4Fe-4S ferredoxin-type domain-containing protein

Overview
Name4Fe-4S ferredoxin-type domain-containing protein
Smed IDSMED30029064
Length (bp)2397
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 4Fe-4S ferredoxin-type domain-containing protein (SMED30029064) t-SNE clustered cells

Violin plots show distribution of expression levels for 4Fe-4S ferredoxin-type domain-containing protein (SMED30029064) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 4Fe-4S ferredoxin-type domain-containing protein (SMED30029064) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 4Fe-4S ferredoxin-type domain-containing protein (SMED30029064) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029064

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30029064SMESG000061308.1 dd_Smed_v4_9046_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029064SMESG000061308.1 dd_Smed_v4_9046_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Human
Match: TMEM63A (transmembrane protein 63A [Source:HGNC Symbol;Acc:HGNC:29118])

HSP 1 Score: 202.216 bits (513), Expect = 7.255e-100
Identity = 96/218 (44.04%), Postives = 145/218 (66.51%), Query Frame = 2
Query: 1460 NIVLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFINSKIHRLAMSFTVFA 2113
            N ++++F P+ ++W+ S LLP IVYYS ++  HWTK+ E+  ++ K Y FLI MVLILPSLG+ SL  F  WLF   + + +       C+F P   AFFVNY+I +AFIG   EL+R+P LI+Y +  I+ +++ +   +++N  ++++FG  Y+W+LCVFTV V YS  CP+I PFGLIYI+ K+ VDR+N+YF Y  + +   IH  A++  + A
Sbjct:  460 NPIISQFFPTLLLWSFSALLPSIVYYSTLLESHWTKSGENQIMMTKVYIFLIFMVLILPSLGLTSLDFFFRWLFDKTSSEAS---IRLECVFLPDQGAFFVNYVIASAFIGNGMELLRLPGLILYTFRMIMAKTAADRRNVKQNQAFQYEFGAMYAWMLCVFTVIVAYSITCPIIAPFGLIYILLKHMVDRHNLYFVYLPAKLEKGIHFAAVNQALAA 674          

HSP 2 Score: 184.111 bits (466), Expect = 7.255e-100
Identity = 122/432 (28.24%), Postives = 207/432 (47.92%), Query Frame = 3
Query:  111 DRVN---IYRITNDTAVIYG--FEGIPQNFTINIVTFIILFVLFCFLRKNAWNHGRIALLTKNRRKEQSSTGYNIWNTVTLSEKNENEETDSTEFDEKTYLRRASVIDTTSQFD----KGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGNGTKVKYNDFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIRRTMVPKFCGRFHSCCIEEV-----DVIDYYNDEILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDYHS-SCSLL---NYPQTSALSNDIKSAYWTISYAPPSNVINWENLCHPYKKWLIK 1352
            DR N    Y    ++ V+ G  F GIP    I++  F+ L ++F  +R+  W++GRIAL++                                E D ++  +R S   ++ Q D     G   WL   + + D  I E  G DA  YL FQ+++IF   +++ +SL VILPVN+ G+        F  TTI NL + + ++W+H + + +Y F  +  + H   +++    N    TL I G+P+++     +  HF++AYP C + D+Q  +N+ KLI+L  +++    +          TG R  + PK CG+F  CC E +     D I YY      L  +  +E     D+ +G+AFVTF+    A  +L+D+++  C  L     PQ S+ S ++ ++ WT+++A     I W+NL     +W ++
Sbjct:   25 DRPNDSYCYNSAKNSTVLQGVTFGGIPTVLLIDVSCFLFLILVFSIIRRRFWDYGRIALVS--------------------------------EADSESRFQRLSSTSSSGQQDFENELGCCPWLTAIFRLHDDQILEWCGEDAIHYLSFQRHIIFLLVVVSFLSLCVILPVNLSGDLLDKDPYSFGRTTIANLQTDNDLLWLHTIFAVIYLFLTVGFMRHHTQSIKYKEENLVRRTLFITGLPRDAR-KETVESHFRDAYPTCEVVDVQLCYNVAKLIYLCKEKKKTEKSLTYYTNLQVKTGQRTLINPKPCGQF--CCCEVLGCEWEDAISYYTRMKDRLLERITEEERHVQDQPLGMAFVTFQEKSMATYILKDFNACKCQSLQCKGEPQPSSHSRELYTSKWTVTFAADPEDICWKNLSIQGLRWWLQ 421          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Human
Match: TMEM63B (transmembrane protein 63B [Source:HGNC Symbol;Acc:HGNC:17735])

HSP 1 Score: 193.741 bits (491), Expect = 7.587e-53
Identity = 101/218 (46.33%), Postives = 147/218 (67.43%), Query Frame = 2
Query: 1460 NIVLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFINSKIHRLAMSFTVFA 2113
            N ++ +F P+ ++W  S LLP IVYYS     HWT++ E+   + K YTFLI MVL+LPSLG++SL  F  WLF  + +      F   C+F P N AFFVNY+I +AFIG   +L+RIP L++Y+    + RS+ E   ++++  +EFQFG  Y+W++CVFTV +TYS  CP+IVPFGL+Y++ K+ VDRYN+Y+AY  + ++ KIH  A++  V A
Sbjct:  288 NPIITQFFPTLLLWCFSALLPTIVYYSAFFEAHWTRSGENRTTMHKCYTFLIFMVLLLPSLGLSSLDLFFRWLFDKKFLAEAAIRFE--CVFLPDNGAFFVNYVIASAFIGNAMDLLRIPGLLMYMIRLCLARSAAERRNVKRHQAYEFQFGAAYAWMMCVFTVVMTYSITCPIIVPFGLMYMLLKHLVDRYNLYYAYLPAKLDKKIHSGAVNQVVAA 503          

HSP 2 Score: 108.227 bits (269), Expect = 5.642e-24
Identity = 69/238 (28.99%), Postives = 117/238 (49.16%), Query Frame = 3
Query:  636 DFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIRRTMVPKFCGRFHSCC-----IEEVDVIDYYNDEILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDYH----SSCSLLNYPQTSALSNDIKSAYWTISYAPPSNVINWENL 1322
             F  TTI NL S + ++W+H   +FLY    +  +    + ++    +    TL I+GI K +     I  HF+EAYP C + + +  +N+ +L+ L+ +R+ A   +       +   +   + PK CG  H CC      E+V+ I+YY      L+   ++E  K  +K +G+AFVTF        +L+D++      C+    P+ S+ S  +  + WT+SYAP    I WE+L
Sbjct:    5 SFGRTTIANLKSGNNLLWLHTSFAFLYLLLTVYSMRRHTSKMRYKEDDLVKRTLFINGISKYAE-SEKIKKHFEEAYPNCTVLEARPCYNVARLMFLDAERKKAERGKLYFTNLQSKENVPTMINPKPCG--HLCCCVVRGCEQVEAIEYYTKLEQKLKEDYKREKEKVNEKPLGMAFVTFHNETITAIILKDFNVCKCQGCTCRGEPRPSSCSESLHISNWTVSYAPDPQNIYWEHL 239          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Human
Match: TMEM63C (transmembrane protein 63C [Source:HGNC Symbol;Acc:HGNC:23787])

