Monoacylglycerol lipase ABHD12

Overview
NameMonoacylglycerol lipase ABHD12
Smed IDSMED30029065
Length (bp)597
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Monoacylglycerol lipase ABHD12 (SMED30029065) t-SNE clustered cells

Violin plots show distribution of expression levels for Monoacylglycerol lipase ABHD12 (SMED30029065) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Monoacylglycerol lipase ABHD12 (SMED30029065) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Monoacylglycerol lipase ABHD12 (SMED30029065) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029065

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30029065SMESG000046035.1 SmedASXL_004493SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30029065SMESG000046035.1 dd_Smed_v6_18185_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Monoacylglycerol lipase ABHD12 vs. Ensembl Celegans
Match: abhd-12 (ABHydrolase Domain containing homolog [Source:UniProtKB/TrEMBL;Acc:Q965S2])

HSP 1 Score: 61.2326 bits (147), Expect = 3.829e-11
Identity = 32/97 (32.99%), Postives = 52/97 (53.61%), Query Frame = 3
Query:  195 NFGFTMRNLRNFRIRNTNYNYELGACLATFFAPILIMHAEDDQVISVEMGQQLYSSIFDIKTDTFFKRFSYLLQLGHSGITTYDNLPKLIKDFTAAA 485
            + G TMR+ +  R         L +C      PI+I+HAEDD+++ V++G+ LY +  D + D   + FS    LGH  I  Y  LP++I++F  + 
Sbjct:  254 SVGLTMRSDKRIR---------LVSC------PIIILHAEDDKILPVKLGRALYEAAKDAERDIKIREFSSDYGLGHKFICRYPELPEIIEEFVGSV 335          
BLAST of Monoacylglycerol lipase ABHD12 vs. Ensembl Celegans
Match: abhd-12 (ABHydrolase Domain containing homolog [Source:UniProtKB/TrEMBL;Acc:Q965S2])

HSP 1 Score: 61.2326 bits (147), Expect = 3.829e-11
Identity = 32/97 (32.99%), Postives = 52/97 (53.61%), Query Frame = 3
Query:  195 NFGFTMRNLRNFRIRNTNYNYELGACLATFFAPILIMHAEDDQVISVEMGQQLYSSIFDIKTDTFFKRFSYLLQLGHSGITTYDNLPKLIKDFTAAA 485
            + G TMR+ +  R         L +C      PI+I+HAEDD+++ V++G+ LY +  D + D   + FS    LGH  I  Y  LP++I++F  + 
Sbjct:  254 SVGLTMRSDKRIR---------LVSC------PIIILHAEDDKILPVKLGRALYEAAKDAERDIKIREFSSDYGLGHKFICRYPELPEIIEEFVGSV 335          
BLAST of Monoacylglycerol lipase ABHD12 vs. Ensembl Fly
Match: CG15111 (gene:FBgn0034419 transcript:FBtr0086581)

HSP 1 Score: 46.595 bits (109), Expect = 5.712e-6
Identity = 30/92 (32.61%), Postives = 42/92 (45.65%), Query Frame = 3
Query:  225 NFRIRNTNY----NYELGACLATFFAPILIMHAEDDQVISVEMGQQLYSSIFDIKTDTF----FKRFSYLLQLGHSGITTYDNLPKLIKDFT 476
            NF I    Y     +E    +  F  PI+I+HAEDD V+   +G +LY    D ++ T     F RF    + GH  +     LP LI+ F 
Sbjct:  294 NFTISQPMYTNRLRFESDVHVLEFRQPIMIIHAEDDVVVPFNLGYRLYRIALDGRSRTSGPVEFHRFGASRKYGHKYLCRAPELPGLIQKFV 385          
BLAST of Monoacylglycerol lipase ABHD12 vs. Ensembl Fly
Match: CG15111 (gene:FBgn0034419 transcript:FBtr0086580)

