIIDVVFQPYWMMYGEVYAYEIDVCANSTENNMDHLCTTGVWLTPALQAVYLFIQYILMVNLLIAFFNNVYLQVMSISNLVWKYQRYHFIMAYHDKPVLPPPLIIFYHISSFLSFLCKRRKKDSAYGPKLF---LTEEDQKKLHDFEEQCVETY 1179          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Sea Lamprey
Match: trpm7 (transient receptor potential cation channel, subfamily M, member 7 [Source:ZFIN;Acc:ZDB-GENE-021115-2])

HSP 1 Score: 266.929 bits (681), Expect = 2.127e-74
Identity = 263/1050 (25.05%), Postives = 475/1050 (45.24%), Query Frame = 1
Query:  199 KYVRVHKDLSNIKGELYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKEA-------DCSVVQLIVEGGKNTIQTGAEAL--KSNIPVVVMKGSKRAADVICDVVESSSDMFQDTIKLKLEEFEKEWNITTDEEKGNFQKNLVIFYECYQIGK-VHLFNM-KDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIF---ENQVRKNEININLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKANAHLHTAVNFIFKGTIDSPEKQSLKMI--GRLINQLTDNLFPQMYQEANSDSCSCCCWKSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMRY---QEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVN-IFQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSKDFSEHRQKSSEKI-----IQPNYQNNTLQFXXXXXXXXXXEDFKRTE-YLSKFRKEQHESLDEVGFCSAIRF--FYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFMGGQVKNFISKFNNWKSSMWNWFD-LGIYIVFTIAYILRNTVNDSDFIYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQVDTSYME-GSQCLFGYCATPNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYR 3258
            +Y RV  D  +    L +LM   W  + P+L+IS++GG +N   L+   K  F +GLI  + +   WI TGG  TGV   VG A K+++  S  +  T+ GI  WG   N+  L  Q  D  +  P           + L+  H  FIL DDG+  K+G E + R E E+ ++  A          VV L+ EGG N I T  E L  +  +PVVV +G+ RAAD++  + +++ D  +    L  +E       T +   G     L    EC +  + + +F+   +  +++D AI+ A   GT          +L LA+ ++R D+A+  +F   ++ + + E     RP ++ AL+ ++  FV   +  G+++  FLT + L +LY    ++ H  + +  +       P    + +I  G +I  L    F  MY             K  ++     +      V +  +  + ++T               + S  E     YP             +L  WA+L +R  MA  FW+ G++ +  ALVA  +  SL  +A    E E+   W R    + +F  LA+++L +++R+D+     LL   L  W   +CL +A  ++   F+ H+  Q  L ++W+G++    N  F++++++    +   I +  Y    K + +      SE   + + ++  EHR  ++  I     +        L F      L+   +    +   S  ++E+   +   G   + R   FY API KF  N ++Y+ FL +F+Y +L++L  +   P+      E+ + ++     +  + + FM  +   F  K   W    WN  D LGI ++F +A  LR+       I  + ++S+ +  +Y+R ++ + V Q+VGP ++MI +M+      + I  I L ++G    ++L+   + +  L RNI + PYW +FG+V    ++  +   +  C T   I     A +L    +++++LLIA F   +++ +  S+++W F RY 
Sbjct:    1 QYARVSYD--SRPDLLLQLMVKEWQMELPRLLISVHGGLQN-FELHPKLKQVFSKGLIKAALTTGAWIFTGGVNTGVVNHVGNALKEHASRSSHKICTI-GIAPWGVIENRGDLVGQ--DSHVVSPYQTLSNPLSKLNLLNSLHSHFILVDDGTVGKYGAEAQLRRELEKHIATVACRAGMGQGVPVVGLVAEGGPNVIVTVLEYLLEEPPVPVVVCEGTGRAADILAFLHKNTDDTGELCDGLH-DEIVGTIKKTFNFSHGQAMHLLQTLLECMRRKELITVFHTGSEDHSDVDLAILTALLKGT----NFSSADQLNLALAWDRVDIAKNHVFVYGQHWMVRLEWARWRRPMLD-ALVMDRVDFVKLLIENGVSMHKFLTITRLEELY--NTSDHHQMSNLRILLHRFSHLPPDYKITLIDVGLVIEFLMGGAFRSMYTR-----------KRFRLLYHNLYGQHRASVDNTRQRKQKMSTASGVGVTL-------DGSDPECSCFAYPF-----------NELLAWAVLMKRQRMAMFFWQHGEESLAKALVACKLYRSLAGEAKQSREDEL--KWKRLWCARVKFGQLALDLLDQSFRQDERMAMKLLTYELRNWSNFTCLKLAVSSRHRPFVAHTCTQMLLADMWMGRLNMRKNSWFKVILSI---LMPPSILMLEY----KSKAEMSHIPQSEELHQ-MGQEEREHRAAATRDIPMQRCLSRRVFLRLLSFAIRILLLRTVGNGSAADGGESGHKEEEGIWIRPSGLSLSRRIYEFYHAPIVKFWFNTLAYIGFLMLFTYVVLVKLQQL---PSVQ----EWFVILYLFMSAIERVREIFM-SEPGKFGQKIKVWLDGYWNINDSLGI-LLFFVAVALRS--QSHLLIEAKIVYSLDVIFWYVRLLDVFAVNQNVGPYIMMIGKMMWQQCMLMIIMAIVLLSFGVARQAILFKEADPSWYLARNIVFQPYWMIFGEVYAPEIDNNTDDEYPPCTTGAFITPFLQAVYLFVQYIIMVNLLIAFFNNIYLEAKNISDKLWKFHRYH 986          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Sea Lamprey
Match: trpm7 (transient receptor potential cation channel, subfamily M, member 7 [Source:ZFIN;Acc:ZDB-GENE-021115-2])

HSP 1 Score: 235.343 bits (599), Expect = 5.790e-64
Identity = 262/1103 (23.75%), Postives = 454/1103 (41.16%), Query Frame = 1
Query:  244 LYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKEA------------DCSVVQLIVEGGKNTIQTGAEAL--KSNIPVVVMKGSKRAADVICDVVESSSDMFQDTIKLKLEEFEKEWNITTDEEKGNFQKNLVIFYECYQ----IGKVHLFNMKDFKNNLDTAIIEAAFS----------GTIKDQPLGDEAKLWLAMTFNRADVAEQRIFE-NQVRKNEININLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKANAHLHTAVNFIFKGTIDSPEKQSLKMIGRLINQLTDNLFPQMYQEANSDSCSC---CCWKSPKISD-SQSFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMR-YQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNI-FQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTEL---LSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXEDFKRTEYLSKFRKEQHESLDEVGFCSAIRFFYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFMGGQVKNFIS------------KFNNWKSSMWNWFD-LGIYIVFTIAYILRNTVNDSDFIYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQVDTSYMEG------SQC----------LFGYCATPNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKLNICK 3351
            L +LM   W  + P+L+IS++GG +N   L+   K  F +GLI  + +   WI TGG  TGV   VG A K+++  S  +  T+ GI  WG   N+  L  Q  D  +  P           + L+  H  FIL DDG+  K+G E + R E E+ ++ +                VV L+ EGG N I T  E L  +  +PVVV +G+ RAAD++  + +++ D                W  T     G     L    EC +    +G               +A I    S          G           +L LA+ ++R D+A+  +F   Q     +    R  M  AL+ ++  FV   +  G+++  FLT + L +LY             N +  G + +P K+ L                     ANS S      C    P I +        +C  I           + +T       ++G   S  E     YP             +L  WA+L +R  MA  FW+ G++ +  ALVA  +  SL  +A     +E  +  ++ Y  EF  LA+++L +++R+D+     LL   L  W   +CL +A  ++   F+ H+  Q  L ++W+G++    N  F++++++    +   I +  Y    K + +      SE   ++    + D  E   K  E I                        + R   LS  R+              I  FY API KF  N ++Y+ FL +F+Y +L++L  +   P+      E+ + ++     +  + +   G +     +            K   W    WN  D LGI ++F +A  LR+       I  + ++S+ +  +Y+R ++ + V Q+VGP ++MI +M+ ++   + I  I L ++G    ++L+   + +  L RNI + PYW +FG+V    ++G      + C           +  C T   I     A +L    +++++LLIA F   +++ +  S+++W F RY     +Y++  + PP  +   + + F   +C+
Sbjct:   13 LLQLMVKEWQMELPRLLISVHGGLQN-FELHPKLKQVFSKGLIKAALTTGAWIFTGGVNTGVVNHVGNALKEHASRSSHKICTI-GIAPWGVIENRGDLVGQ--DSHVVSPYQTLSNPLSKLNLLNSLHSHFILVDDGTVGKYGAEAQLRRELEKHIALQKIHTLACRAGMGQGVPVVGLVAEGGPNVIVTVLEYLLEEPPVPVVVCEGTGRAADILAFLHKNTDD--------------TGWAHT--HRHGQAMHLLQTLLECMRRKELVGTRARVRTHTHTCTHGSAAISGGPSVETLIALHRTGAAAGTNFSSADQLNLALAWDRVDIAKNHVFVYGQHWMALMWARWRRPMLDALVMDRVDFVKLLIENGVSMHKFLTITRLEELY-------------NTV-SGPLTNPPKRPLL--------------------ANSRSPPVGLNCTLNPPVIGNLLLMILGGTCSAIQAVDNTRQRKQKMSTASGVGVTLDG---SDPECSCFAYPF-----------NELLAWAVLMKRQRMAMFFWQHGEESLAKALVACKLYRSLAGEAKQSEAVEDSSEELKQYSTEFGQLALDLLDQSFRQDERMAMKLLTYELRNWSNFTCLKLAVSSRHRPFVAHTCTQMLLADMWMGRLNMRKNSWFKVILSI---LMPPSILMLEY----KSKAEMSHIPQSEELHQMGNGSAADGGESGHKEEEGI------------------------WIRPSGLSLSRR--------------IYEFYHAPIVKFWFNTLAYIGFLMLFTYVVLVKLQQL---PSVQ----EWFVILYLFMSAIERVREVSDGARETRKAAGLRSDSEASAHRKIKVWLDGYWNINDSLGI-LLFFVAVALRS--QSHLLIEAKIVYSLDVIFWYVRLLDVFAVNQNVGPYIMMIGKMMANMFSIVIIMAIVLLSFGVARQAILFKEADPSWYLARNIVFQPYWMIFGEVYAPEIDGICVAVLAACENIMKNNTDDEYPPCTTGAFITPFLQAVYLFVQYIIMVNLLIAFFNNIYLEAKNISDKLWKFHRYH-FTMYYHQKPILPPPLILLSYLSLFASQLCR 991          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Sea Lamprey
Match: trpm2 (transient receptor potential cation channel, subfamily M, member 2 [Source:NCBI gene;Acc:799412])