HSP 1 Score: 196.052 bits (497), Expect = 5.874e-52
Identity = 96/224 (42.86%), Postives = 145/224 (64.73%), Query Frame = 2
Query: 1442 IKKISMNIVLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFINSKIHRLAMSFTVFA 2113
            I+K+  N ++ +F PS ++W  + +LP IVY+S  +  HWT++ ++  ++ K Y FL+ MV+ILPS+G+ SL  F+ WLF I  ++  +  F   C+F P N AFFVNY+ITAA +GT  EL+R+  L  Y       RS  E   IRKN   +FQFG  Y+W++ VF+V + YS  CP+IVPFGL+Y+  K+  DRYN+Y+++  + +N +IH  A+S  +FA
Sbjct:  443 IEKLQ-NPIVTQFFPSVMLWGFTVILPLIVYFSAFLEAHWTRSSQNLVMVHKCYIFLVFMVVILPSMGLTSLDVFLRWLFDIYYLEQASIRFQ--CVFLPDNGAFFVNYVITAALLGTGMELLRLGSLFCYSTRLFFSRSEPERVNIRKNQAIDFQFGREYAWMMNVFSVVMAYSITCPIIVPFGLLYLCMKHLTDRYNMYYSFAPTKLNEQIHMAAVSQAIFA 663          

HSP 2 Score: 186.037 bits (471), Expect = 1.683e-48
Identity = 125/393 (31.81%), Postives = 200/393 (50.89%), Query Frame = 3
Query:  162 FEGIPQNFTINIVTFIILFVLFCFLRKNAWNHGRIALLTKNRRKEQSSTGYNIWNTVTLSEKNENEETDSTEFDEKTYLRRASVIDTTSQFDKGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGNGTKVKYNDFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTG---IRRTMVPKFCGRFHSC--CIEEVDVIDYYNDEILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDY-HSSCSLLNYPQTSALSNDIKSAYWTISYAPPSNVINWENL 1322
            F G+P    +NI  ++++ V++ FLRK AW++GR+ALL  N        G         SEK    ET S E + +               DKGF SW      + D+D+  K G+DA  Y++FQ +LI    II + SL +ILP+N  G+      + FA TTI+N+S+ S+++W+H++LSF YF      + H           + + TL+I  +PK+     +I+ HF EAYP   +  + F +++R LI L+ QR  A+  +     +   TG   IR     + C  F  C  C +EVD   YY++    L  +   E+ +   K++ + FVTF+    A++V +DY +  C +   PQ S+++  +KS YW ++ AP    I W++L
Sbjct:   35 FGGVPTVLCLNIALWVLVLVVYSFLRKAAWDYGRLALLIHNDSLTSLIYGEQ-------SEKTSPSET-SLEMERR---------------DKGFCSWFFNSITMKDEDLINKCGDDARIYIVFQYHLIIFVLIICIPSLGIILPINYTGSVLDWS-SHFARTTIVNVSTESKLLWLHSLLSFFYFITNFMFMAHHCLGFAPRNSQKVTRTLMITYVPKDIEDPELIIKHFHEAYPGSVVTRVHFCYDVRNLIDLDDQRRHAMRGRLFYTAKAKKTGKVMIRIHPCARLC--FCKCWTCFKEVDAEQYYSELEEQLTDEFNAELNRVPLKRLDLIFVTFQDSRMAKRVRKDYKYVQCGV--QPQQSSVTTIVKSYYWRVTMAPHPKDIIWKHL 399          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Human
Match: TMEM63B (transmembrane protein 63B [Source:HGNC Symbol;Acc:HGNC:17735])

HSP 1 Score: 194.897 bits (494), Expect = 1.217e-51
Identity = 101/218 (46.33%), Postives = 147/218 (67.43%), Query Frame = 2
Query: 1460 NIVLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFINSKIHRLAMSFTVFA 2113
            N ++ +F P+ ++W  S LLP IVYYS     HWT++ E+   + K YTFLI MVL+LPSLG++SL  F  WLF  + +      F   C+F P N AFFVNY+I +AFIG   +L+RIP L++Y+    + RS+ E   ++++  +EFQFG  Y+W++CVFTV +TYS  CP+IVPFGL+Y++ K+ VDRYN+Y+AY  + ++ KIH  A++  V A
Sbjct:  401 NPIITQFFPTLLLWCFSALLPTIVYYSAFFEAHWTRSGENRTTMHKCYTFLIFMVLLLPSLGLSSLDLFFRWLFDKKFLAEAAIRFE--CVFLPDNGAFFVNYVIASAFIGNAMDLLRIPGLLMYMIRLCLARSAAERRNVKRHQAYEFQFGAAYAWMMCVFTVVMTYSITCPIIVPFGLMYMLLKHLVDRYNLYYAYLPAKLDKKIHSGAVNQVVAA 616          

HSP 2 Score: 157.918 bits (398), Expect = 2.087e-39
Identity = 109/374 (29.14%), Postives = 185/374 (49.47%), Query Frame = 3
Query:  234 LRKNAWNHGRIALLTKNRRKEQSSTG--YNIWNTVTLSEKNENEETDSTEFDEKTYLRRASVIDTTSQFDKGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGNGTKVKYNDFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIRRTMVPKFCGRFHSCC-----IEEVDVIDYYNDEILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDYH----SSCSLLNYPQTSALSNDIKSAYWTISYAPPSNVINWENL 1322
            LRK AW++GR+AL+T       +  G  ++ +  +T         + S +FD++               D GF SWL   + + D +IR+K G DA  YL FQ+++I    ++ V+S+ ++LPVN  G+  +     F  TTI NL S + ++W+H   +FLY    +  +    + ++    +    TL I+GI K +     I  HF+EAYP C + + +  +N+ +L+ L+ +R+ A   +       +   +   + PK CG  H CC      E+V+ I+YY      L+   ++E  K  +K +G+AFVTF        +L+D++      C+    P+ S+ S  +  + WT+SYAP    I WE+L
Sbjct:    4 LRKVAWDYGRLALVTDADSVASAMHGDSHDRYERLT-------SVSSSVDFDQR---------------DNGFCSWLTAIFRIKDDEIRDKCGGDAVHYLSFQRHIIGLLVVVGVLSVGIVLPVNFSGDLLENNAYSFGRTTIANLKSGNNLLWLHTSFAFLYLLLTVYSMRRHTSKMRYKEDDLVKRTLFINGISKYAE-SEKIKKHFEEAYPNCTVLEARPCYNVARLMFLDAERKKAERGKLYFTNLQSKENVPTMINPKPCG--HLCCCVVRGCEQVEAIEYYTKLEQKLKEDYKREKEKVNEKPLGMAFVTFHNETITAIILKDFNVCKCQGCTCRGEPRPSSCSESLHISNWTVSYAPDPQNIYWEHL 352          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Human
Match: TMEM63B (transmembrane protein 63B [Source:HGNC Symbol;Acc:HGNC:17735])

HSP 1 Score: 194.897 bits (494), Expect = 2.280e-51
Identity = 101/218 (46.33%), Postives = 147/218 (67.43%), Query Frame = 2
Query: 1460 NIVLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFINSKIHRLAMSFTVFA 2113
            N ++ +F P+ ++W  S LLP IVYYS     HWT++ E+   + K YTFLI MVL+LPSLG++SL  F  WLF  + +      F   C+F P N AFFVNY+I +AFIG   +L+RIP L++Y+    + RS+ E   ++++  +EFQFG  Y+W++CVFTV +TYS  CP+IVPFGL+Y++ K+ VDRYN+Y+AY  + ++ KIH  A++  V A
Sbjct:  472 NPIITQFFPTLLLWCFSALLPTIVYYSAFFEAHWTRSGENRTTMHKCYTFLIFMVLLLPSLGLSSLDLFFRWLFDKKFLAEAAIRFE--CVFLPDNGAFFVNYVIASAFIGNAMDLLRIPGLLMYMIRLCLARSAAERRNVKRHQAYEFQFGAAYAWMMCVFTVVMTYSITCPIIVPFGLMYMLLKHLVDRYNLYYAYLPAKLDKKIHSGAVNQVVAA 687          