HSP 1 Score: 46.2098 bits (108), Expect = 6.623e-6
Identity = 30/92 (32.61%), Postives = 42/92 (45.65%), Query Frame = 3
Query:  225 NFRIRNTNY----NYELGACLATFFAPILIMHAEDDQVISVEMGQQLYSSIFDIKTDTF----FKRFSYLLQLGHSGITTYDNLPKLIKDFT 476
            NF I    Y     +E    +  F  PI+I+HAEDD V+   +G +LY    D ++ T     F RF    + GH  +     LP LI+ F 
Sbjct:  312 NFTISQPMYTNRLRFESDVHVLEFRQPIMIIHAEDDVVVPFNLGYRLYRIALDGRSRTSGPVEFHRFGASRKYGHKYLCRAPELPGLIQKFV 403          
BLAST of Monoacylglycerol lipase ABHD12 vs. TrEMBL
Match: Q965S2 (Hydrolase_4 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=abhd-12 PE=1 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 1.444e-7
Identity = 32/97 (32.99%), Postives = 52/97 (53.61%), Query Frame = 3
Query:  195 NFGFTMRNLRNFRIRNTNYNYELGACLATFFAPILIMHAEDDQVISVEMGQQLYSSIFDIKTDTFFKRFSYLLQLGHSGITTYDNLPKLIKDFTAAA 485
            + G TMR+ +  R         L +C      PI+I+HAEDD+++ V++G+ LY +  D + D   + FS    LGH  I  Y  LP++I++F  + 
Sbjct:  254 SVGLTMRSDKRIR---------LVSC------PIIILHAEDDKILPVKLGRALYEAAKDAERDIKIREFSSDYGLGHKFICRYPELPEIIEEFVGSV 335          
BLAST of Monoacylglycerol lipase ABHD12 vs. TrEMBL
Match: A0A1W0XBM8 (Monoacylglycerol lipase ABHD12 OS=Hypsibius dujardini OX=232323 GN=BV898_01131 PE=4 SV=1)

HSP 1 Score: 56.6102 bits (135), Expect = 5.366e-6
Identity = 33/91 (36.26%), Postives = 45/91 (49.45%), Query Frame = 3
Query:  201 GFTMRNLRNFRIRNTNYNYELGACLATFFAPILIMHAEDDQVISVEMGQQLYSSIFDIKTDTFFKRFSYLLQLGHSGITTYDNLPKLIKDF 473
            GFT    +  +I   N N    A + T   PILI+HAEDD V+   +GQ+LY+          F  F   L  GH GI    +LP+++ DF
Sbjct:  242 GFTETVAKAMKIMEVNLNNS--AAVLTLRLPILILHAEDDNVVPFHLGQKLYNIAQTRDAPVSFVTFRRELGYGHKGIYQDPDLPRIVNDF 330          
BLAST of Monoacylglycerol lipase ABHD12 vs. Ensembl Medaka
Match: ENSORLT00000035678.1 (abhydrolase domain containing 12B [Source:NCBI gene;Acc:101159055])

HSP 1 Score: 51.6026 bits (122), Expect = 1.169e-7
Identity = 30/73 (41.10%), Postives = 39/73 (53.42%), Query Frame = 3
Query:  273 LATFFAPILIMHAEDDQVISVEMGQQLYSSIFDIK----TDTFFKRFSYLLQLG--HSGITTYDNLPKLIKDF 473
            L T   P+LI+HAEDD V+   MGQQLY    + +    TD      SY   LG  HS I    +LP+++K F
Sbjct:  246 LKTLTCPLLILHAEDDNVVPHRMGQQLYQVSLEAQREFGTDDRVAMVSYPADLGFSHSNIYMDPSLPEIVKKF 318          
BLAST of Monoacylglycerol lipase ABHD12 vs. Planmine SMEST
Match: SMESG000046035.1 (SMESG000046035.1)