HSP 1 Score: 207.608 bits (527), Expect = 7.700e-55
Identity = 189/696 (27.16%), Postives = 307/696 (44.11%), Query Frame = 1
Query:  148 YGAIQLSGYRVIAGKNPKYVRVHKDLSNIKGELYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSAS---TWIVTGGFETGVSKLVGEASKDYSIL--SKKQTFTVLGIGTWGATYNKEKLAMQTEDDRITYP-NYDPQKVGKGQ-SPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKEADCSVVQLIVEGGKNTIQTGAEALKSNIPVVVMKGSKRAADVICDVVESSSDMFQDTIKLKLEEFEKEWNITTDEEKGN--FQKNLVIFYECYQIGKVHLFNMKDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEININLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKANAHLHTAVNFIFKG--TIDSPEKQ---SLKMIGRLINQLTDNLFPQMYQEANSDSCSCCCWKSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMRYQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNIFQILINVPFGYLT-SRIFIFPYNL 2190
            +G IQ +G   +  +  K+VRV  D       L+KLM   W    P L+IS+ GGAKN   L    +  F+ GL   ++S      WI+TGG   GV K VGE+ +D+++   SK+     +GI TWG  +NKE L     D +  +P  Y   + G+G+ S LD  H  FIL D+G+  ++G EI  R   E+ +S +   S               G E   S    V    + R  D+   V      +    I        +E N +   EK N  F   + +F+    I +  L     +   +    I A+     K Q   D  +L LA+ +NR D+A   IF +  RK +   +L   M+ AL+ N+ +F+  F+  GL +  +LT + L  LY    A++ LH  +  I +G  +   P ++   +L M  + +N  +      + +E   DS S       K+S     + SS                         K  G  +    +++               E+DLF+WA+L  R E+A  FW  GKD + +AL+A+ +  ++ ++   + + +  ++ +   + +E LAI +L E Y+ D++R   LLIR L  WG  +CL +A      +F  HS  Q  L  IW G +   +  +++++ + F  L  +RI  F + L
Sbjct:   72 FGDIQFTG---LGQRLGKFVRVGNDTE--PSVLFKLMMEHWHLDVPNLLISVTGGAKNF-HLKPQLRTIFRHGLNKTARSTGIQGAWIITGGSYAGVMKYVGESVRDFALASGSKEGKIVAIGIATWGIIHNKEHLI----DAQGKFPAEYPMDEAGQGRLSCLDNNHSHFILVDNGTHGQYGVEIVLRARLEQYISTQHTGS---------------GGECRSSKAVGVRGNCAARLWDMCVRVRHCGKIVL--IIMQAXSMVVREINSSVIFEKQNIYFDVLICLFFLGRIISRALL--TGTYACAMVVVCISASRGEANKAQESCDH-QLRLALAWNRVDIATSEIFTDD-RKWQTG-DLEQVMDAALLENRPEFISLFVEHGLILREYLTWARLESLYNGAPASSLLHILLRRISEGEKSPADPHRRWISTLPMAPKRMNHFSLYHISLLIRELLGDSTSML--YGNKMSRFSKLSPSS-------------------------KNTGSTKGGTSLEFKGQTYNEGQLYCPDPERDLFIWAVLLNRRELANFFWSQGKDCMAAALMASKLLKAMVQE---EDDSDRTSDMLAQADNYEQLAIGLLDECYKDDELRAQKLLIRQLHSWGGATCLSMAYHANNKSFFSHSGVQALLTQIWWGGMSVDLKTWRVILCIIFPLLIYTRIITFRWVL 705          

HSP 2 Score: 138.658 bits (348), Expect = 2.860e-33
Identity = 113/373 (30.29%), Postives = 184/373 (49.33%), Query Frame = 1
Query: 2440 CSAIRF--FYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFMGGQVKNFISKFNNWKSS------MWNWFDLGIYIVFTIAYILR---NTVNDSDFIYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQ----VDTSYMEGSQCLFGYCATPNAIVQVANAXXXXXXXX---------XXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKLNICKNSNNGRLSVDAFIANLIHEEDLECSGFEQQCMETYLITNQLLDLS 3486
            C+  R+  F+TAPIT F  N++SY  FL +F+Y ++++       P       EY +Y + +S +L E+ Q F   +      K   WK++      +WN  D+   ++FTI  I R   N++N+S F   R++  +   +F +R M  + V +++GPK+I++ RM+KDI FFL +  + + AYG  +  +L  N      + R + Y PY  +FGQ    VD++  + + C      T      V    +L              LLL+LLIAMF  TF  V++N++ +W F RY ++ E++ RP L PP  VF   Y F +  I K   +     + F       E+ E   +E    E+Y + +QL + S
Sbjct:  710 CTPTRWRNFWTAPITVFWANVVSYFIFLWLFAYVIIMDFQYTPDWP-------EYVLYAWVLSLILEELRQVFTDPE------KAGQWKAAVRYIKDIWNRIDILALLLFTIGVICRLIPNSINESTFQAGRSVLCVDYMVFCLRLMHIFTVNKTLGPKIIIVKRMVKDIFFFLFLLGVWVVAYGVATQGILILNEQRLDWIFRGVVYQPYLLIFGQFPTRVDSTTFDTTSCTNNGINTSQPRCPVLGVDWLTILLTCLYLLFANILLLNLLIAMFNYTFQLVQDNTDTIWKFQRYELVNEYHSRPSLAPPLIVFSHLYLFVRRFILKKPQHKH---EDFKKGFSESEEREFLAWESIMRESY-VASQLTEKS 1065          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Nematostella
Match: EDO30135 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1N0])

HSP 1 Score: 365.54 bits (937), Expect = 1.544e-105
Identity = 306/1156 (26.47%), Postives = 556/1156 (48.10%), Query Frame = 1
Query:  130 RHEKFQYGAIQLSGYRVIAGKNPKYVRVHKDL-SNIKGELYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQT-FTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSK-------EAD---CSVVQLIVEGGKNTIQTGAEALKSNIPVVVMKGSKRAADVICDVVESS--SDMFQDTIKLKLEEFEKEWNITTDEEKG--NFQKNLVIFYECYQIGK-VHLFNMK-DFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIF-ENQVRKNEININLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKANAHLHTAVNFIFKGTIDSPEKQSLKM--IGRLINQLTDNLFPQMYQEANSDSCSCCCWKSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEI-EIMNNWMRYQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNIFQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFX-----XXXXXXXXXEDFKRTEYLSKFRKEQHESL----DEVGFCSAIRFFYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYS-RKIEYCIYIFYISFLLGEIYQFFMGGQVKNFI-SKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDFIYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINI-----TSPLMRNIFYNPYWQLFGQVDTSYMEGSQCLFGYCATPNA--IVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFK--LNICKNSNNGRLSVDAFIANLIHEEDLECSGFEQQCMETYLITNQ 3471
            +H    YG I   GY     K   Y+R+  D  +N+   +  LM   W  + P L+IS+ GGAK+ + L    +  F+RGLI  +K+   WI+TGG  TGV K VGEA K+  ++    T   V+GI TWG    +  L  +         + +P    +G + LDP H  F L DDG++ K+G EI  R+  EE++ K       EA      VV L++EGG NT+ T  E +K  +P VV+ GS RAA V+      +   ++   TI +   ++E E      E  G     K   +  +  +  K + ++++  +   ++D AI++A      +  P+   A+L LA+ +NR D+A+  IF E Q    E    L   M TAL+ ++ +F + FL+ GL++  FL+  +L  LY +   N    T +  + +  +   + +++ M  +G +I +L  ++F   Y++                 D   F + +        Y E +  +             + +SSK++   +    N+   +     D+FLWA+L  R E+A++ W+ G++ + +AL+A+ +   +  +A     I +I ++   +   FE  A+ +L E +  ++  +  LL+R L ++ R + L++A   +  +F+ H++CQ  L  +W+G +      +++L+ +   YL   IF   Y +  ++  +       +      S     H++K+   ++ P Y++   +               +EDF+  +Y+ + R++    +     ++GFC  I  FY+AP +KFV N++ YLAF+ +++Y +L        + T       E  +Y +  + L+ EI Q  +  +   +I  K + + S  WN+ D+    VF IA ILR   N   F   R + S+ +  F +R ++ + V + +GPK++MI +M++D+  F+ I  +   AYG    ++++P+  I     T   + ++   PYWQ++G++    ++G +        P+   +  +  A +++FTN+LLL+LLIA+F  TF +V+E+S++VW F RY +++E++ RP+  PP  +      F +    +C+  +  R S       L   E  +   +E Q  E Y+   Q
Sbjct:   89 KHPTNAYGEIDFEGYG--GQKRAPYLRMSHDTDANL---VITLMLKRWNLEIPNLVISVTGGAKSFV-LKPRLREMFRRGLIKAAKTTGAWIITGGTNTGVMKHVGEAVKEQQLMFGSDTQVNVIGIATWGIVDKQSDLISEKNGKYPALYSMEPTPGHQG-AMLDPNHSHFFLVDDGTEGKYGVEIGMRSRIEEAIMKVKTDSRSEAGSIGVPVVLLVLEGGPNTVATMYELIKKKVPAVVIDGSGRAASVVGFAYNHTIKRNVDGQTINVIDPQYEDEVRAKVVEVFGAKGADKTYSMIKDVLEDEKMISVYSLDGEISQDIDLAILKALLKAN-RSSPV---AQLNLALAWNRIDLAKSDIFTEEQQWTTE---TLSAAMLTALLDDKAEFAELFLQNGLSMREFLSLDILCKLYAEVPGN----TTIKPLLQKEMGKRQVKTIDMDVVGEVIEELMGDMFESYYRK-----------------DGHYFGELAS-------YAEGLVLK-------------NRKSSKDLLANI----NRIDPLPTPYLDVFLWAVLCNRRELARVLWEAGREPMAAALMASRLLKRMASRAQEDNTITDISSDLYDHARLFEERAVGVLDECFNENETLSQTLLVRELDHYSRMTALELAVSAESQDFIAHTSCQVLLTRLWMGTMAMNTRWWKVLVCL---YLPVLIFPIIYFVPDEQHERQAAEREHQKSLNQKSSKVKSHKEKNDAPVV-PVYRSKEEKAVSNDEEARVGTENEEEDFQLEDYIPEIREDDSMEVIMRNKKLGFCDRIMHFYSAPFSKFVGNVVGYLAFIFLYAYVVLFNFPRFDPAKTLGGIHPTEIVLYFWVFTILIEEIRQ--LAAKPPKYIKDKVSVYFSDTWNFVDIFSLTVFIIAIILRFFTNSRIFTASRIILSLDIIFFIVRSLQIFSVNRLLGPKLVMIQKMMQDLAQFIIILAVFTIAYGIALHAVMFPSPGIYARNNTWVTITSVVQYPYWQMYGELFLDEIQGEKPKEFGEVDPDGRWLSPLLLAIYMVFTNILLLNLLIAIFNYTFERVQEDSDKVWKFQRYDLVQEYHSRPVFAPPLVLLGHILIFIRWVWRMCRCGHPPRGST--MKIGLSPAEMEQMDNWEFQAAEMYIHQQQ 1177          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Nematostella
Match: EDO47658 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLT7])