HSP 2 Score: 178.718 bits (452), Expect = 5.411e-46
Identity = 118/404 (29.21%), Postives = 201/404 (49.75%), Query Frame = 3
Query:  162 FEGIPQNFTINIVTFIILFVLFCFLRKNAWNHGRIALLT---KNRRKEQSSTGYNIWNTVTLSEKNENEE-----TDSTEFDEKTYLRRASVIDTTSQFDKGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGNGTKVKYNDFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIRRTMVPKFCGRFHSCC-----IEEVDVIDYYNDEILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDYH----SSCSLLNYPQTSALSNDIKSAYWTISYAPPSNVINWENL 1322
            F G+P    ++ + F+ L  LF  LRK AW++GR+AL+T   + RR+E+         +    + ++  E     + S +FD++               D GF SWL   + + D +IR+K G DA  YL FQ+++I    ++ V+S+ ++LPVN  G+  +     F  TTI NL S + ++W+H   +FLY    +  +    + ++    +    TL I+GI K +     I  HF+EAYP C + + +  +N+ +L+ L+ +R+ A   +       +   +   + PK CG  H CC      E+V+ I+YY      L+   ++E  K  +K +G+AFVTF        +L+D++      C+    P+ S+ S  +  + WT+SYAP    I WE+L
Sbjct:   38 FGGVPTVLALDFMCFLALLFLFSILRKVAWDYGRLALVTDADRLRRQERDRVEQEYVASAMHGDSHDRYERLTSVSSSVDFDQR---------------DNGFCSWLTAIFRIKDDEIRDKCGGDAVHYLSFQRHIIGLLVVVGVLSVGIVLPVNFSGDLLENNAYSFGRTTIANLKSGNNLLWLHTSFAFLYLLLTVYSMRRHTSKMRYKEDDLVKRTLFINGISKYAE-SEKIKKHFEEAYPNCTVLEARPCYNVARLMFLDAERKKAERGKLYFTNLQSKENVPTMINPKPCG--HLCCCVVRGCEQVEAIEYYTKLEQKLKEDYKREKEKVNEKPLGMAFVTFHNETITAIILKDFNVCKCQGCTCRGEPRPSSCSESLHISNWTVSYAPDPQNIYWEHL 423          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Fly
Match: Tmem63 (gene:FBgn0033259 transcript:FBtr0088781)

HSP 1 Score: 185.652 bits (470), Expect = 6.548e-49
Identity = 92/216 (42.59%), Postives = 139/216 (64.35%), Query Frame = 2
Query: 1478 FLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFI----NSKIHRLAMSFTVFA 2113
            FLP+ ++W +S L+P IV  S+  + H+T++ ++ +++ K + +L++M++ILPSLG+ S  + + W F  Q  +       W CIF P   +F+VNYIITAAFIGT  EL+R PELI+Y++  +  +S  E   IRK ++ EF FG  Y+W   VFT+ + YS  CPLI+PF +IYI  K+ VDR+N+YFAY  S +      KIH  A++ T F+
Sbjct:  443 FLPTLMLWTLSALMPVIVAISDKWMRHYTRSKQNYSIMTKCFGYLLMMIMILPSLGLTSAQALLEWGFLNQTDR-------WQCIFLPDRGSFYVNYIITAAFIGTALELLRFPELIVYIWSLLKAKSKAETPYIRKAILIEFPFGTHYAWTTLVFTIAIVYSVACPLIMPFAMIYICLKHFVDRHNLYFAYGPSNMISRKGGKIHSTAVTMTKFS 651          

HSP 2 Score: 133.65 bits (335), Expect = 7.331e-32
Identity = 100/409 (24.45%), Postives = 188/409 (45.97%), Query Frame = 3
Query:  159 GFEGIPQNFTINIVTFIILFVLFCFLRKNAWNHGRIALLTKNRRKEQSSTGYNIWNTVTLSEKN---ENEETDSTEFDEKTYLRRASVIDTTS----QFDKGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGNGTKVKY--NDFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIRRTMV--PKFCGRFHSCCIEEVDVIDYYNDEILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDYHSSCSLLNYPQTSALSNDIKSAYWTISYAPPSNVINWENLCHPYKKWLIK 1352
             + GIP+   +N + +++L +LF  LR  A + GR+AL+  N  K++       W  +  S      + + + ST+   +       V D+T     Q ++G F W++    +  + I    G DA  YL FQ++L+    ++T++SL++ILPVN      +  Y  N F  TT+ NLS  S  +WVH +++ LY   ++ +I   A+         A+ T++I  I       +++ ++ +E +P   I+++  A+N+ +L   N + E  +H        + N   R T++  P+ C      C +E +  +YY  E   L     +      ++ + +AF+T  T+++A+ ++  +        Y Q            W + +AP  + + WENL      W +K
Sbjct:   25 AYNGIPETLILNTIFWVLLILLFTVLRHQAGDFGRLALVNSNGSKKR-------WTEIFYSRAASVVDPQPSTSTQVSPRPSTTSQGVPDSTPLSPIQPEEGLFGWIRVTLKLRKETILLHTGPDAVHYLSFQQHLMAVMALVTIVSLVIILPVNFLNGPKENPYDVNAFGRTTMANLSPDSPWLWVHTIITILY-IPLVVLIMRRASGRNAFK-KAATRTIMISNISSSDRNKTVVRNYMQELFPDVTIENVSIAYNISRLYVRNAEFE-RVHEARLYCEHHRN---RDTLMVKPEMCS-----CKKE-NAYEYYQREERKLSGDVARLRASTMNEPLDIAFITVSTVQEAQNIVTHFTPG----TYRQ------------WHLVFAPSPDDLFWENLNVNKSHWYLK 398          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Zebrafish
Match: tmem63c (transmembrane protein 63C [Source:ZFIN;Acc:ZDB-GENE-120928-2])

HSP 1 Score: 210.69 bits (535), Expect = 3.657e-109
Identity = 101/218 (46.33%), Postives = 146/218 (66.97%), Query Frame = 2
Query: 1460 NIVLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFINSKIHRLAMSFTVFA 2113
            N V+ +F P+ ++WA S LLPFIVYYS     HWT++ E+   + K +  L+ MV+ILPSLG++SL  F  WLF ++ +      F   C+F P N AFFVNY+IT++ IGT  EL+RIP L++Y       +S  E   ++ +  +EFQFGL Y+W +C+F+V++TYS  CP+IVPFGL+Y++ K+ VDRYNIY+AY  + +N +IH  A+S  V A
Sbjct:  476 NPVITQFFPTLLLWAFSILLPFIVYYSSFFEYHWTRSGENQVTMHKCFLLLVFMVIILPSLGLSSLNLFFRWLFDVRFLDETDVKFQ--CVFLPDNGAFFVNYVITSSLIGTAMELLRIPALLVYSLRLCFAKSKAECIHVKISQAYEFQFGLEYAWTMCIFSVSMTYSITCPVIVPFGLLYLVLKHMVDRYNIYYAYTPTKLNQRIHAAAISQVVVA 691          