HSP 1 Score: 178.718 bits (452), Expect = 4.442e-56
Identity = 87/87 (100.00%), Postives = 87/87 (100.00%), Query Frame = 3
Query:  273 LATFFAPILIMHAEDDQVISVEMGQQLYSSIFDIKTDTFFKRFSYLLQLGHSGITTYDNLPKLIKDFTAAALAQNFTGIQMMFNTDN 533
            LATFFAPILIMHAEDDQVISVEMGQQLYSSIFDIKTDTFFKRFSYLLQLGHSGITTYDNLPKLIKDFTAAALAQNFTGIQMMFNTDN
Sbjct:  180 LATFFAPILIMHAEDDQVISVEMGQQLYSSIFDIKTDTFFKRFSYLLQLGHSGITTYDNLPKLIKDFTAAALAQNFTGIQMMFNTDN 266          

HSP 2 Score: 46.595 bits (109), Expect = 3.201e-6
Identity = 20/21 (95.24%), Postives = 20/21 (95.24%), Query Frame = 3
Query:  210 MRNLRNFRIRNTNYNYELGAC 272
            MRNLRNFRIRNTNYNYELGA 
Sbjct:    1 MRNLRNFRIRNTNYNYELGAW 21          
BLAST of Monoacylglycerol lipase ABHD12 vs. Planmine SMEST
Match: SMESG000018264.1 (SMESG000018264.1)

HSP 1 Score: 123.635 bits (309), Expect = 1.766e-34
Identity = 61/87 (70.11%), Postives = 67/87 (77.01%), Query Frame = 3
Query:  273 LATFFAPILIMHAEDDQVISVEMGQQLYSSIFDIKTDTFFKRFSYLLQLGHSGITTYDNLPKLIKDFTAAALAQNFTGIQMMFNTDN 533
            L TFFAPILIMHAE+D V++  MGQQLYSS+FD K D FFKRFSYLL  GH  IT Y NLPKLIKDF  AA  QN TG+ M FNTD+
Sbjct:  196 LETFFAPILIMHAEEDNVVNFVMGQQLYSSLFDKKKDVFFKRFSYLLNFGHLRITRYYNLPKLIKDFANAAQKQNSTGLPMTFNTDD 282          

HSP 2 Score: 60.8474 bits (146), Expect = 4.787e-11
Identity = 28/44 (63.64%), Postives = 32/44 (72.73%), Query Frame = 3
Query:  138 IKLVFKGSSNQTEYLKNPENFGFTMRNLRNFRIRNTNYNYELGA 269
            + L   GSS +T+YLK PENF F MRN RNFRI+N  YNYEL A
Sbjct:    1 MHLCHLGSSKRTDYLKYPENFRFNMRNFRNFRIKNAEYNYELSA 44          
BLAST of Monoacylglycerol lipase ABHD12 vs. Planmine SMEST
Match: SMESG000018264.1 (SMESG000018264.1)

HSP 1 Score: 123.635 bits (309), Expect = 3.115e-34
Identity = 61/87 (70.11%), Postives = 67/87 (77.01%), Query Frame = 3
Query:  273 LATFFAPILIMHAEDDQVISVEMGQQLYSSIFDIKTDTFFKRFSYLLQLGHSGITTYDNLPKLIKDFTAAALAQNFTGIQMMFNTDN 533
            L TFFAPILIMHAE+D V++  MGQQLYSS+FD K D FFKRFSYLL  GH  IT Y NLPKLIKDF  AA  QN TG+ M FNTD+
Sbjct:  221 LETFFAPILIMHAEEDNVVNFVMGQQLYSSLFDKKKDVFFKRFSYLLNFGHLRITRYYNLPKLIKDFANAAQKQNSTGLPMTFNTDD 307          