HSP 1 Score: 311.997 bits (798), Expect = 1.280e-88
Identity = 317/1151 (27.54%), Postives = 539/1151 (46.83%), Query Frame = 1
Query:  148 YGAIQLSGYRVIAGK--NPKYVRVHKDLSNIKGELYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFT-------VLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVS------KEADCSVVQLIVEGGKNTIQTGAEALK--SNIPVVVMKGSKRAADVICD----VVESSSDM--FQDTIKLK--LEEFEKEWNITTDEEKGNFQKNLVIFYECYQIGK-VHLFNMKDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEININLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKANAHLHTAVNFIFKGTIDSPEKQSLKMIGRLINQLTDNLFPQMYQEANSDSCSCCCWKSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKI-FW-KC--GKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMRYQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVN-IFQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSKDFS--EHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXEDFKRTEYLSKFRKEQHESLDEVGFCSAIRFFYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFMGGQVKNF-ISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDFIYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQV---DTSYMEGS-QCLFGYCATP------NAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKLNICKNSNNGRLSVDA---FIANLIHEEDLECSGFEQQCMETYL 3459
            +G ++  G    AG+    KY+R+  D       + +L+   W    PKL+IS+ GGAKN I L+   K   + GL+  +++   W++TGG  TGV + VGEA K ++++S+ +          ++GI +WG   +KE L     +     P      +    + LD  H  FIL D+G+D ++G EI FR   E  ++      K     VV L++EGG NTI+T  E++     +PVV+ +GS RAAD++      +  S+ +M    D ++ +  L + EK +   + E++ +  +N++   +C    + V +F + D    +D AI+ A     +K Q    E +L LA+ ++RAD+A+  IF  + +K E+ + L   M  AL+ ++ +FVD  L  G+++ +FLT   L +LY K + +   H +         D+    S +M     N+ T  ++ Q             C            +  +   I +  Y  PV   P  +         ++  S+  +Y  +   + + + +    +++   L    I   +   W  C  G+      L   +   + Q+ +  +   +     M    EF  +A+ +L E Y+ + +    LLI    YWG  + L +A  ++   F+ HS CQ +L  IW+G +    N   ++L+ + F  L     IF      + + Q V T + +   + L  DF    HR+  S +     Y  + + F K +K    +E     E + + R         +G    I  FY APITKF  N+I YL FL +FS+ +LIEL  +          IE  + I ++  L  E  +      V NF   + ++W S++WN  D    ++F +A  LR  +N         ++S+ + ++ IR ++ + V + +GP V+MI RM  D+++FL I ++ L AYG    ++L+P+   +  L+  IF+ PY+Q++G++   D  Y   S +  F   +TP        +V V  AF+LL  N+LLL+LLIA+F  TF +V+ NSN++W F R+ ++ E+  RP L PPF +    +   K  I K +     S  A   F   L  EE  +   FE+QC ET+L
Sbjct:   20 FGELEFQG----AGQPSRAKYIRLAHDTD--PELVLRLLCGEWALDLPKLLISVTGGAKNFI-LSPKIKRVLREGLLKAAQTTGAWVITGGTNTGVMRHVGEAVKGHTVMSRGEQLKNTAHQVHLIGIASWGIVDHKEMLVNPKVE---VVPYQMTSSMQSRGACLDNNHSHFILVDNGTDGEYGGEISFRASLENLIASKKMAQKFHGVPVVLLVLEGGPNTIRTVLESVSRCPAVPVVIAEGSGRAADILAFAHRFIAPSNGEMSGVADVVEHRQLLHKIEKSFAECSPEDRLSIYQNVL---KCVAKREFVTIFCVDDGGLEVDKAILRA----LLKSQHSQLEDQLSLALVWDRADIAKTEIF-TEDQKWEVPM-LETAMMEALLHDRVEFVDLLLDNGVSMANFLTVKRLEELYRKVRGSKANHASSRIFMHYHNDTYTNASTQM-----NKHTHGIYTQR------------CTHLHYARTHTYLHGHAHAHIRFCTY--PVPLSPLQSMGSVLLFTSEKMPSRVTRYGFF---STSLRFVKQSTEIYHPPLPPLSISYLQTEAWDPCVRGEPQEAQMLQICIKPGNRQETSAKEAAADASCRDMLDSREFYDIALGLLDECYKANDVLAQRLLIYHPVYWGGRTSLSLAVASRHEEFVAHSCCQKKLTEIWMGALKTGYNGSLKVLLGILFPPL-----IFALEFRSREEMQRVPTTDDDSADD-LPPDFDPYHHREPGSAQ-YNDGYLGDGVAFVKNRKSSGNEE-----EPIVEIRL--------LGLGKRIIGFYNAPITKFWSNLIVYLLFLVVFSHVILIELPPVP--------SIEEWVLIGFVFSLCAEEVRQVRVINVWNFSFFESSDWASNVWNLCDGFAMVLFFLAVGLR--LNPGTLRIGHLVYSLDIMLWIIRLLDIFSVSKDLGPYVVMIGRMTIDMMYFLVIMVVFLLAYGVAQQAILFPHEKPSWELITKIFFRPYFQVYGELFIEDVDYSSNSRETAF---STPKFDEYGGRLVTVIMAFYLLVANILLLNLLIAIFNNTFSEVQANSNQIWKFQRFSLVMEYRQRPRLVPPFILIAHAHGLAK-AIWKRACGAPASRQADCKFKLFLGKEEYHKLMLFEEQCTETFL 1095          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Medaka
Match: trpm7 (transient receptor potential cation channel subfamily M member 7 [Source:NCBI gene;Acc:101156483])

HSP 1 Score: 321.627 bits (823), Expect = 6.170e-90
Identity = 309/1219 (25.35%), Postives = 564/1219 (46.27%), Query Frame = 1
Query:  148 YGAIQLSG----YRVIAGKNPKYVRVHKDLSNIKGELYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKE-------ADCSVVQLIVEGGKNTIQTGAEALKSN--IPVVVMKGSKRAADVICDVVESSSDM--FQDTIKLKL-EEFEKEWNITTDEEKGNFQKNLVIFYECYQIGK-VHLFNMK-DFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEININ-LRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKA--NAHLHTAVNFIFKGTIDSPEKQSLKMIGRLINQLTDNLFPQMYQEA----------NSDSCSCCCWKSP-----KISDSQSFNDSSCEVIDYEKYIEPVAT-EPTTNCCCCFKINGDEESSKEMKYTVYPIRN-KNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMR-YQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNI-FQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXEDFKRTEYLSKFRKEQHESLDEVGFCSAIRFFYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDFIYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQV-----DTSYMEGSQCLFGYCATPNA-IVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKLNICKNSNNGRLSVDAFIANLIHEEDLECSGFEQQCMETYLITNQLLDLSAHDASKTWFKSDDSITNEPSNVAIEAHVKALVGSIAEIKDELKSLNEKVYKIRRLQKKTV 3666
            YG I   G    YR       KYVR+  D  +    + +LM   W  + PK++IS++GG +N   L+   K    +GLI  + +   WI+TGG  TGV+K VG+A K++   S K+  T+ GI  WG   N+  L  +     I  P           + L+  H  F+L DDG+  K+G E+K R + E+ ++ +           VV LI EGG N I T  E L+    +PVVV +G+ RAAD++  V + + +     D ++  +    +K +N +  +    FQ    +  EC +  + + +F++  + + ++D AI++A   GT    P     +L L + ++R D+A+  +F   V   ++ ++ L   M  AL+ ++  FV   +  G+++  FLT + L +LY  +++  N  L   V  + +  +    K +L  +G +I  L    +   Y              S+  S      P     K  ++ S      E   +  +I+     +P  +          E++ K  K  +  I + + ++  Y   +L +WA+L +R +M+  FW+ G++++  ALVA  +C S+  +A     ++  ++ ++ Y  +F TLA+++L +++R+D+     LL   L  W   +CL +A  + L  F+ H+  Q  L+++W+G++    N  +++++++    +   I +  Y    K + +      S+   ++  +D SEH           N+QN     +    K     D   T    K   E H    ++     I  FY API KF  N + YL FL +++Y +L+++     +P+      E+ + ++  +  + +I + FM  +      K   W S  +N  D    + F I   LR    D+ F+  R ++ +++  +Y+R ++   V Q  GP V+MI++M+ ++ + + I L+ L +YG    ++LYPN   +  L R++ + PYW ++G+V     D         +   CA+    +     A +L    +L+++LLIA F   +M+V+  SN VW F RY  I  ++ +P+LPPPF +    Y+ F    C      + S       L  E+  +   FE+QC+ETY       D   H  S+   +    +T++    A+   +K +   +  IK  L +L+ ++  ++ L   TV
Sbjct:  110 YGVINFQGGSHSYRA------KYVRLSYD--SRPESVLRLMLKEWHMELPKILISVHGGVQNF-ELHPRIKQVVGKGLIKAAVTTGAWILTGGVNTGVAKHVGDALKEHCSRSAKKICTI-GIAPWGVIENRNDLIGKD----IIAPYQTLLNPLSKLNVLNNLHSHFLLVDDGTVGKYGAEVKLRRDLEKHINLQRIHARIGQGVPVVALIFEGGPNVILTVLEYLQETPPVPVVVCEGTGRAADILAYVHKQTEEGGGLPDGVETDIIATIKKTFNFSHSDAIHLFQ----MLMECMKSKELITVFDISSEEQQDIDVAILKALLQGT-NSSPFD---QLVLTLAWDRVDIAKNHVF---VYGQQLLVSSLEQAMLDALVMDRVDFVKLLIENGVSMHRFLTINRLEELYNTKQSPNNPTLLHLVRDVKQSNLPPNYKITLIDVGLVIEYLMGGTYRCNYTRKRFRIIYNNLHGSNRRSGRHAAGPGSHFRKSHEAFSMQADKKEKTRHNHFIKTAQPYKPKVDSSA-------EQNKKRSKEEIVDIDDPETRRFPYPFNELLVWAVLMKRQKMSLFFWQHGEENMAKALVACKLCRSMGYEAKKSDVVDDTSDKLKDYSNDFGTLAVDLLEQSFRQDETMAMKLLTYELKNWSNSTCLKLAVSSHLRPFVAHTCTQMLLSDMWMGRLNMRKNSWYKVILSI---LVPPAILLLEY----KSKAEMAHIPQSQDDHQMTMED-SEH-----------NFQNLHEDIQMDVFKEARSHDHVET----KHDMEMHVRSRKLPLTRKIYAFYHAPIVKFWSNTLFYLGFLMLYTYVVLVKM---IQAPSTQ----EWVVIVYIFTSAIEKIREMFMS-EAGKISQKIKVWFSDYFNVSDFLAIVTFFIGCGLRLAGGDA-FLPGRIVYCLNIIFWYVRLLDILAVNQQAGPYVMMIAKMVANMFYIVVIMLVVLLSYGVPRKAILYPNEEPSWTLARDVVFQPYWMMYGEVYAYEIDVCANNSEDSVKPLCASAGVWLTPFLQAVYLFVQYILMVNLLIAFFNNVYMQVKSISNLVWKFQRYHFIMAYHEKPVLPPPFILLCHVYSLF----CMCRKRKKESTYGPKLFLTEEDQKKLHDFEEQCVETYFHEK---DDQFHSGSEERIR----LTSQRVE-AMSLQLKEVGNKVNFIKRSLHTLDSQIGHLQDLSALTV 1252          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Medaka
Match: trpm7 (transient receptor potential cation channel subfamily M member 7 [Source:NCBI gene;Acc:101156483])