HSP 2 Score: 206.068 bits (523), Expect = 3.657e-109
Identity = 147/444 (33.11%), Postives = 238/444 (53.60%), Query Frame = 3
Query:  126 YRITNDTAVIYG--FEGIPQNFTINIVTFIILFVLFCFLRKNAWNHGRIALLTKNRRKEQSSTGYNIWNTVTLSEKNENEETDSTEFDEKTYLRRASVIDTTSQFDKGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGNGTKVKYNDFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIRRTMVPKF-CGRFHSCCI---EEVDVIDYYN--DEILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDYHSSCSLLNYPQTSALSNDIKSAYWTISYAPPSNVINWENL--CHPYKKWLIKAXXXXXXXXXXXXXXTTPTYALNVL 1427
            YR  + ++V+ G  F G+P    IN+V ++IL ++F  LRK AW++GR+ALL KN          +   ++   E++E E+T S      +  +           D GF SWL   Y + D++IR K G DA  YL FQ+++I    ++ ++SL +ILPVN+ GN       +F  TT++N+ + +  +W+H++ + LYF   +  + H ++ L+     + + TL+I  IP+E S   +I  H  EAYP C + DI F  N++KL+ L+ +R  A+  +     +    G  R M+    C +   C I   E+VD   YY+  +E L  E   +K  +    K++G+AFVTF        +++DY S     + PQ S+++  ++S  W +SYAP  N I WENL  C P  +W ++ IL+N +LF+ LF LTTP   +N +
Sbjct:   47 YRSHSRSSVLQGLPFGGVPTVLAINVVLWLILLLIFSCLRKAAWDYGRLALLMKN----------DSLTSLFYGEQSEKEKTPSDSSPSDSETK-----------DMGFCSWLTSLYHMKDEEIRSKCGIDAVTYLSFQRHIILLMMVVCLLSLTIILPVNLSGNLLGDNPENFGRTTVVNVPAQNIFLWLHSIFALLYFVITVLCMAHHSSRLEYREDEKVARTLMITSIPREISDPGLITKHLHEAYPSCTVTDIHFCFNVQKLMKLDSERRKAMKGRLYFTTKAQKNG--RIMIKTHPCAQIFCCDICGFEKVDAEQYYSELEEKLTDEFNAEKNWISM--KRLGIAFVTFRDERMTAVIVKDY-SRARCRHRPQQSSITTVVRSHQWDVSYAPAPNDIIWENLSVCGP--RWWLRCILLNILLFLLLFFLTTPAIIVNTM 462          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Zebrafish
Match: tmem63c (transmembrane protein 63C [Source:ZFIN;Acc:ZDB-GENE-120928-2])

HSP 1 Score: 211.075 bits (536), Expect = 4.007e-109
Identity = 101/218 (46.33%), Postives = 146/218 (66.97%), Query Frame = 2
Query: 1460 NIVLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFINSKIHRLAMSFTVFA 2113
            N V+ +F P+ ++WA S LLPFIVYYS     HWT++ E+   + K +  L+ MV+ILPSLG++SL  F  WLF ++ +      F   C+F P N AFFVNY+IT++ IGT  EL+RIP L++Y       +S  E   ++ +  +EFQFGL Y+W +C+F+V++TYS  CP+IVPFGL+Y++ K+ VDRYNIY+AY  + +N +IH  A+S  V A
Sbjct:  463 NPVITQFFPTLLLWAFSILLPFIVYYSSFFEYHWTRSGENQVTMHKCFLLLVFMVIILPSLGLSSLNLFFRWLFDVRFLDETDVKFQ--CVFLPDNGAFFVNYVITSSLIGTAMELLRIPALLVYSLRLCFAKSKAECIHVKISQAYEFQFGLEYAWTMCIFSVSMTYSITCPVIVPFGLLYLVLKHMVDRYNIYYAYTPTKLNQRIHAAAISQVVVA 678          

HSP 2 Score: 205.682 bits (522), Expect = 4.007e-109
Identity = 147/444 (33.11%), Postives = 238/444 (53.60%), Query Frame = 3
Query:  126 YRITNDTAVIYG--FEGIPQNFTINIVTFIILFVLFCFLRKNAWNHGRIALLTKNRRKEQSSTGYNIWNTVTLSEKNENEETDSTEFDEKTYLRRASVIDTTSQFDKGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGNGTKVKYNDFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIRRTMVPKF-CGRFHSCCI---EEVDVIDYYN--DEILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDYHSSCSLLNYPQTSALSNDIKSAYWTISYAPPSNVINWENL--CHPYKKWLIKAXXXXXXXXXXXXXXTTPTYALNVL 1427
            YR  + ++V+ G  F G+P    IN+V ++IL ++F  LRK AW++GR+ALL KN          +   ++   E++E E+T S      +  +           D GF SWL   Y + D++IR K G DA  YL FQ+++I    ++ ++SL +ILPVN+ GN       +F  TT++N+ + +  +W+H++ + LYF   +  + H ++ L+     + + TL+I  IP+E S   +I  H  EAYP C + DI F  N++KL+ L+ +R  A+  +     +    G  R M+    C +   C I   E+VD   YY+  +E L  E   +K  +    K++G+AFVTF        +++DY S     + PQ S+++  ++S  W +SYAP  N I WENL  C P  +W ++ IL+N +LF+ LF LTTP   +N +
Sbjct:   34 YRSHSRSSVLQGLPFGGVPTVLAINVVLWLILLLIFSCLRKAAWDYGRLALLMKN----------DSLTSLFYGEQSEKEKTPSDSSPSDSETK-----------DMGFCSWLTSLYHMKDEEIRSKCGIDAVTYLSFQRHIILLMMVVCLLSLTIILPVNLSGNLLGDNPENFGRTTVVNVPAQNIFLWLHSIFALLYFVITVLCMAHHSSRLEYREDEKVARTLMITSIPREISDPGLITKHLHEAYPSCTVTDIHFCFNVQKLMKLDSERRKAMKGRLYFTTKAQKNG--RIMIKTHPCAQIFCCDICGFEKVDAEQYYSELEEKLTDEFNAEKNWISM--KRLGIAFVTFRDERMTAVIVKDY-SRARCRHKPQQSSITTVVRSHQWDVSYAPAPNDIIWENLSVCGP--RWWLRCILLNILLFLLLFFLTTPAIIVNTM 449          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Zebrafish
Match: tmem63c (transmembrane protein 63C [Source:ZFIN;Acc:ZDB-GENE-120928-2])

HSP 1 Score: 210.69 bits (535), Expect = 3.749e-108
Identity = 101/218 (46.33%), Postives = 146/218 (66.97%), Query Frame = 2
Query: 1460 NIVLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFINSKIHRLAMSFTVFA 2113
            N V+ +F P+ ++WA S LLPFIVYYS     HWT++ E+   + K +  L+ MV+ILPSLG++SL  F  WLF ++ +      F   C+F P N AFFVNY+IT++ IGT  EL+RIP L++Y       +S  E   ++ +  +EFQFGL Y+W +C+F+V++TYS  CP+IVPFGL+Y++ K+ VDRYNIY+AY  + +N +IH  A+S  V A
Sbjct:  459 NPVITQFFPTLLLWAFSILLPFIVYYSSFFEYHWTRSGENQVTMHKCFLLLVFMVIILPSLGLSSLNLFFRWLFDVRFLDETDVKFQ--CVFLPDNGAFFVNYVITSSLIGTAMELLRIPALLVYSLRLCFAKSKAECIHVKISQAYEFQFGLEYAWTMCIFSVSMTYSITCPVIVPFGLLYLVLKHMVDRYNIYYAYTPTKLNQRIHAAAISQVVVA 674          