HSP 2 Score: 70.4774 bits (171), Expect = 2.112e-14
Identity = 36/69 (52.17%), Postives = 44/69 (63.77%), Query Frame = 3
Query:  108 LVVYLFPFIIIKLVFKG---------------SSNQTEYLKNPENFGFTMRNLRNFRIRNTNYNYELGA 269
            ++VY+FP I IK+VF+G               SS +T+YLK PENF F MRN RNFRI+N  YNYEL A
Sbjct:    1 MIVYVFPSIFIKVVFQGLLIYFASLMHLCHLGSSKRTDYLKYPENFRFNMRNFRNFRIKNAEYNYELSA 69          
BLAST of Monoacylglycerol lipase ABHD12 vs. Planmine SMEST
Match: SMESG000018264.1 (SMESG000018264.1)

HSP 1 Score: 123.635 bits (309), Expect = 6.300e-34
Identity = 61/87 (70.11%), Postives = 67/87 (77.01%), Query Frame = 3
Query:  273 LATFFAPILIMHAEDDQVISVEMGQQLYSSIFDIKTDTFFKRFSYLLQLGHSGITTYDNLPKLIKDFTAAALAQNFTGIQMMFNTDN 533
            L TFFAPILIMHAE+D V++  MGQQLYSS+FD K D FFKRFSYLL  GH  IT Y NLPKLIKDF  AA  QN TG+ M FNTD+
Sbjct:  264 LETFFAPILIMHAEEDNVVNFVMGQQLYSSLFDKKKDVFFKRFSYLLNFGHLRITRYYNLPKLIKDFANAAQKQNSTGLPMTFNTDD 350          

HSP 2 Score: 58.151 bits (139), Expect = 4.743e-10
Identity = 26/37 (70.27%), Postives = 29/37 (78.38%), Query Frame = 3
Query:  159 SSNQTEYLKNPENFGFTMRNLRNFRIRNTNYNYELGA 269
            SS +T+YLK PENF F MRN RNFRI+N  YNYEL A
Sbjct:   76 SSKRTDYLKYPENFRFNMRNFRNFRIKNAEYNYELSA 112          
BLAST of Monoacylglycerol lipase ABHD12 vs. Planmine SMEST
Match: SMESG000046033.1 (SMESG000046033.1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.536e-16
Identity = 35/81 (43.21%), Postives = 48/81 (59.26%), Query Frame = 3
Query:  288 APILIMHAEDDQVISVEMGQQLYSSIFDIKTDTFFKRFSYLLQLGHSGITTYDNLPKLIKDFTAAALAQNFTGIQMMFNTD 530
             PI+I+HAEDD+++  EMGQ+LYS++     + FFK FS     GH  I  Y  LP LI++FT  AL Q  +G  M    +
Sbjct:  253 VPIIILHAEDDRILKFEMGQKLYSTLKSEGKNVFFKGFSSKFGYGHKHIIRYPELPNLIREFTNGALTQKLSGHSMCLQCN 333          