HSP 1 Score: 321.627 bits (823), Expect = 6.890e-90
Identity = 309/1219 (25.35%), Postives = 565/1219 (46.35%), Query Frame = 1
Query:  148 YGAIQLSG----YRVIAGKNPKYVRVHKDLSNIKGELYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKE-------ADCSVVQLIVEGGKNTIQTGAEALKSN--IPVVVMKGSKRAADVICDVVESSSDM--FQDTIKLKL-EEFEKEWNITTDEEKGNFQKNLVIFYECYQIGK-VHLFNMK-DFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEININ-LRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKA--NAHLHTAVNFIFKGTIDSPEKQSLKMIGRLINQLTDNLFPQMYQEA----------NSDSCSCCCWKSP-----KISDSQSFNDSSCEVIDYEKYIEPVAT-EPTTNCCCCFKINGDEESSKEMKYTVYPIRN-KNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMR-YQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNI-FQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXEDFKRTEYLSKFRKEQHESLDEVGFCSAIRFFYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDFIYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQV-----DTSYMEGSQCLFGYCATPNA-IVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKLNICKNSNNGRLSVDAFIANLIHEEDLECSGFEQQCMETYLITNQLLDLSAHDASKTWFKSDDSITNEPSNVAIEAHVKALVGSIAEIKDELKSLNEKVYKIRRLQKKTV 3666
            YG I   G    YR       KYVR+  D  +    + +LM   W  + PK++IS++GG +N   L+   K    +GLI  + +   WI+TGG  TGV+K VG+A K++   S K+  T+ GI  WG   N+  L  +     I  P           + L+  H  F+L DDG+  K+G E+K R + E+ ++ +           VV LI EGG N I T  E L+    +PVVV +G+ RAAD++  V + + +     D ++  +    +K +N +  +    FQ    +  EC +  + + +F++  + + ++D AI++A   GT    P     +L L + ++R D+A+  +F   V   ++ ++ L   M  AL+ ++  FV   +  G+++  FLT + L +LY  +++  N  L   V  + +  +    K +L  +G +I  L    +   Y              S+  S      P     K  ++ S      E   +  +I+     +P  +       +  E++ K  K  +  I + + ++  Y   +L +WA+L +R +M+  FW+ G++++  ALVA  +C S+  +A     ++  ++ ++ Y  +F TLA+++L +++R+D+     LL   L  W   +CL +A  + L  F+ H+  Q  L+++W+G++    N  +++++++    +   I +  Y    K + +      S+   ++  +D SEH           N+QN     +    K     D   T    K   E H    ++     I  FY API KF  N + YL FL +++Y +L+++     +P+      E+ + ++  +  + +I + FM  +      K   W S  +N  D    + F I   LR    D+ F+  R ++ +++  +Y+R ++   V Q  GP V+MI++M+ ++ + + I L+ L +YG    ++LYPN   +  L R++ + PYW ++G+V     D         +   CA+    +     A +L    +L+++LLIA F   +M+V+  SN VW F RY  I  ++ +P+LPPPF +    Y+ F    C      + S       L  E+  +   FE+QC+ETY       D   H  S+   +    +T++    A+   +K +   +  IK  L +L+ ++  ++ L   TV
Sbjct:  102 YGVINFQGGSHSYRA------KYVRLSYD--SRPESVLRLMLKEWHMELPKILISVHGGVQN-FELHPRIKQVVGKGLIKAAVTTGAWILTGGVNTGVAKHVGDALKEHCSRSAKKICTI-GIAPWGVIENRNDLIGKD----IIAPYQTLLNPLSKLNVLNNLHSHFLLVDDGTVGKYGAEVKLRRDLEKHINLQRIHARIGQGVPVVALIFEGGPNVILTVLEYLQETPPVPVVVCEGTGRAADILAYVHKQTEEGGGLPDGVETDIIATIKKTFNFSHSDAIHLFQ----MLMECMKSKELITVFDISSEEQQDIDVAILKALLQGT-NSSPFD---QLVLTLAWDRVDIAKNHVF---VYGQQLLVSSLEQAMLDALVMDRVDFVKLLIENGVSMHRFLTINRLEELYNTKQSPNNPTLLHLVRDVKQSNLPPNYKITLIDVGLVIEYLMGGTYRCNYTRKRFRIIYNNLHGSNRRSGRHAAGPGSHFRKSHEAFSMQADKKEKTRHNHFIKTAQPYKPKVD-------SSAEQNKKRSKEEIVDIDDPETRRFPYPFNELLVWAVLMKRQKMSLFFWQHGEENMAKALVACKLCRSMGYEAKKSDVVDDTSDKLKDYSNDFGTLAVDLLEQSFRQDETMAMKLLTYELKNWSNSTCLKLAVSSHLRPFVAHTCTQMLLSDMWMGRLNMRKNSWYKVILSI---LVPPAILLLEY----KSKAEMAHIPQSQDDHQMTMED-SEH-----------NFQNLHEDIQMDVFKEARSHDHVET----KHDMEMHVRSRKLPLTRKIYAFYHAPIVKFWSNTLFYLGFLMLYTYVVLVKM---IQAPSTQ----EWVVIVYIFTSAIEKIREMFMS-EAGKISQKIKVWFSDYFNVSDFLAIVTFFIGCGLRLAGGDA-FLPGRIVYCLNIIFWYVRLLDILAVNQQAGPYVMMIAKMVANMFYIVVIMLVVLLSYGVPRKAILYPNEEPSWTLARDVVFQPYWMMYGEVYAYEIDVCANNSEDSVKPLCASAGVWLTPFLQAVYLFVQYILMVNLLIAFFNNVYMQVKSISNLVWKFQRYHFIMAYHEKPVLPPPFILLCHVYSLF----CMCRKRKKESTYGPKLFLTEEDQKKLHDFEEQCVETYFHEK---DDQFHSGSEERIR----LTSQRVE-AMSLQLKEVGNKVNFIKRSLHTLDSQIGHLQDLSALTV 1244          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Medaka
Match: trpm7 (transient receptor potential cation channel subfamily M member 7 [Source:NCBI gene;Acc:101156483])

HSP 1 Score: 321.242 bits (822), Expect = 8.834e-90
Identity = 309/1219 (25.35%), Postives = 564/1219 (46.27%), Query Frame = 1
Query:  148 YGAIQLSG----YRVIAGKNPKYVRVHKDLSNIKGELYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKE-------ADCSVVQLIVEGGKNTIQTGAEALKSN--IPVVVMKGSKRAADVICDVVESSSDM--FQDTIKLKL-EEFEKEWNITTDEEKGNFQKNLVIFYECYQIGK-VHLFNMK-DFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEININ-LRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKA--NAHLHTAVNFIFKGTIDSPEKQSLKMIGRLINQLTDNLFPQMYQEA----------NSDSCSCCCWKSP-----KISDSQSFNDSSCEVIDYEKYIEPVAT-EPTTNCCCCFKINGDEESSKEMKYTVYPIRN-KNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMR-YQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNI-FQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXEDFKRTEYLSKFRKEQHESLDEVGFCSAIRFFYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDFIYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQV-----DTSYMEGSQCLFGYCATPNA-IVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKLNICKNSNNGRLSVDAFIANLIHEEDLECSGFEQQCMETYLITNQLLDLSAHDASKTWFKSDDSITNEPSNVAIEAHVKALVGSIAEIKDELKSLNEKVYKIRRLQKKTV 3666
            YG I   G    YR       KYVR+  D  +    + +LM   W  + PK++IS++GG +N   L+   K    +GLI  + +   WI+TGG  TGV+K VG+A K++   S K+  T+ GI  WG   N+  L  +     I  P           + L+  H  F+L DDG+  K+G E+K R + E+ ++ +           VV LI EGG N I T  E L+    +PVVV +G+ RAAD++  V + + +     D ++  +    +K +N +  +    FQ    +  EC +  + + +F++  + + ++D AI++A   GT    P     +L L + ++R D+A+  +F   V   ++ ++ L   M  AL+ ++  FV   +  G+++  FLT + L +LY  +++  N  L   V  + +  +    K +L  +G +I  L    +   Y              S+  S      P     K  ++ S      E   +  +I+     +P  +          E++ K  K  +  I + + ++  Y   +L +WA+L +R +M+  FW+ G++++  ALVA  +C S+  +A     ++  ++ ++ Y  +F TLA+++L +++R+D+     LL   L  W   +CL +A  + L  F+ H+  Q  L+++W+G++    N  +++++++    +   I +  Y    K + +      S+   ++  +D SEH           N+QN     +    K     D   T    K   E H    ++     I  FY API KF  N + YL FL +++Y +L+++     +P+      E+ + ++  +  + +I + FM  +      K   W S  +N  D    + F I   LR    D+ F+  R ++ +++  +Y+R ++   V Q  GP V+MI++M+ ++ + + I L+ L +YG    ++LYPN   +  L R++ + PYW ++G+V     D         +   CA+    +     A +L    +L+++LLIA F   +M+V+  SN VW F RY  I  ++ +P+LPPPF +    Y+ F    C      + S       L  E+  +   FE+QC+ETY       D   H  S+   +    +T++    A+   +K +   +  IK  L +L+ ++  ++ L   TV
Sbjct:   95 YGVINFQGGSHSYRA------KYVRLSYD--SRPESVLRLMLKEWHMELPKILISVHGGVQNF-ELHPRIKQVVGKGLIKAAVTTGAWILTGGVNTGVAKHVGDALKEHCSRSAKKICTI-GIAPWGVIENRNDLIGKD----IIAPYQTLLNPLSKLNVLNNLHSHFLLVDDGTVGKYGAEVKLRRDLEKHINLQRIHARIGQGVPVVALIFEGGPNVILTVLEYLQETPPVPVVVCEGTGRAADILAYVHKQTEEGGGLPDGVETDIIATIKKTFNFSHSDAIHLFQ----MLMECMKSKELITVFDISSEEQQDIDVAILKALLQGT-NSSPFD---QLVLTLAWDRVDIAKNHVF---VYGQQLLVSSLEQAMLDALVMDRVDFVKLLIENGVSMHRFLTINRLEELYNTKQSPNNPTLLHLVRDVKQSNLPPNYKITLIDVGLVIEYLMGGTYRCNYTRKRFRIIYNNLHGSNRRSGRHAAGPGSHFRKSHEAFSMQADKKEKTRHNHFIKTAQPYKPKVDSSA-------EQNKKRSKEEIVDIDDPETRRFPYPFNELLVWAVLMKRQKMSLFFWQHGEENMAKALVACKLCRSMGYEAKKSDVVDDTSDKLKDYSNDFGTLAVDLLEQSFRQDETMAMKLLTYELKNWSNSTCLKLAVSSHLRPFVAHTCTQMLLSDMWMGRLNMRKNSWYKVILSI---LVPPAILLLEY----KSKAEMAHIPQSQDDHQMTMED-SEH-----------NFQNLHEDIQMDVFKEARSHDHVET----KHDMEMHVRSRKLPLTRKIYAFYHAPIVKFWSNTLFYLGFLMLYTYVVLVKM---IQAPSTQ----EWVVIVYIFTSAIEKIREMFMS-EAGKISQKIKVWFSDYFNVSDFLAIVTFFIGCGLRLAGGDA-FLPGRIVYCLNIIFWYVRLLDILAVNQQAGPYVMMIAKMVANMFYIVVIMLVVLLSYGVPRKAILYPNEEPSWTLARDVVFQPYWMMYGEVYAYEIDVCANNSEDSVKPLCASAGVWLTPFLQAVYLFVQYILMVNLLIAFFNNVYMQVKSISNLVWKFQRYHFIMAYHEKPVLPPPFILLCHVYSLF----CMCRKRKKESTYGPKLFLTEEDQKKLHDFEEQCVETYFHEK---DDQFHSGSEERIR----LTSQRVE-AMSLQLKEVGNKVNFIKRSLHTLDSQIGHLQDLSALTV 1237          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Medaka
Match: trpm2 (transient receptor potential cation channel subfamily M member 2 [Source:NCBI gene;Acc:101170060])