HSP 2 Score: 202.601 bits (514), Expect = 3.749e-108
Identity = 147/444 (33.11%), Postives = 238/444 (53.60%), Query Frame = 3
Query:  126 YRITNDTAVIYG--FEGIPQNFTINIVTFIILFVLFCFLRKNAWNHGRIALLTKNRRKEQSSTGYNIWNTVTLSEKNENEETDSTEFDEKTYLRRASVIDTTSQFDKGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGNGTKVKYNDFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIRRTMVPKF-CGRFHSCCI---EEVDVIDYYN--DEILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDYHSSCSLLNYPQTSALSNDIKSAYWTISYAPPSNVINWENL--CHPYKKWLIKAXXXXXXXXXXXXXXTTPTYALNVL 1427
            YR  + ++V+ G  F G+P    IN+V ++IL ++F  LRK AW++GR+ALL KN          +   ++   E++E E+T S      +  +           D GF SWL   Y + D++IR K G DA  YL FQ+++I    ++ ++SL +ILPVN+ GN       +F  TT++N+ + +  +W+H++ + LYF   +  + H ++ L+     + + TL+I  IP+E S   +I  H  EAYP C + DI F  N++KL+ L+ +R  A+  +     +    G  R M+    C +   C I   E+VD   YY+  +E L  E   +K  +    K++G+AFVTF        +++DY S     + PQ S+++  ++S  W +SYAP  N I WENL  C P  +W ++ IL+N +LF+ LF LTTP   +N +
Sbjct:   34 YRSHSRSSVLQGLPFGGVPTVLAINVVLWLILLLIFSCLRKAAWDYGRLALLMKN----------DSLTSLFYGEQSEKEKTPSDSSPSDSETK-----------DMGFCSWLTSLYHMKDEEIRSKCGIDAVTYLSFQRHIILLMMVVCLLSLTIILPVNLSGN----LLENFGRTTVVNVPAQNIFLWLHSIFALLYFVITVLCMAHHSSRLEYREDEKVARTLMITSIPREISDPGLITKHLHEAYPSCTVTDIHFCFNVQKLMKLDSERRKAMKGRLYFTTKAQKNG--RIMIKTHPCAQIFCCDICGFEKVDAEQYYSELEEKLTDEFNAEKNWISM--KRLGIAFVTFRDERMTAVIVKDY-SRARCRHKPQQSSITTVVRSHQWDVSYAPAPNDIIWENLSVCGP--RWWLRCILLNILLFLLLFFLTTPAIIVNTM 445          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Zebrafish
Match: tmem63ba (transmembrane protein 63Ba [Source:ZFIN;Acc:ZDB-GENE-030131-4320])

HSP 1 Score: 191.815 bits (486), Expect = 1.161e-94
Identity = 102/218 (46.79%), Postives = 146/218 (66.97%), Query Frame = 2
Query: 1460 NIVLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFINSKIHRLAMSFTVFA 2113
            N ++ +F P+ ++W  S LLP IVYYS     HWT++ E+   + K YTFLI MVL+LPSLG++SL  F  WLF  + +   T  F   C+F P N AFFVNY+I +AFIG   +L+RIP  ++Y+    + RS+ E   ++K+  +EFQFG  Y+W++ VFTV +TYS  CP+IVPFGL+Y++ K+ VDRYN+Y+AY  S ++ KIH  A++  V A
Sbjct:  475 NPIVTQFFPTLLLWCFSALLPTIVYYSAFFEAHWTRSGENRTTMHKCYTFLIFMVLLLPSLGLSSLDLFFRWLFDKKFLDEATIRFR--CVFLPDNGAFFVNYVIASAFIGNAMDLLRIPYFLMYMIRLCLARSAAERRNVKKHQAYEFQFGAAYAWMMNVFTVVMTYSITCPIIVPFGLMYMLLKHLVDRYNMYYAYLPSKLDKKIHSGAVNQVVAA 690          

HSP 2 Score: 176.792 bits (447), Expect = 1.161e-94
Identity = 132/441 (29.93%), Postives = 219/441 (49.66%), Query Frame = 3
Query:  162 FEGIPQNFTINIVTFIILFVLFCFLRKNAWNHGRIALLTK--NRRKEQSSTGYNIWNTVTLSEKNENEETDSTEFDEKTYLRRASVIDTTS--QFDKGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGNGTKVKYN-------DFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIRRTMVPKFCGRFHSCCI----EEVDVIDYYNDEILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDYHS----SCSLLNYPQTSALSNDIKSAYWTISYAPPSNVINWENLCHPYKKWLIKAXXXXXXXXXXXXXXTTPTYALNVL 1427
            F G+P    ++ + F++L  +F FLRK AW++GR+AL++   +RR +             L E+        T  D + Y R  SV  +    Q D G  SWL   + + D +IREK G DA  YL FQ+++I    ++ V+S+ ++LPVN  G+      N        F  TT++NL S + ++W+H + +F Y    +  +    + +     +    TL I GI K +   S I  HF++AY  C + D +  +N+ KL+ L  +R+ A  ++       +   I   + PK CG    CCI    E+ + ++YY      L+ + +KE  K   K +G+AFVTF+    A  +L+D+++     C     P++S  S+ + +  WT+SYAP    + WE+L      W ++  +IN  LF+ LF LTTP   ++ +
Sbjct:   33 FGGVPTVLALDFMCFLVLLCVFSFLRKVAWDYGRLALVSDADSRRNKHYQR---------LDEQEYVASAMQTPADSR-YERLTSVSSSVDFDQRDNGLCSWLTAIFRIKDDEIREKCGEDAVHYLSFQRHIIGLLVVVGVLSVGIVLPVNFSGDQLVETGNFENNNAYSFGRTTVVNLKSGNHLLWLHTIFAFFYLLLTVYSMRRHTSKMHYKEDDLVKRTLFISGIAKYAE-ESEIKQHFEKAYENCVVLDARICYNVAKLMSLESERKKAERSKKFYTDLMSREHIPTMINPKPCGHL-CCCIIKGCEQEEAVNYYTKLEAKLKEEYRKEREKVNTKPLGMAFVTFQNEAMAALILKDFNACQCHGCHCRRQPKSSPFSSQLHTYNWTVSYAPDPQNVYWEHLSISGLNWWVRCFVINCFLFLLLFFLTTPAIIISTM 461          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Zebrafish
Match: tmem63ba (transmembrane protein 63Ba [Source:ZFIN;Acc:ZDB-GENE-030131-4320])

HSP 1 Score: 191.815 bits (486), Expect = 1.415e-93
Identity = 102/218 (46.79%), Postives = 146/218 (66.97%), Query Frame = 2
Query: 1460 NIVLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFINSKIHRLAMSFTVFA 2113
            N ++ +F P+ ++W  S LLP IVYYS     HWT++ E+   + K YTFLI MVL+LPSLG++SL  F  WLF  + +   T  F   C+F P N AFFVNY+I +AFIG   +L+RIP  ++Y+    + RS+ E   ++K+  +EFQFG  Y+W++ VFTV +TYS  CP+IVPFGL+Y++ K+ VDRYN+Y+AY  S ++ KIH  A++  V A
Sbjct:  461 NPIVTQFFPTLLLWCFSALLPTIVYYSAFFEAHWTRSGENRTTMHKCYTFLIFMVLLLPSLGLSSLDLFFRWLFDKKFLDEATIRFR--CVFLPDNGAFFVNYVIASAFIGNAMDLLRIPYFLMYMIRLCLARSAAERRNVKKHQAYEFQFGAAYAWMMNVFTVVMTYSITCPIIVPFGLMYMLLKHLVDRYNMYYAYLPSKLDKKIHSGAVNQVVAA 676          