HSP 2 Score: 54.6842 bits (130), Expect = 7.960e-9
Identity = 28/65 (43.08%), Postives = 40/65 (61.54%), Query Frame = 3
Query:   81 FFIVYILFPLVVYLFPFIIIKLVFKGSSNQTEY--LKNPENFGFTMRNLRNFRIRNTNYNYELGA 269
            F  +YILFPL++YL+P+I+ K +   ++  T +  LK P+ F FT  N R  RI+N     ELGA
Sbjct:    2 FITIYILFPLIIYLYPWILAKCILLNTAFITVFTNLKKPDYFKFTKGNWRYLRIKNNYSKCELGA 66          
The following BLAST results are available for this feature:
BLAST of Monoacylglycerol lipase ABHD12 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Monoacylglycerol lipase ABHD12 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
abhd-123.829e-1132.99ABHydrolase Domain containing homolog [Source:Uni... [more]
abhd-123.829e-1132.99ABHydrolase Domain containing homolog [Source:Uni... [more]
back to top
BLAST of Monoacylglycerol lipase ABHD12 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG151115.712e-632.61gene:FBgn0034419 transcript:FBtr0086581[more]
CG151116.623e-632.61gene:FBgn0034419 transcript:FBtr0086580[more]
back to top
BLAST of Monoacylglycerol lipase ABHD12 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Monoacylglycerol lipase ABHD12 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Monoacylglycerol lipase ABHD12 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Monoacylglycerol lipase ABHD12 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Monoacylglycerol lipase ABHD12 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 2
Match NameE-valueIdentityDescription
Q965S21.444e-732.99Hydrolase_4 domain-containing protein OS=Caenorhab... [more]
A0A1W0XBM85.366e-636.26Monoacylglycerol lipase ABHD12 OS=Hypsibius dujard... [more]
back to top
BLAST of Monoacylglycerol lipase ABHD12 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Monoacylglycerol lipase ABHD12 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Monoacylglycerol lipase ABHD12 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Monoacylglycerol lipase ABHD12 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Monoacylglycerol lipase ABHD12 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000035678.11.169e-741.10abhydrolase domain containing 12B [Source:NCBI gen... [more]
back to top
BLAST of Monoacylglycerol lipase ABHD12 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000046035.14.442e-56100.00SMESG000046035.1[more]
SMESG000018264.11.766e-3470.11SMESG000018264.1[more]
SMESG000018264.13.115e-3470.11SMESG000018264.1[more]
SMESG000018264.16.300e-3470.11SMESG000018264.1[more]
SMESG000046033.11.536e-1643.21SMESG000046033.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029065 ID=SMED30029065|Name=Monoacylglycerol lipase ABHD12|organism=Schmidtea mediterranea sexual|type=transcript|length=597bp
GGAAGCTTATTTTGAATTAGATATAAAAATAATTTAATACTTATATGGCT
TGTCCGTTATACTCATATACAGGATTTTGTTTCTTTATAGTTTATATACT
TTTCCCTTTGGTAGTTTATTTGTTCCCCTTCATAATTATAAAATTAGTTT
TTAAAGGTTCCTCAAACCAAACCGAATATCTAAAAAATCCGGAAAACTTT
GGATTTACTATGAGAAATTTAAGAAATTTCCGTATAAGAAACACAAATTA
CAATTATGAATTGGGTGCATGTTTGGCGACATTTTTTGCGCCGATTCTAA
TAATGCACGCCGAAGACGATCAAGTAATAAGTGTGGAAATGGGACAACAG
CTCTATTCTTCAATTTTTGATATAAAAACTGACACTTTCTTTAAAAGGTT
TTCTTATCTGTTACAGTTGGGACATTCTGGAATCACGACTTATGATAATT
TGCCAAAACTAATCAAAGATTTTACCGCGGCGGCTCTAGCGCAGAATTTT
ACTGGAATACAAATGATGTTTAATACGGATAATTATTGATATAAATATTA
TTTTATTATTAAAATGAAGTTGAAGAATTTGGTTACGCAAGATCGGA
back to top

protein sequence of SMED30029065-orf-1

>SMED30029065-orf-1 ID=SMED30029065-orf-1|Name=SMED30029065-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=165bp
MACPLYSYTGFCFFIVYILFPLVVYLFPFIIIKLVFKGSSNQTEYLKNPE
NFGFTMRNLRNFRIRNTNYNYELGACLATFFAPILIMHAEDDQVISVEMG
QQLYSSIFDIKTDTFFKRFSYLLQLGHSGITTYDNLPKLIKDFTAAALAQ
NFTGIQMMFNTDNY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004622lysophospholipase activity
GO:0047372acylglycerol lipase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR029058AB_hydrolase
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR029058Alpha/Beta hydrolase foldGENE3DG3DSA:3.40.50.1820coord: 22..143
e-value: 2.8E-5
score: 25.4
IPR029058Alpha/Beta hydrolase foldSUPERFAMILYSSF53474alpha/beta-Hydrolasescoord: 60..143
NoneNo IPR availableTMHMMTMhelixcoord: 67..89
NoneNo IPR availableTMHMMTMhelixcoord: 10..32