HSP 1 Score: 215.698 bits (548), Expect = 2.083e-56
Identity = 197/696 (28.30%), Postives = 317/696 (45.55%), Query Frame = 1
Query:  148 YGAIQLSGYRVIAGKNPKYVRVHKDLSNIKGELYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQ-TFTVLGIGTWGATYNKEKLAMQTEDDRITYPN-YDPQKVGKGQ-SPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVS----KEADCS----VVQLIVEGGKNTIQTGAEALKSNIPVVVMKGSKRAADVICDVVESSSDMFQDTIKLKLEEFEKEWNITTDEEKGNFQKNLVIFY--ECYQIGKV-HLFNM----KDFKNNLDTAIIEAAFSGTIKDQPLGDEA---KLWLAMTFNRADVAEQRIFENQVRKNEININLRPFMETALIRNQWQFVDFFLRQGLTVESFLTN-SMLRDLY-------FKEKANAHLHTAVNFIFKGTIDSPEKQSLKMIGRLINQLTDNLFPQMYQEANSDSCSCCCWKSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMRYQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNIFQILINVPF 2148
            +G IQ  G +    K   Y RV  + S     LY L+T  W    P L+IS+ GGAKN   L    +  F RGLI V+++   WI+TGG   GV K VG+A +DYS+ +  Q     +G+ TWG  +N+E L     ++   +P  Y   K  +G+ S LD  H  F+L DDG+   +G EI+ RT  E+ +S     + D S    VV +++EGG  T+ T   A+K+  P V+ +G+ R ADVI  V  S   + Q TI L  +  EK +     +E   F +  VI +  +   I ++ HL  +    +D   ++D AI++A    +   + L  +    +L LA+ +NR D+A+  IF      +  + +L   M +AL+ N+ QFV   L  G+++  FL N   L +LY       F  K    +H+  + +    I          +  L+   T +++P   ++         C  +  +S S S N                              NG    + E+       R+ +        D+FLWA+L    ++A+I W+  +D I +AL AT +   L+K AG + + E     +     +E  AI + SE Y  D+ R   LL+    +WG  + L +A K +   F+  S  Q  +  +W G++    +I ++LI + F
Sbjct:   93 FGEIQFDGLQQTTAK---YARVSSETS--PEVLYDLLTEQWHLLPPNLLISVTGGAKNF-NLKPHLRNMFHRGLIKVAQTTGAWIITGGTNAGVMKHVGQAVRDYSLSNSIQGQIVAIGVATWGVIHNREALI----NEEGCFPALYMTDKTSQGRLSCLDKNHTHFLLVDDGTHGHYGVEIELRTCLEKCISGKQLGKKDSSVTIPVVCVVLEGGPGTLNTIFNAMKNGTPCVIFEGTGRIADVIAQV--SGLPLQQITITLIHQLMEKFFG----QEYKKFTELSVIEWTKKIQDIVRMSHLLTIFRVTEDSHGDVDVAILKALLKASRSSETLTLDCWKTQLELAVAWNRVDIAKTEIFTEDSLWS--SADLHQAMFSALVGNKPQFVTLLLENGMSLRKFLQNEETLCNLYREMPSCIFLRKLAKRVHSKADLVDSNNITLTHVSD--EVRHLLGNATRHIYPPYVEQRY-------CMSAEDLSLSLSKN------------------------------NGAPRPAGEVAQ-----RDAS-------SDVFLWAVLQNNRDLAEIAWEQCQDSICAALAATRI---LKKLAGGESDAEEAEEMLNQASHYEEHAIGVFSECYNTDEERALKLLVHVSNFWGGTTSLWLALKAEDKRFVALSGVQAFMTRVWCGELSVDNHILRVLICMLF 716          

HSP 2 Score: 108.612 bits (270), Expect = 2.470e-23
Identity = 92/306 (30.07%), Postives = 150/306 (49.02%), Query Frame = 1
Query: 2458 FYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDFIYC-RTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFG-----------QVDTSYMEGSQCLFGYCAT---------PNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVF 3312
             Y +P  KF  NI+SY  FL +F+  L+++ +     P       E  +Y++  S +  E  Q F       F  K   + + +WN  D+   ++F +    R T   S+  Y  + +  I   +F +R M  + + Q++GPK+I++ RM+KD+ FF+ +  I + AYG     +L  N      + R   Y PY  +FG            +D+  M G+  L   C           P  +       +LLF N+LLL+LLIA+F  TF +V++N++R+W F RY +I+E++ RP  PPPF +F
Sbjct:  776 LYGSPQVKFYWNIVSYFFFLNLFAGVLMMDFHATPSVP-------ELLLYVWVFSLVCEEFRQLFCNSDGFGFKIKAKLYITDLWNILDVLSILLFLLGLAFRLT---SELFYAGKIVLCIDFVVFCLRLMAIFTISQTLGPKIIIVRRMMKDLFFFMFLLSIWVVAYGVAKQGILIHNDTRLDWIFRGAIYEPYLIIFGNFPENLAEAKFSLDSCSMNGTDPLKPKCPILNENHAPVFPEWLTITMLCVYLLFANILLLNLLIAIFNFTFQEVQDNTDRIWKFQRYELIKEYHSRPAAPPPFIIF 1071          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Medaka
Match: trpm2 (transient receptor potential cation channel subfamily M member 2 [Source:NCBI gene;Acc:101170060])

HSP 1 Score: 215.312 bits (547), Expect = 3.237e-56
Identity = 197/696 (28.30%), Postives = 317/696 (45.55%), Query Frame = 1
Query:  148 YGAIQLSGYRVIAGKNPKYVRVHKDLSNIKGELYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQ-TFTVLGIGTWGATYNKEKLAMQTEDDRITYPN-YDPQKVGKGQ-SPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVS----KEADCS----VVQLIVEGGKNTIQTGAEALKSNIPVVVMKGSKRAADVICDVVESSSDMFQDTIKLKLEEFEKEWNITTDEEKGNFQKNLVIFY--ECYQIGKV-HLFNM----KDFKNNLDTAIIEAAFSGTIKDQPLGDEA---KLWLAMTFNRADVAEQRIFENQVRKNEININLRPFMETALIRNQWQFVDFFLRQGLTVESFLTN-SMLRDLY-------FKEKANAHLHTAVNFIFKGTIDSPEKQSLKMIGRLINQLTDNLFPQMYQEANSDSCSCCCWKSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMRYQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNIFQILINVPF 2148
            +G IQ  G +    K   Y RV  + S     LY L+T  W    P L+IS+ GGAKN   L    +  F RGLI V+++   WI+TGG   GV K VG+A +DYS+ +  Q     +G+ TWG  +N+E L     ++   +P  Y   K  +G+ S LD  H  F+L DDG+   +G EI+ RT  E+ +S     + D S    VV +++EGG  T+ T   A+K+  P V+ +G+ R ADVI  V  S   + Q TI L  +  EK +     +E   F +  VI +  +   I ++ HL  +    +D   ++D AI++A    +   + L  +    +L LA+ +NR D+A+  IF      +  + +L   M +AL+ N+ QFV   L  G+++  FL N   L +LY       F  K    +H+  + +    I          +  L+   T +++P   ++         C  +  +S S S N                              NG    + E+       R+ +        D+FLWA+L    ++A+I W+  +D I +AL AT +   L+K AG + + E     +     +E  AI + SE Y  D+ R   LL+    +WG  + L +A K +   F+  S  Q  +  +W G++    +I ++LI + F
Sbjct:   93 FGEIQFDGLQQTTAK---YARVSSETS--PEVLYDLLTEQWHLLPPNLLISVTGGAKNF-NLKPHLRNMFHRGLIKVAQTTGAWIITGGTNAGVMKHVGQAVRDYSLSNSIQGQIVAIGVATWGVIHNREALI----NEEGCFPALYMTDKTSQGRLSCLDKNHTHFLLVDDGTHGHYGVEIELRTCLEKCISGKQLGKKDSSVTIPVVCVVLEGGPGTLNTIFNAMKNGTPCVIFEGTGRIADVIAQV--SGLPLQQITITLIHQLMEKFFG----QEYKKFTELSVIEWTKKIQDIVRMSHLLTIFRVTEDSHGDVDVAILKALLKASRSSETLTLDCWKTQLELAVAWNRVDIAKTEIFTEDSLWS--SADLHQAMFSALVGNKPQFVTLLLENGMSLRKFLQNEETLCNLYREMPSCIFLRKLAKRVHSKADLVDSNNITLTHVSD--EVRHLLGNATRHIYPPYVEQRY-------CMSAEDLSLSLSKN------------------------------NGAPRPAGEVAQ-----RDAS-------SDVFLWAVLQNNRDLAEIAWEQCQDSICAALAATRI---LKKLAGGESDAEEAEEMLNQASHYEEHAIGVFSECYNTDEERALKLLVHVSNFWGGTTSLWLALKAEDKRFVALSGVQAFMTRVWCGELSVDNHILRVLICMLF 716          

HSP 2 Score: 108.612 bits (270), Expect = 2.374e-23
Identity = 92/306 (30.07%), Postives = 150/306 (49.02%), Query Frame = 1
Query: 2458 FYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDFIYC-RTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFG-----------QVDTSYMEGSQCLFGYCAT---------PNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVF 3312
             Y +P  KF  NI+SY  FL +F+  L+++ +     P       E  +Y++  S +  E  Q F       F  K   + + +WN  D+   ++F +    R T   S+  Y  + +  I   +F +R M  + + Q++GPK+I++ RM+KD+ FF+ +  I + AYG     +L  N      + R   Y PY  +FG            +D+  M G+  L   C           P  +       +LLF N+LLL+LLIA+F  TF +V++N++R+W F RY +I+E++ RP  PPPF +F
Sbjct:  776 LYGSPQVKFYWNIVSYFFFLNLFAGVLMMDFHATPSVP-------ELLLYVWVFSLVCEEFRQLFCNSDGFGFKIKAKLYITDLWNILDVLSILLFLLGLAFRLT---SELFYAGKIVLCIDFVVFCLRLMAIFTISQTLGPKIIIVRRMMKDLFFFMFLLSIWVVAYGVAKQGILIHNDTRLDWIFRGAIYEPYLIIFGNFPENLAEAKFSLDSCSMNGTDPLKPKCPILNENHAPVFPEWLTITMLCVYLLFANILLLNLLIAIFNFTFQEVQDNTDRIWKFQRYELIKEYHSRPAAPPPFIIF 1071          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Planmine SMEST
Match: SMESG000035341.1 (SMESG000035341.1)

HSP 1 Score: 2399.78 bits (6218), Expect = 0.000e+0
Identity = 1199/1199 (100.00%), Postives = 1199/1199 (100.00%), Query Frame = 1
Query:   85 MESHPSVESDCSEFWRHEKFQYGAIQLSGYRVIAGKNPKYVRVHKDLSNIKGELYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKEADCSVVQLIVEGGKNTIQTGAEALKSNIPVVVMKGSKRAADVICDVVESSSDMFQDTIKLKLEEFEKEWNITTDEEKGNFQKNLVIFYECYQIGKVHLFNMKDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEININLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKANAHLHTAVNFIFKGTIDSPEKQSLKMIGRLINQLTDNLFPQMYQEANSDSCSCCCWKSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMRYQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNIFQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXEDFKRTEYLSKFRKEQHESLDEVGFCSAIRFFYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDFIYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQVDTSYMEGSQCLFGYCATPNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKLNICKNSNNGRLSVDAFIANLIHEEDLECSGFEQQCMETYLITNQLLDLSAHDASKTWFKSDDSITNEPSNVAIEAHVKALVGSIAEIKDELKSLNEKVYKIRRLQKKTVISGNN 3681
            MESHPSVESDCSEFWRHEKFQYGAIQLSGYRVIAGKNPKYVRVHKDLSNIKGELYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKEADCSVVQLIVEGGKNTIQTGAEALKSNIPVVVMKGSKRAADVICDVVESSSDMFQDTIKLKLEEFEKEWNITTDEEKGNFQKNLVIFYECYQIGKVHLFNMKDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEININLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKANAHLHTAVNFIFKGTIDSPEKQSLKMIGRLINQLTDNLFPQMYQEANSDSCSCCCWKSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMRYQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNIFQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFKKIKKKLKIKEDFKRTEYLSKFRKEQHESLDEVGFCSAIRFFYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDFIYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDILFFLAIYLIALFAYGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQVDTSYMEGSQCLFGYCATPNAIVQVANAFFLLFTNVLLLSLLIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKLNICKNSNNGRLSVDAFIANLIHEEDLECSGFEQQCMETYLITNQLLDLSAHDASKTWFKSDDSITNEPSNVAIEAHVKALVGSIAEIKDELKSLNEKVYKIRRLQKKTVISGNN
Sbjct:    1 MESHPSVESDCSEFWRHEKFQYGAIQLSGYRVIAGKNPKYVRVHKDLSNIKGELYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKEADCSVVQLIVEGGKNTIQTGAEALKSNIPVVVMKGSKRAADVICDVVESSSDMFQDTIKLKLEEFEKEWNITTDEEKGNFQKNLVIFYECYQIGKVHLFNMKDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEININLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKANAHLHTAVNFIFKGTIDSPEKQSLKMIGRLINQLTDNLFPQMYQEANSDSCSCCCWKSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMRYQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNIFQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFKKIKKKLKIKEDFKRTEYLSKFRKEQHESLDEVGFCSAIRFFYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDFIYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDILFFLAIYLIALFAYGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQVDTSYMEGSQCLFGYCATPNAIVQVANAFFLLFTNVLLLSLLIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKLNICKNSNNGRLSVDAFIANLIHEEDLECSGFEQQCMETYLITNQLLDLSAHDASKTWFKSDDSITNEPSNVAIEAHVKALVGSIAEIKDELKSLNEKVYKIRRLQKKTVISGNN 1199          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Planmine SMEST
Match: SMESG000004955.1 (SMESG000004955.1)