HSP 2 Score: 172.94 bits (437), Expect = 1.415e-93
Identity = 125/437 (28.60%), Postives = 214/437 (48.97%), Query Frame = 3
Query:  162 FEGIPQNFTINIVTFIILFVLFCFLRKNAWNHGRIALLTKNRRKEQSSTGYNIWNTVTLSEKNENEETDSTEFDEKTYLRRASVIDTTSQFDKGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGNGTKVKYN-------DFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIRRTMVPKFCGRFHSCCI----EEVDVIDYYNDEILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDYHS----SCSLLNYPQTSALSNDIKSAYWTISYAPPSNVINWENLCHPYKKWLIKAXXXXXXXXXXXXXXTTPTYALNVL 1427
            F G+P    ++ + F++L  +F FLRK AW++GR+AL++     +  S    +        +     + S +FD++               D G  SWL   + + D +IREK G DA  YL FQ+++I    ++ V+S+ ++LPVN  G+      N        F  TT++NL S + ++W+H + +F Y    +  +    + +     +    TL I GI K +   S I  HF++AY  C + D +  +N+ KL+ L  +R+ A  ++       +   I   + PK CG    CCI    E+ + ++YY      L+ + +KE  K   K +G+AFVTF+    A  +L+D+++     C     P++S  S+ + +  WT+SYAP    + WE+L      W ++  +IN  LF+ LF LTTP   ++ +
Sbjct:   33 FGGVPTVLALDFMCFLVLLCVFSFLRKVAWDYGRLALVS-----DADSVASAMQTPADSRYERLTSVSSSVDFDQR---------------DNGLCSWLTAIFRIKDDEIREKCGEDAVHYLSFQRHIIGLLVVVGVLSVGIVLPVNFSGDQLVETGNFENNNAYSFGRTTVVNLKSGNHLLWLHTIFAFFYLLLTVYSMRRHTSKMHYKEDDLVKRTLFISGIAKYAE-ESEIKQHFEKAYENCVVLDARICYNVAKLMSLESERKKAERSKKFYTDLMSREHIPTMINPKPCGHL-CCCIIKGCEQEEAVNYYTKLEAKLKEEYRKEREKVNTKPLGMAFVTFQNEAMAALILKDFNACQCHGCHCRRQPKSSPFSSQLHTYNWTVSYAPDPQNVYWEHLSISGLNWWVRCFVINCFLFLLLFFLTTPAIIISTM 447          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Xenopus
Match: tmem63c (transmembrane protein 63C [Source:NCBI gene;Acc:100036641])

HSP 1 Score: 204.912 bits (520), Expect = 1.041e-104
Identity = 99/221 (44.80%), Postives = 143/221 (64.71%), Query Frame = 2
Query: 1430 VEFSIKKISMNIVLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFINSKIHRLA 2092
            V + ++K+  N V+ +FLP+F++W  S  LPF+VYYS     HWT++ E+   + K Y FL+ MV++LPSLG+ SL  F  WLF I  +      F   C+F P N AFFVNY+ITA+ IGT  EL+R P L +Y     + R+  +   +++N  +EFQFGL Y+W  CVF+V + YS  CP+IVPFGLIY++ K+  DRYNIY+AY  + ++  +H+ A
Sbjct:  459 VTYPVEKLR-NPVITQFLPTFLLWMFSVCLPFLVYYSAFFECHWTRSSENQHTMHKCYFFLVFMVIVLPSLGLTSLNLFFRWLFDIHFLDEANIKFQ--CVFLPNNGAFFVNYVITASLIGTAMELLRFPGLTVYAARLCLARTEPDRLHVKRNQAYEFQFGLEYAWTTCVFSVVMAYSITCPVIVPFGLIYMLLKHMTDRYNIYYAYIPTKLSPGLHKAA 676          

HSP 2 Score: 197.593 bits (501), Expect = 1.041e-104
Identity = 127/431 (29.47%), Postives = 218/431 (50.58%), Query Frame = 3
Query:   57 YRLLDNEINVMSKATPVCDRVNIYRITNDTAVIYG--FEGIPQNFTINIVTFIILFVLFCFLRKNAWNHGRIALLTKNRRK--EQSSTGYNIWNTVTLSEKNENEETDSTEFDEKTYLRRASVIDTTSQFDKGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGNGTKVKYNDFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNE-AIRQYANTGIRRTMVPKFCGRF---HSCCIEEVDVIDYYNDEILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDYHS-SCSLLNYPQTSALSNDIKSAYWTISYAPPSNVINWENL 1322
            YR      + +S   PV +    Y+  + + V+ G  F GIP    IN + +++L ++F  LRK AW++GR+ALL  N     ++  T Y++  ++   E +E E++              S  + +++ D G  SWL   Y + D++I+ K G+DA  YL +Q++L+     +  IS+ +ILPVN  G+        F  TTI+N+ +  + +W+H+V + +YF   +  + H  ++L     ++ + TL+I  IP E S  S+   HF EAYP C + D+QF +++R L+ L+ +R  A+  +   A R      I+  + P  C R      C  ++V+   YY +    L  +   E  +   K++G  FVTF+       +++DY+   C     PQ S+++  +KS  W + YAP  + I WENL
Sbjct:    5 YRTESPLGDSLSMDPPVNETEQCYKAHSHSTVLQGLPFGGIPTVLAINFLAWLVLLLIFSCLRKAAWDYGRLALLIDNDSHALQRRWTSYDL-TSLFYGEPSEKEKSPC----------EISPSEASTK-DVGLCSWLSSIYQMKDEEIQSKCGSDAITYLSYQRHLLVVLLAVCCISVAIILPVNFSGDMLGDSPAQFGRTTIVNVPTKDRFLWLHSVFALVYFLFSVLCMRHHTSSLHYKEDDKVARTLMITKIPSEISDASLFTKHFHEAYPSCTVTDVQFCYDVRHLMKLDKERRRAMKGRMYFAGRAQKEGKIQIKIHP--CARLCPCDCCGFQQVEAEQYYGELEERLTDEFTAERNRITLKRLGAVFVTFQDERMTAVIIKDYNRLPCH--RAPQQSSVTPLLKSHKWKVHYAPAPSDIIWENL 419          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Xenopus
Match: tmem63c (transmembrane protein 63C [Source:NCBI gene;Acc:100036641])

HSP 1 Score: 205.297 bits (521), Expect = 1.015e-103
Identity = 99/221 (44.80%), Postives = 143/221 (64.71%), Query Frame = 2
Query: 1430 VEFSIKKISMNIVLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFINSKIHRLA 2092
            V + ++K+  N V+ +FLP+F++W  S  LPF+VYYS     HWT++ E+   + K Y FL+ MV++LPSLG+ SL  F  WLF I  +      F   C+F P N AFFVNY+ITA+ IGT  EL+R P L +Y     + R+  +   +++N  +EFQFGL Y+W  CVF+V + YS  CP+IVPFGLIY++ K+  DRYNIY+AY  + ++  +H+ A
Sbjct:  448 VTYPVEKLR-NPVITQFLPTFLLWMFSVCLPFLVYYSAFFECHWTRSSENQHTMHKCYFFLVFMVIVLPSLGLTSLNLFFRWLFDIHFLDEANIKFQ--CVFLPNNGAFFVNYVITASLIGTAMELLRFPGLTVYAARLCLARTEPDRLHVKRNQAYEFQFGLEYAWTTCVFSVVMAYSITCPVIVPFGLIYMLLKHMTDRYNIYYAYIPTKLSPGLHKAA 665          

HSP 2 Score: 194.126 bits (492), Expect = 1.015e-103
Identity = 125/429 (29.14%), Postives = 213/429 (49.65%), Query Frame = 3
Query:   57 YRLLDNEINVMSKATPVCDRVNIYRITNDTAVIYG--FEGIPQNFTINIVTFIILFVLFCFLRKNAWNHGRIALLTKNRRKEQSSTGYNIWNTVTLSEKNENEETDSTEFDEKTYLRRASVIDTTSQFDKGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGNGTKVKYNDFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNE-AIRQYANTGIRRTMVPKFCGRF---HSCCIEEVDVIDYYNDEILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDYHS-SCSLLNYPQTSALSNDIKSAYWTISYAPPSNVINWENL 1322
            YR      + +S   PV +    Y+  + + V+ G  F GIP    IN + +++L ++F  LRK AW++GR+ALL  N          +   ++   E +E E++              S  + +++ D G  SWL   Y + D++I+ K G+DA  YL +Q++L+     +  IS+ +ILPVN  G+        F  TTI+N+ +  + +W+H+V + +YF   +  + H  ++L     ++ + TL+I  IP E S  S+   HF EAYP C + D+QF +++R L+ L+ +R  A+  +   A R      I+  + P  C R      C  ++V+   YY +    L  +   E  +   K++G  FVTF+       +++DY+   C     PQ S+++  +KS  W + YAP  + I WENL
Sbjct:    5 YRTESPLGDSLSMDPPVNETEQCYKAHSHSTVLQGLPFGGIPTVLAINFLAWLVLLLIFSCLRKAAWDYGRLALLIDN----------DSLTSLFYGEPSEKEKSPC----------EISPSEASTK-DVGLCSWLSSIYQMKDEEIQSKCGSDAITYLSYQRHLLVVLLAVCCISVAIILPVNFSGDMLGDSPAQFGRTTIVNVPTKDRFLWLHSVFALVYFLFSVLCMRHHTSSLHYKEDDKVARTLMITKIPSEISDASLFTKHFHEAYPSCTVTDVQFCYDVRHLMKLDKERRRAMKGRMYFAGRAQKEGKIQIKIHP--CARLCPCDCCGFQQVEAEQYYGELEERLTDEFTAERNRITLKRLGAVFVTFQDERMTAVIIKDYNRLPCH--RAPQQSSVTPLLKSHKWKVHYAPAPSDIIWENL 408          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Xenopus
Match: tmem63c (transmembrane protein 63C [Source:NCBI gene;Acc:100036641])

HSP 1 Score: 205.297 bits (521), Expect = 1.148e-100
Identity = 99/221 (44.80%), Postives = 143/221 (64.71%), Query Frame = 2
Query: 1430 VEFSIKKISMNIVLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFINSKIHRLA 2092
            V + ++K+  N V+ +FLP+F++W  S  LPF+VYYS     HWT++ E+   + K Y FL+ MV++LPSLG+ SL  F  WLF I  +      F   C+F P N AFFVNY+ITA+ IGT  EL+R P L +Y     + R+  +   +++N  +EFQFGL Y+W  CVF+V + YS  CP+IVPFGLIY++ K+  DRYNIY+AY  + ++  +H+ A
Sbjct:  444 VTYPVEKLR-NPVITQFLPTFLLWMFSVCLPFLVYYSAFFECHWTRSSENQHTMHKCYFFLVFMVIVLPSLGLTSLNLFFRWLFDIHFLDEANIKFQ--CVFLPNNGAFFVNYVITASLIGTAMELLRFPGLTVYAARLCLARTEPDRLHVKRNQAYEFQFGLEYAWTTCVFSVVMAYSITCPVIVPFGLIYMLLKHMTDRYNIYYAYIPTKLSPGLHKAA 661          

HSP 2 Score: 183.726 bits (465), Expect = 1.148e-100
Identity = 126/429 (29.37%), Postives = 211/429 (49.18%), Query Frame = 3
Query:   57 YRLLDNEINVMSKATPVCDRVNIYRITNDTAVIYG--FEGIPQNFTINIVTFIILFVLFCFLRKNAWNHGRIALLTKNRRKEQSSTGYNIWNTVTLSEKNENEETDSTEFDEKTYLRRASVIDTTSQFDKGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGNGTKVKYNDFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNE-AIRQYANTGIRRTMVPKFCGRF---HSCCIEEVDVIDYYNDEILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDYHS-SCSLLNYPQTSALSNDIKSAYWTISYAPPSNVINWENL 1322
            YR      + +S   PV +    Y+  + + V+ G  F GIP    IN + +++L ++F  LRK AW++GR+ALL  N          +   ++   E +E E++       +     AS  D T   + GF     FF    D++I+ K G+DA  YL +Q++L+     +  IS+ +ILPVN  G+        F  TTI+N+ +  + +W+H+V + +YF   +  + H  ++L     ++ + TL+I  IP E S  S+   HF EAYP C + D+QF +++R L+ L+ +R  A+  +   A R      I+  + P  C R      C  ++V+   YY +    L  +   E  +   K++G  FVTF+       +++DY+   C     PQ S+++  +KS  W + YAP  + I WENL
Sbjct:    5 YRTESPLGDSLSMDPPVNETEQCYKAHSHSTVLQGLPFGGIPTVLAINFLAWLVLLLIFSCLRKAAWDYGRLALLIDN----------DSLTSLFYGEPSEKEKSPC-----EISPSEASTKDVT---NCGFL----FF---RDEEIQSKCGSDAITYLSYQRHLLVVLLAVCCISVAIILPVNFSGDMLGDSPAQFGRTTIVNVPTKDRFLWLHSVFALVYFLFSVLCMRHHTSSLHYKEDDKVARTLMITKIPSEISDASLFTKHFHEAYPSCTVTDVQFCYDVRHLMKLDKERRRAMKGRMYFAGRAQKEGKIQIKIHP--CARLCPCDCCGFQQVEAEQYYGELEERLTDEFTAERNRITLKRLGAVFVTFQDERMTAVIIKDYNRLPCH--RAPQQSSVTPLLKSHKWKVHYAPAPSDIIWENL 404          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Xenopus
Match: tmem63a (transmembrane protein 63A [Source:NCBI gene;Acc:779796])

HSP 1 Score: 205.682 bits (522), Expect = 1.134e-95
Identity = 99/208 (47.60%), Postives = 143/208 (68.75%), Query Frame = 2
Query: 1460 NIVLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFINSKIH 2083
            N V+++F P+ ++W+ S LLP IVYYS ++  HWTK+ E+  ++ K Y FLI MVLILPSLG+ SL  F  WLF  + + L        C+F P   AFFVNY+I +AF+G   EL+R+P LI+Y    I+ +S+ E   I++N  +E++FG  Y+W+LCVFTV + YS  CP+IVPFGLIY++ K+ VDR+N+Y+AY  + ++ KIH
Sbjct:  459 NPVISQFFPTLMLWSFSALLPTIVYYSTLLEAHWTKSAENRIMMHKVYIFLIFMVLILPSLGLTSLDFFFRWLFD-RALDLQG-PVRLECVFLPDQGAFFVNYVIASAFVGNGMELMRLPGLILYTIRMIMAKSAAERRNIKQNQAFEYEFGAMYAWMLCVFTVVMAYSITCPIIVPFGLIYLLLKHMVDRHNLYYAYLPTKLDKKIH 664          