HSP 1 Score: 431.409 bits (1108), Expect = 8.578e-132
Identity = 343/1172 (29.27%), Postives = 589/1172 (50.26%), Query Frame = 1
Query:  148 YGAIQLSGYRVIA-GKNPKYVRVHKDLSNIKGEL----YKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILS--KKQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKEADCSVVQLIVEGGKNTIQTGAEALKSNIPVVVMKGSKRAADVICDVVESSSDMFQDTIKLKLEEFEKEWNITTDEEKGNFQKNLVIFYECYQIGKVHLFNMKDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEININLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKANAHLHTAVNFIFKGTIDSPEKQSLKMIGRLINQLTDNLFPQMYQEANSDSCSCCCWKSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCC-CCFKINGDEESSKEMKYTVYPIRNKNKQIIY--TEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMRYQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNIFQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXEDFKRTEYLSKFRKEQHESLDEVGFCSAIRFFYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFMGGQVKN-FISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDFIYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQVD-TSYMEGSQCLFGYCATPNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKL----NICKNSNNGRLSVDAFIANLIHEEDLECSGFEQQCMETYLITNQL------LDLSAHDASKTWFKSDDSITNEPSNVAIEAHVKALVGSIAE 3597
            +G I+  GY  I+   NP+++R      N   EL    Y+L+T  W F KP+L+IS+NGG K M   NN QK  FK+GL++V +  +TWI+ GGF  G+ KLV EA  D+ ILS   +    ++ I TWG   N   L + T      Y N +   + KG+  LDP +D ++  DDG+++++ +EI FR +FE +V ++     VQ++ EGGK  I++   +L+ +IP+VV+K S RAAD+IC+++E+      D + +++ +  +E    TD++K    + L   Y  Y+                     E      + DQ +  + K+  A+  +R D   ++     VR N ++I                  DF + Q     +    ++   +YFKE  + + H  +           E             + +NL         S  C C    +  ISD     D S ++ +           P  N     +KI  +  S   +K+  + +R+ N       + ++LFLW+L++   EMA IFW+ GK+++GSAL+ +++ S ++    +KG  ++ +  ++   +F+ LA +I+++AY+ +Q +TH++L R L  W   +CL IA    L++FL  +AC++     W+G +  F+  ++IL+ +PF  L  + FI PY             +N +  + L  +   +      EKI + N +  +                       K  K  H   D+V FC A+  FY API KFV+ ++SY+ FL +F+Y  L+EL  I       +   E  +YIF + F++ EI Q  +    KN  I K  ++ S  WN +D+    +F I+ I+R TVN   FI+ R  ++++LS+F +R M+FY++ +S+GPKVIMI +M+ D+ FFL+I+ + + +YGT S S+  PN      L+  +FY PY+Q +G++    +   S C    C   +A + +    FLL TN+LLL+LLIAMFG TF K++  S + ++F + ++++EF+ +P++PPP N+   +Y   KL     I  + ++ R +    I  L  +++L+  GFE  CME+ ++ N        ++L++ +   T  K+ + I  + +N + +  + + +G I +
Sbjct:   21 FGKIKFLGYEDISLNTNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGGFKRMNFKNNQQKKNFKQGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGT----CAYDNSNT--IEKGKVTLDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNV-RDIGAFAVQILYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEILET------DKMNVEIVDKYEEQLRLTDDDKIRIIEILSDIYSNYK---------------------ERITIHDLLDQNVHLDKKILDAIISSREDRNLEKTLNLAVRFNCVDI-----------------ADFKVFQSSRASTLSQKTL--GIYFKEMLSKNQHEMLQLFLVNNFSIDE------------FVQENLQDLYMTSLRSIKCRC----TEMISDLILREDKSFKIDN--------INNPGKNLLKVIYKIICNL-SDNILKFESFNLRSSNSHNANQNSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPY------------VSNKKSCSNLSHEKVKDKFLFEKEKI-ELNIRKKS----------------------PKSWKSYHSESDQVSFCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQ--INNTEKNGLIYKLKSYVSGSWNLYDMLTIFIFIISIIMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVFFFLSIFSLFIISYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELMLDDFKIPSPCNTTVCIVQSATLIIGFGIFLLMTNILLLNLLIAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNI--AYYILRKLWQSGKIIFHGDSKRKNT-FLIKYLNDDQNLKIRGFEHLCMESAMLENHQSTNVANINLNSDNLFDTILKNLELINEKLNNKSSDKAITSRLGVIEK 1074          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Planmine SMEST
Match: SMESG000004955.1 (SMESG000004955.1)

HSP 1 Score: 431.795 bits (1109), Expect = 8.794e-132
Identity = 343/1172 (29.27%), Postives = 589/1172 (50.26%), Query Frame = 1
Query:  148 YGAIQLSGYRVIA-GKNPKYVRVHKDLSNIKGEL----YKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILS--KKQTFTVLGIGTWGATYNKEKLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKEADCSVVQLIVEGGKNTIQTGAEALKSNIPVVVMKGSKRAADVICDVVESSSDMFQDTIKLKLEEFEKEWNITTDEEKGNFQKNLVIFYECYQIGKVHLFNMKDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEININLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLYFKEKANAHLHTAVNFIFKGTIDSPEKQSLKMIGRLINQLTDNLFPQMYQEANSDSCSCCCWKSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCC-CCFKINGDEESSKEMKYTVYPIRNKNKQIIY--TEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMRYQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNIFQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXEDFKRTEYLSKFRKEQHESLDEVGFCSAIRFFYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFMGGQVKN-FISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDFIYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQVD-TSYMEGSQCLFGYCATPNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKL----NICKNSNNGRLSVDAFIANLIHEEDLECSGFEQQCMETYLITNQL------LDLSAHDASKTWFKSDDSITNEPSNVAIEAHVKALVGSIAE 3597
            +G I+  GY  I+   NP+++R      N   EL    Y+L+T  W F KP+L+IS+NGG K M   NN QK  FK+GL++V +  +TWI+ GGF  G+ KLV EA  D+ ILS   +    ++ I TWG   N   L + T      Y N +   + KG+  LDP +D ++  DDG+++++ +EI FR +FE +V ++     VQ++ EGGK  I++   +L+ +IP+VV+K S RAAD+IC+++E+      D + +++ +  +E    TD++K    + L   Y  Y+                     E      + DQ +  + K+  A+  +R D   ++     VR N ++I                  DF + Q     +    ++   +YFKE  + + H  +           E             + +NL         S  C C    +  ISD     D S ++ +           P  N     +KI  +  S   +K+  + +R+ N       + ++LFLW+L++   EMA IFW+ GK+++GSAL+ +++ S ++    +KG  ++ +  ++   +F+ LA +I+++AY+ +Q +TH++L R L  W   +CL IA    L++FL  +AC++     W+G +  F+  ++IL+ +PF  L  + FI PY             +N +  + L  +   +      EKI + N +  +                       K  K  H   D+V FC A+  FY API KFV+ ++SY+ FL +F+Y  L+EL  I       +   E  +YIF + F++ EI Q  +    KN  I K  ++ S  WN +D+    +F I+ I+R TVN   FI+ R  ++++LS+F +R M+FY++ +S+GPKVIMI +M+ D+ FFL+I+ + + +YGT S S+  PN      L+  +FY PY+Q +G++    +   S C    C   +A + +    FLL TN+LLL+LLIAMFG TF K++  S + ++F + ++++EF+ +P++PPP N+   +Y   KL     I  + ++ R +    I  L  +++L+  GFE  CME+ ++ N        ++L++ +   T  K+ + I  + +N + +  + + +G I +
Sbjct:   36 FGKIKFLGYEDISLNTNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGGFKRMNFKNNQQKKNFKQGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGT----CAYDNSNT--IEKGKVTLDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNV-RDIGAFAVQILYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEILET------DKMNVEIVDKYEEQLRLTDDDKIRIIEILSDIYSNYK---------------------ERITIHDLLDQNVHLDKKILDAIISSREDRNLEKTLNLAVRFNCVDI-----------------ADFKVFQSSRASTLSQKTL--GIYFKEMLSKNQHEMLQLFLVNNFSIDE------------FVQENLQDLYMTSLRSIKCRC----TEMISDLILREDKSFKIDN--------INNPGKNLLKVIYKIICNL-SDNILKFESFNLRSSNSHNANQNSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPY------------VSNKKSCSNLSHEKVKDKFLFEKEKI-ELNIRKKS----------------------PKSWKSYHSESDQVSFCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQ--INNTEKNGLIYKLKSYVSGSWNLYDMLTIFIFIISIIMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVFFFLSIFSLFIISYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELMLDDFKIPSPCNTTVCIVQSATLIIGFGIFLLMTNILLLNLLIAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNI--AYYILRKLWQSGKIIFHGDSKRKNT-FLIKYLNDDQNLKIRGFEHLCMESAMLENHQSTNVANINLNSDNLFDTILKNLELINEKLNNKSSDKAITSRLGVIEK 1089          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Planmine SMEST
Match: SMESG000004977.1 (SMESG000004977.1)

HSP 1 Score: 398.667 bits (1023), Expect = 1.095e-119
Identity = 325/1057 (30.75%), Postives = 522/1057 (49.39%), Query Frame = 1
Query:  148 YGAIQLSGYR-VIAGKNPKYVRVH-KDLSNIKGELYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSKSASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTV--LGIGTWGATYNKEKLAMQTEDDRITYPNYD-PQKVGKGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKEADCSVVQLIVEGGKNTIQTGAEALKSNIPVVVMKGSKRAADVICDVVESSSDMFQDTIKLKLEEFEKEWNITTDEEKGNFQKNLVIFYECYQIGKVHLFNMKDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEININLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLY---FKEKANAHLHTAVNFIF--KGTIDSPEKQS---LKMIGRLINQLTDNLFPQMYQEANSDSCSCCCWKSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMRYQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNIFQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXEDFKRTEYLSKFRKEQHESLDEVGFCSAIRFFYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDFIYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQ--VDTSYMEGSQCLFGYCATPNAIVQVANAXXXXXXXXXXXXXXIAMFGVTFMKVEENSNRVWAFTRYRMIEEF 3273
            +G I  +GY  +I    P ++R + +D   I   +YKLM   W F KP+LIIS+ GG K M    N QK  FK+ LI+V K   TWI+ GGF  G+  L+ EA  +Y       +  V  LGI TWGA  N + L  +        P Y   +K  KG+  LD + D F+  DDG+++++ +E  FR +FE+ V +  + +VVQ++ EGG   +++   +LK++IP+V++K S RAADVI  +++     + + IK  L   +   NI  +++   FQ+ L   YE Y+  ++ + ++ D    LD  I+EA  S +I D  L  E  L + + FN  D+AE+++F N   ++     L    +  L  NQ +FV  FL    ++E FLT   L  LY      K +   +  V+FI       DS  K+S   L  + R+IN ++ N+                                           E +  +P         I  DEE+ +    +   + +K      T QDLFLWALLT+  E+A IFWK G++HIGSAL+A+++ + ++     +G  +      R  ++F+ +AI +++EA+ + Q  T+ LLIR L  W   +CL IA    L+ FL  SAC + +  IW G++  F+ +++ILI++PF ++  +  I P         Q  Q+  S    E  + +F               Y+ N+               FKR  + S+ +K+       + +   I+ FY  PI KFV+++ISY+ FL +F Y  L+EL    L+    +R  E  I+ + +  +  EI Q  +  +    I K   + S  WN +D+   +V+ I + LR  ++   FI  R  +S++LSM  +R M++Y++  ++GPKVIMI RM+ DI FFL I L    +    +M+L          L+  IFY PY+Q +G+  +D  +                 +    A FLL TN+LL++LLIAMFG TF K++  S++ ++F + +++EEF
Sbjct:   58 FGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMNFNTNQQKKNFKQSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNEN-------PTYHFTKKTEKGKVLLDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVRENDNGNVVQILYEGGSRALESAYNSLKASIPLVLIKNSGRAADVINAILDLKMTSYLEKIKSILSANQSTMNI-DEKDIEKFQEILREIYEKYR-NQIFVHDLFDKSMKLDRKIVEAVIS-SIDDNDL--EKILKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPSRCGYLLVDFIATTDKNFDSKRKKSKYLLYPVRRIINMMSGNILQN----------------------------------------ENIHPKPGRQL-----IRTDEENFEFQSQSFIEVHSKK----ITPQDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGYSDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWKILISIPFSFILIKPLIMP------SVNQPTQSERSNESAESQTPEFM--------------YEANS--------------PFKR--HYSQSKKKA-----SIPYKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELK---LNLKIQNRWAEIFIFFYVLGIITEEIRQ-IIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDIFFFLTIALQDNRSR---AMNL---------SLITEIFYRPYFQTYGELMLDEFHTNDENITDIDRTIGRMTIICGFAVFLLLTNILLINLLIAMFGHTFNKIQVESHKFFSFIQLQLVEEF 996          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Planmine SMEST
Match: SMESG000005064.1 (SMESG000005064.1)

HSP 1 Score: 318.546 bits (815), Expect = 1.849e-90
Identity = 230/833 (27.61%), Postives = 418/833 (50.18%), Query Frame = 1
Query:  601 KGQSPLDPYHDAFILYDDGSDRKFGREIKFRTEFEESVSKEADCSVVQLIVEGGKNTIQTGAEALKSNIPVVVMKGSKRAADVICDVVESSSDMFQDTIKLKLEEFEKEWNITTDEEKGNFQKNLVIFYECYQIGK--VHLFNMKDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMTFNRADVAEQRIFENQVRKNEININLRPFMETALIRNQWQFVDFFLRQGLTVESFLTNSMLRDLY----------FKEKANAHLHTA-VNFIFKGTIDSPEKQSLKMIGRLINQLTDNLFPQMYQEANSDSCSCCCWKSPKISDSQSFNDSSCEVIDYEKYIEPVATEPTTNCCCCFKINGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFLWALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNNWMRYQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKNQLINFLFHSACQTRLNNIWLGKIPNFVNIFQILINVPFGYLTSRIFIFPYNLLGKRQTQAVQTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQFXXXXXXXXXXEDFKRTEYLSKFRKEQHESLDEVGFCSAIRFFYTAPITKFVMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLGEIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDSDFIYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDXXXXXXXXXXXXXXXGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQV 3060
            KG+  LD  HD F+  DDG+++++ RE++FR +FE  +  + D  +VQ++ EGG+  ++     L   IP+V++KGS   A++I  V+E  +   ++ I   + E +  +    ++ KG   + +    E Y+  K  + +++M +     D  I+EA   G   +  L  +  L L + F    +A + +F +   +      +       L  N+ +F++ F+     VE F+ + +LRDLY            E  +    +A   +  K   +  +   L +IG+++ +L+ N+   +Y++          +K     +    ND+  +                        +N DE S  E  Y       +N  +    Q+LFLWALL+   EM+ +FWK  KD IGSAL+A+ +  S+      +G+  +   +    ++++ L++ IL+EAY++++++T++LLIR L  W   +CL IA  + ++ FL HSAC++ +  +W+G++   ++ ++I++ +PF ++  +  I P                + P  +++  D S+    S  K+++                       K  E    +  ++ ES +++ +  A+R FY A I KF + ++SY++FL +F Y  L+EL  +    +      E  IYI+  +F+  EI Q     ++   I+K   + S +WN  D+ I  +F ++ ILR ++  ++F+ CR  F+++LSMF+IR M+FY++ QS+GPKVIMI  ML+DILFFL+I++I L AYGT   SL +PN      L ++I Y PY+Q FG++
Sbjct:  431 KGKHTLDGLHDNFLFCDDGTEKQYDREVEFRLKFENYLKNKTDAFLVQILFEGGRMAMEHVYTVLNDEIPIVIVKGSGGIANLIASVMELPNSKHKENISALVNENQHLF----EKSKGEITEYINFLCEIYRKYKRQIVIYDMMNNNMKFDKKILEAMILGY--NNSL--DKTLKLCIRFKCPKIANRAVFSDSKYQKISRKTIEKMFINCLKENRPEFIELFIENNFEVEKFINDEILRDLYQISFNPDQCQCAELLSELCRSARTTYFTKKNENEIDLDILYIIGKVVQKLSGNVIKNLYEK----------YKFSTEKNKLVLNDAEIQ------------------------LNNDETSFNEDFY------EENGLLSLNAQNLFLWALLSGMTEMSLVFWKINKDQIGSALLASTILRSMASLMLKRGDNNLEKKFSETSKKYQDLSVLILTEAYKKNKMKTYILLIRELKKWNNTTCLQIATNSDMLEFLNHSACRSYITKVWMGELSPILSNWKIILTIPFSFIFIKPLIIP----------------TFPPKKIMH-DESDKMDSSEMKLLE-----------------------KTEEVQYSYPVKRIES-EKISYREAMRVFYGATIVKFYIYLLSYVSFLLIFIYLNLVELKPLEDVKSIKDVLAEIYIYIYVFTFICEEIRQV-TDQKITGLINKAKEYFSGIWNKIDVFIISLFFLSVILRFSIPKTNFMSCRCCFAVTLSMFFIRAMQFYFINQSIGPKVIMIREMLRDILFFLSIFIIFLLAYGTLFQSLKFPNSKFDLNLFKDIVYLPYFQTFGEL 1173          
The following BLAST results are available for this feature:
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRPM32.014e-9026.41transient receptor potential cation channel subfam... [more]
TRPM34.396e-8926.56transient receptor potential cation channel subfam... [more]
TRPM37.308e-8826.72transient receptor potential cation channel subfam... [more]
TRPM31.312e-8726.81transient receptor potential cation channel subfam... [more]
TRPM31.312e-8726.81transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gtl-23.200e-7926.57Gon-Two Like (TRP subfamily) [Source:UniProtKB/Tr... [more]
gtl-16.999e-3327.25GTL-1; Gon-Two Like (TRP subfamily) [Source:UniPr... [more]
gon-23.058e-2626.51Transient receptor potential channel [Source:UniP... [more]
gon-23.814e-2626.51Transient receptor potential channel [Source:UniP... [more]
gon-24.784e-2626.51Transient receptor potential channel [Source:UniP... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trpm1.622e-8626.69gene:FBgn0265194 transcript:FBtr0339075[more]
Trpm4.170e-8626.64gene:FBgn0265194 transcript:FBtr0339079[more]
Trpm4.835e-8626.64gene:FBgn0265194 transcript:FBtr0339076[more]
Trpm5.703e-8626.64gene:FBgn0265194 transcript:FBtr0339074[more]
Trpm8.454e-8626.68gene:FBgn0265194 transcript:FBtr0339077[more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpm1b4.530e-8126.78transient receptor potential cation channel, subfa... [more]
trpm51.543e-8025.33transient receptor potential cation channel, subfa... [more]
trpm52.078e-8025.29transient receptor potential cation channel, subfa... [more]
trpm52.304e-8025.69transient receptor potential cation channel, subfa... [more]
trpm1a1.866e-7525.68transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aldh3a21.838e-9326.66aldehyde dehydrogenase 3 family member A2 [Source:... [more]
aldh3a25.492e-9226.89aldehyde dehydrogenase 3 family member A2 [Source:... [more]
aldh3a21.477e-9126.53aldehyde dehydrogenase 3 family member A2 [Source:... [more]
aldh3a21.598e-9126.53aldehyde dehydrogenase 3 family member A2 [Source:... [more]
aldh3a22.056e-9127.15aldehyde dehydrogenase 3 family member A2 [Source:... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trpm32.377e-9026.66transient receptor potential cation channel, subfa... [more]
Trpm32.377e-9026.37transient receptor potential cation channel, subfa... [more]
Trpm31.397e-8826.29transient receptor potential cation channel, subfa... [more]
Trpm32.757e-8726.49transient receptor potential cation channel, subfa... [more]
Trpm73.591e-8625.00transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A7T1N0|TMP2L_NEMVE3.766e-10426.47Transient receptor potential cation channel subfam... [more]
sp|Q96QT4|TRPM7_HUMAN2.449e-8625.43Transient receptor potential cation channel subfam... [more]
sp|Q925B3|TRPM7_RAT1.191e-8525.17Transient receptor potential cation channel subfam... [more]
sp|Q9HCF6|TRPM3_HUMAN1.531e-8526.08Transient receptor potential cation channel subfam... [more]
sp|Q923J1|TRPM7_MOUSE2.903e-8525.00Transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A077LAN80.000e+065.44Transient receptor potential ion channel M b (Frag... [more]
R7TUH64.976e-13829.07Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A210PMT12.219e-13731.11Transient receptor potential cation channel subfam... [more]
A0A1S3HH512.483e-13230.67transient receptor potential cation channel subfam... [more]
A0A1S3HED02.676e-13030.88transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpm77.026e-8925.46transient receptor potential cation channel subfam... [more]
trpm74.113e-8825.04transient receptor potential cation channel subfam... [more]
trpm74.518e-8825.28transient receptor potential cation channel subfam... [more]
trpm75.680e-8825.28transient receptor potential cation channel subfam... [more]
trpm75.780e-8825.04transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
trpm72.127e-7425.05transient receptor potential cation channel, subfa... [more]
trpm75.790e-6423.75transient receptor potential cation channel, subfa... [more]
trpm27.700e-5527.16transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO301351.544e-10526.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476581.280e-8827.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpm76.170e-9025.35transient receptor potential cation channel subfam... [more]
trpm76.890e-9025.35transient receptor potential cation channel subfam... [more]
trpm78.834e-9025.35transient receptor potential cation channel subfam... [more]
trpm22.083e-5628.30transient receptor potential cation channel subfam... [more]
trpm23.237e-5628.30transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000035341.10.000e+0100.00SMESG000035341.1[more]
SMESG000004955.18.578e-13229.27SMESG000004955.1[more]
SMESG000004955.18.794e-13229.27SMESG000004955.1[more]
SMESG000004977.11.095e-11930.75SMESG000004977.1[more]
SMESG000005064.11.849e-9027.61SMESG000005064.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029075 ID=SMED30029075|Name=Transient receptor potential cation channel subfamily M member 2|organism=Schmidtea mediterranea sexual|type=transcript|length=3710bp
CGAGAACTTATTTACTTTTAAATTTTAAGTATTAATAAAAGGTTATAGTT
AATAAATATTTTCTAATAGAAATTTATTACAAGCATGGAAAGTCATCCTA
GTGTCGAGAGCGATTGTTCTGAGTTTTGGAGGCATGAGAAATTTCAGTAC
GGTGCTATACAGTTGAGTGGATATAGAGTTATTGCTGGTAAAAATCCAAA
ATATGTTCGAGTCCATAAAGACTTAAGTAATATTAAGGGAGAATTGTATA
AACTCATGACTAATGTTTGGGGCTTTAAAAAACCTAAGTTAATAATTTCA
TTAAATGGAGGAGCTAAAAATATGATACCTTTGAATAATGATCAAAAGTT
GGCATTTAAAAGAGGCCTTATAGATGTCTCTAAATCGGCATCAACATGGA
TCGTAACTGGTGGTTTCGAGACCGGAGTTTCAAAATTAGTCGGAGAAGCT
TCAAAAGACTATTCAATTTTATCAAAGAAACAAACTTTTACAGTGCTTGG
TATTGGAACATGGGGGGCTACCTATAACAAAGAAAAATTAGCAATGCAAA
CAGAAGATGATAGAATAACATATCCTAACTATGATCCTCAAAAAGTAGGT
AAAGGCCAGTCTCCTTTAGATCCTTATCACGATGCCTTTATTTTGTATGA
TGATGGAAGTGACAGAAAATTTGGACGTGAAATTAAATTTCGCACTGAAT
TCGAAGAATCTGTTTCAAAAGAAGCTGATTGTAGCGTCGTACAATTGATA
GTCGAGGGAGGTAAAAATACGATTCAAACGGGGGCCGAAGCATTGAAATC
TAACATTCCTGTAGTTGTGATGAAAGGTTCCAAACGTGCAGCCGATGTAA
TTTGCGATGTTGTCGAATCTTCTTCTGATATGTTTCAAGATACAATCAAA
TTGAAGTTAGAAGAATTTGAAAAAGAATGGAACATAACGACAGATGAGGA
AAAAGGAAATTTTCAAAAAAACCTTGTTATTTTTTATGAGTGCTATCAAA
TTGGAAAAGTACATTTATTCAATATGAAGGACTTTAAAAATAATCTCGAC
ACGGCAATTATTGAAGCAGCCTTTTCAGGAACAATTAAGGATCAGCCATT
AGGAGACGAGGCTAAACTCTGGTTGGCCATGACGTTCAATCGCGCGGATG
TTGCTGAACAAAGGATATTTGAAAACCAAGTCAGGAAAAATGAGATCAAT
ATTAATTTGCGACCGTTTATGGAAACGGCATTAATAAGGAACCAATGGCA
ATTTGTGGATTTTTTTCTCCGACAAGGATTAACAGTAGAGTCTTTTCTTA
CTAACTCAATGTTGCGTGACTTATACTTCAAAGAAAAAGCAAATGCTCAT
TTACACACGGCGGTTAATTTCATATTCAAAGGCACAATTGATTCGCCGGA
AAAGCAGAGCTTAAAAATGATAGGGAGACTAATCAATCAATTAACAGATA
ATCTTTTCCCACAAATGTATCAAGAAGCCAATTCAGATTCTTGTTCGTGT
TGTTGCTGGAAAAGTCCCAAAATCAGCGACTCTCAGTCATTTAATGATTC
ATCCTGTGAAGTGATTGACTATGAAAAATATATTGAGCCTGTAGCCACGG
AGCCAACTACTAATTGCTGTTGCTGCTTCAAGATAAATGGCGATGAAGAA
TCGAGTAAAGAAATGAAATATACCGTCTATCCGATAAGAAATAAAAACAA
ACAGATAATATATACTGAACAAGATCTGTTTTTGTGGGCTTTATTGACAC
AAAGAATTGAAATGGCGAAGATTTTCTGGAAATGCGGAAAAGACCACATT
GGTTCGGCGTTAGTGGCAACCGTGGTTTGTAGTTCACTCCAGAAAAAAGC
TGGGGCGAAAGGTGAAATTGAAATAATGAACAATTGGATGAGATATCAGG
AAGAGTTCGAAACATTGGCTATCAACATTTTATCTGAAGCCTATCGTAGA
GATCAAATTCGAACTCACCTTCTATTAATCAGAGCCCTACCTTACTGGGG
TAGAGAATCGTGCTTGGATATCGCCAACAAAAACCAACTCATTAACTTTT
TGTTTCACAGTGCTTGCCAGACAAGACTCAATAACATATGGCTCGGTAAA
ATTCCGAATTTTGTGAATATATTTCAGATTTTAATAAACGTACCTTTTGG
CTATTTAACTTCAAGGATATTTATCTTTCCATATAATCTTCTTGGCAAAA
GGCAAACCCAAGCAGTACAAACTAACAACAGTGAACCAGGAACTGAGTTG
TTGTCAAAGGATTTCAGTGAACATAGACAAAAGTCATCGGAAAAAATTAT
TCAACCAAATTATCAGAATAACACTTTACAATTTAAGAAAATTAAAAAGA
AATTAAAAATAAAAGAAGATTTTAAAAGAACGGAGTATTTGTCCAAGTTT
CGCAAAGAACAACATGAATCATTGGACGAAGTCGGGTTTTGTTCAGCCAT
AAGGTTTTTCTATACAGCTCCAATAACAAAATTTGTGATGAATATTATAT
CATATCTGGCCTTTTTGACGATGTTCAGTTATTTCCTCTTAATAGAATTG
AACACAATTACTTTAAGCCCCACAGCTTATAGTAGAAAAATAGAATATTG
TATTTATATTTTCTACATTTCATTTTTATTAGGAGAAATCTATCAATTTT
TTATGGGAGGTCAAGTCAAAAATTTTATCAGTAAATTTAATAACTGGAAA
TCTTCGATGTGGAATTGGTTTGATCTTGGTATTTATATCGTGTTCACAAT
TGCCTATATTTTACGAAATACTGTGAATGATTCGGACTTTATATACTGCC
GGACCCTGTTTTCCATTTCCCTCAGTATGTTCTATATTCGGTTTATGGAG
TTCTATTATGTCCAACAAAGTGTCGGGCCAAAAGTGATCATGATTAGCAG
AATGTTAAAGGACATTTTATTTTTCTTGGCTATATATTTGATAGCATTAT
TTGCCTACGGAACATTTTCTATGTCTTTATTGTATCCGAATATAAACATC
ACGAGTCCATTGATGAGAAATATTTTTTATAATCCTTATTGGCAATTGTT
TGGTCAAGTTGACACTTCTTATATGGAAGGCAGTCAGTGTCTTTTTGGAT
ATTGTGCAACTCCAAATGCAATAGTCCAAGTTGCTAATGCTTTCTTTTTA
TTATTCACCAACGTTTTACTGCTCAGTCTTCTTATTGCTATGTTTGGAGT
CACATTTATGAAGGTAGAAGAAAACTCGAATCGTGTTTGGGCGTTTACTC
GATATCGGATGATTGAAGAATTCTACTACCGACCAATTTTGCCACCCCCT
TTCAATGTCTTCGAAGTTTTCTATAATTTTTTCAAGTTGAATATCTGCAA
AAATTCTAACAATGGCCGGTTATCGGTTGATGCATTCATTGCGAATTTGA
TCCACGAAGAAGACCTTGAATGTTCCGGTTTTGAACAACAGTGCATGGAG
ACATATTTAATAACCAACCAATTGTTAGATCTTTCAGCTCATGATGCTAG
TAAAACATGGTTCAAATCTGATGATTCCATAACCAATGAACCGTCTAATG
TTGCTATAGAGGCCCACGTAAAAGCTCTTGTTGGTTCTATTGCAGAAATA
AAAGATGAATTAAAAAGTCTAAATGAGAAAGTTTATAAAATAAGAAGACT
ACAAAAGAAAACTGTGATTTCAGGAAATAATTAAGCCATGAAATTAGATT
AACTTTTCTT
back to top

protein sequence of SMED30029075-orf-1

>SMED30029075-orf-1 ID=SMED30029075-orf-1|Name=SMED30029075-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1200bp
MESHPSVESDCSEFWRHEKFQYGAIQLSGYRVIAGKNPKYVRVHKDLSNI
KGELYKLMTNVWGFKKPKLIISLNGGAKNMIPLNNDQKLAFKRGLIDVSK
SASTWIVTGGFETGVSKLVGEASKDYSILSKKQTFTVLGIGTWGATYNKE
KLAMQTEDDRITYPNYDPQKVGKGQSPLDPYHDAFILYDDGSDRKFGREI
KFRTEFEESVSKEADCSVVQLIVEGGKNTIQTGAEALKSNIPVVVMKGSK
RAADVICDVVESSSDMFQDTIKLKLEEFEKEWNITTDEEKGNFQKNLVIF
YECYQIGKVHLFNMKDFKNNLDTAIIEAAFSGTIKDQPLGDEAKLWLAMT
FNRADVAEQRIFENQVRKNEININLRPFMETALIRNQWQFVDFFLRQGLT
VESFLTNSMLRDLYFKEKANAHLHTAVNFIFKGTIDSPEKQSLKMIGRLI
NQLTDNLFPQMYQEANSDSCSCCCWKSPKISDSQSFNDSSCEVIDYEKYI
EPVATEPTTNCCCCFKINGDEESSKEMKYTVYPIRNKNKQIIYTEQDLFL
WALLTQRIEMAKIFWKCGKDHIGSALVATVVCSSLQKKAGAKGEIEIMNN
WMRYQEEFETLAINILSEAYRRDQIRTHLLLIRALPYWGRESCLDIANKN
QLINFLFHSACQTRLNNIWLGKIPNFVNIFQILINVPFGYLTSRIFIFPY
NLLGKRQTQAVQTNNSEPGTELLSKDFSEHRQKSSEKIIQPNYQNNTLQF
KKIKKKLKIKEDFKRTEYLSKFRKEQHESLDEVGFCSAIRFFYTAPITKF
VMNIISYLAFLTMFSYFLLIELNTITLSPTAYSRKIEYCIYIFYISFLLG
EIYQFFMGGQVKNFISKFNNWKSSMWNWFDLGIYIVFTIAYILRNTVNDS
DFIYCRTLFSISLSMFYIRFMEFYYVQQSVGPKVIMISRMLKDILFFLAI
YLIALFAYGTFSMSLLYPNINITSPLMRNIFYNPYWQLFGQVDTSYMEGS
QCLFGYCATPNAIVQVANAFFLLFTNVLLLSLLIAMFGVTFMKVEENSNR
VWAFTRYRMIEEFYYRPILPPPFNVFEVFYNFFKLNICKNSNNGRLSVDA
FIANLIHEEDLECSGFEQQCMETYLITNQLLDLSAHDASKTWFKSDDSIT
NEPSNVAIEAHVKALVGSIAEIKDELKSLNEKVYKIRRLQKKTVISGNN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016787hydrolase activity
GO:0005216ion channel activity
GO:0005227calcium activated cation channel activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR041491TRPM_SLOG
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0006812cation transport
GO:0016048detection of temperature stimulus
GO:0034220ion transmembrane transport
GO:0050951sensory perception of temperature stimulus
GO:0051262protein tetramerization
GO:0055085transmembrane transport
GO:0098655cation transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1177..1204
NoneNo IPR availablePANTHERPTHR13800TRANSIENT RECEPTOR POTENTIAL CATION CHANNEL, SUBFAMILY M, MEMBER 6coord: 22..1201
NoneNo IPR availableTMHMMTMhelixcoord: 891..910
NoneNo IPR availableTMHMMTMhelixcoord: 854..876
NoneNo IPR availableTMHMMTMhelixcoord: 815..834
NoneNo IPR availableTMHMMTMhelixcoord: 959..981
NoneNo IPR availableTMHMMTMhelixcoord: 917..939
NoneNo IPR availableTMHMMTMhelixcoord: 1034..1056
IPR041491TRPM, SLOG domainPFAMPF18139LSDAT_eukcoord: 39..290
e-value: 1.7E-51
score: 175.2