HSP 2 Score: 166.777 bits (421), Expect = 1.134e-95
Identity = 124/431 (28.77%), Postives = 214/431 (49.65%), Query Frame = 3
Query:  162 FEGIPQNFTINIVTFIILFVLFCFLRKNAWNHGRIALLTKNRRKEQSSTGYNIWNTVTLSEKNENEETDSTEFDEKTYLRRASVIDTTSQFDKGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGNGTKVKYNDFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIRRTMVPKFCGRFHSCCI----EEVDVIDYYND-EILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDYHS-SCS---LLNYPQTSALSNDIKSAYWTISYAPPSNVINWENLCHPYKKWLIKAXXXXXXXXXXXXXXTTPTYALNVL 1427
            F GIP    +++  F+ L + F  +R++ W++GR+AL+      +  S+ ++ +  ++ S   E  E D+                       GF  W+   + ++D+DI ++ G DA  YL FQ+++I    I +++S+ VILPVN+ GN        F  TTI NL  + +++W+H V++ +Y    +  + H  + ++    N    TL I G+P+     ++ L HF EAYP C ++++   +++  LI L+ +R+ A             TG R  + PK CG+F  CC+    E  D I+YY      ++E   +K+ V   D  +G+ FVTF     +  +L+D+++  CS     +  Q SA S  + ++ W ++YA     I W NL     KW  + + IN  LFI LF LTTP+  ++ +
Sbjct:   46 FGGIPTVLVLDVACFMFLLLAFAIIRRHFWDYGRVALV-----YDADSSPHSRYRRLSSSSGGEELERDN-----------------------GFCYWMTSTFQMNDEDIYDRCGEDATHYLSFQRHIICLLIIASILSVGVILPVNLSGNLLDKDPLSFGRTTIANLQHHDRLLWLHTVVAVVYLILTVVFMRHHLSAIKYKEENTVKQTLFITGLPRNVDKETVRL-HFSEAYPSCQVEEVNLCYDVADLIRLSKERKKAEKNLAYFTNLLNKTGRRVLINPKPCGQF-CCCVVRGCEREDAIEYYTRVRDGVMEEYARKQEVVC-DIPLGIVFVTFADKSMSTLILKDFNAVKCSGYRCAHETQPSAYSKQLGTSRWGVTYATYPENICWGNLSLQGVKWWARCLGINFCLFIVLFFLTTPSIIISTM 445          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Xenopus
Match: tmem63a (transmembrane protein 63A [Source:NCBI gene;Acc:779796])

HSP 1 Score: 205.682 bits (522), Expect = 4.921e-93
Identity = 99/208 (47.60%), Postives = 143/208 (68.75%), Query Frame = 2
Query: 1460 NIVLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFINSKIH 2083
            N V+++F P+ ++W+ S LLP IVYYS ++  HWTK+ E+  ++ K Y FLI MVLILPSLG+ SL  F  WLF  + + L        C+F P   AFFVNY+I +AF+G   EL+R+P LI+Y    I+ +S+ E   I++N  +E++FG  Y+W+LCVFTV + YS  CP+IVPFGLIY++ K+ VDR+N+Y+AY  + ++ KIH
Sbjct:  446 NPVISQFFPTLMLWSFSALLPTIVYYSTLLEAHWTKSAENRIMMHKVYIFLIFMVLILPSLGLTSLDFFFRWLFD-RALDLQG-PVRLECVFLPDQGAFFVNYVIASAFVGNGMELMRLPGLILYTIRMIMAKSAAERRNIKQNQAFEYEFGAMYAWMLCVFTVVMAYSITCPIIVPFGLIYLLLKHMVDRHNLYYAYLPTKLDKKIH 651          

HSP 2 Score: 157.918 bits (398), Expect = 4.921e-93
Identity = 121/430 (28.14%), Postives = 202/430 (46.98%), Query Frame = 3
Query:  162 FEGIPQNFTINIVTFIILFVLFCFLRKNAWNHGRIALLTKNRRKEQSSTGYNIWNTVTLSEKNENEETDSTEFDEKTYLRRASVIDTTSQFDKGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGNGTKVKYNDFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIRRTMVPKFCGRFHSCCI---EEVDVIDYYND-EILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDYHS-SCS---LLNYPQTSALSNDIKSAYWTISYAPPSNVINWENLCHPYKKWLIKAXXXXXXXXXXXXXXTTPTYALNVL 1427
            F GIP    +++  F+ L + F  +R++ W++GR+AL+    R   +   Y                                V+ T   F            + SD+DI ++ G DA  YL FQ+++I    I +++S+ VILPVN+ GN        F  TTI NL  + +++W+H V++ +Y    +  + H  + ++    N    TL I G+P+     ++ L HF EAYP C ++++   +++  LI L+ +R+ A             TG R  + PK CG+F  C +   E  D I+YY      ++E   +K+ V   D  +G+ FVTF     +  +L+D+++  CS     +  Q SA S  + ++ W ++YA     I W NL     KW  + + IN  LFI LF LTTP+  ++ +
Sbjct:   46 FGGIPTVLVLDVACFMFLLLAFAIIRRHFWDYGRVALVYDADRYVIAQIPYA-----------------------------THVLPTVCPF------------LSSDEDIYDRCGEDATHYLSFQRHIICLLIIASILSVGVILPVNLSGNLLDKDPLSFGRTTIANLQHHDRLLWLHTVVAVVYLILTVVFMRHHLSAIKYKEENTVKQTLFITGLPRNVDKETVRL-HFSEAYPSCQVEEVNLCYDVADLIRLSKERKKAEKNLAYFTNLLNKTGRRVLINPKPCGQFCCCVVRGCEREDAIEYYTRVRDGVMEEYARKQEVVC-DIPLGIVFVTFADKSMSTLILKDFNAVKCSGYRCAHETQPSAYSKQLGTSRWGVTYATYPENICWGNLSLQGVKWWARCLGINFCLFIVLFFLTTPSIIISTM 432          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Mouse
Match: Tmem63a (transmembrane protein 63a [Source:MGI Symbol;Acc:MGI:2384789])

HSP 1 Score: 206.838 bits (525), Expect = 8.641e-103
Identity = 98/218 (44.95%), Postives = 149/218 (68.35%), Query Frame = 2
Query: 1460 NIVLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFINSKIHRLAMSFTVFA 2113
            N V+++F P+ ++W+ S LLP IVYYS ++  HWT++ E+  ++ K Y FLI MVLILPSLG+ SL  F  WLF   + + +       C+F P   AFFVNY+I +AFIG+  EL+R+P LI+Y +  I+ +++ +   +++N  +E++FG  Y+W+LCVFTV + YS  CP+IVPFGLIYI+ K+ VDR+N+YFAY  + +  +IH  A++  + A
Sbjct:  459 NPVISQFFPTLLLWSFSALLPSIVYYSTLLESHWTRSGENRIMVSKVYIFLIFMVLILPSLGLTSLDFFFRWLFDKTSSETS---IRLECVFLPDQGAFFVNYVIASAFIGSGMELLRLPGLILYTFRMIMAKTAADRRNVKQNQAFEYEFGAMYAWMLCVFTVIMAYSITCPIIVPFGLIYILLKHMVDRHNLYFAYLPAKLEKRIHFAAVNQALAA 673          

HSP 2 Score: 188.734 bits (478), Expect = 8.641e-103
Identity = 141/473 (29.81%), Postives = 230/473 (48.63%), Query Frame = 3
Query:   90 SKATPVCDRVNIYRITNDT---------AVIYG--FEGIPQNFTINIVTFIILFVLFCFLRKNAWNHGRIALLTKN------RRKEQSSTGYNIWNTVTLSEKNENEETDSTEFDEKTYLRRASVIDTTSQFDKGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGNGTKVKYNDFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIRRTMVPKFCGRFHSCCI---EEVDVIDYY---NDEILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDYHS-SCSLL---NYPQTSALSNDIKSAYWTISYAPPSNVINWENLCHPYKKWLIKAXXXXXXXXXXXXXXTTPTYALNVL 1427
            SKA  V +R+ +    ND+          V+ G  F GIP    +++  F+ L ++F  +R+  W++GRIAL+++       +R   SS+G          +  ENE                           G   WL   + + D  I E  G DA  YL FQ+++IF   +I+ +SL VILPVN+ G+        F  TTI NL + + ++W+H V S +Y F  +  +WH   +++    +    TL I G+P+E+     +  HF++AYP C + D+Q  +++ KLI+L  +R+    +        A TG R  + PK CG+F  C +   E  D I YY   ND +L    +   E  +  D+ +G+AFVTF     A  +L+D+++  C  L     PQ S+ S ++  + WT+++A     I W+NL     +W ++ + IN  LF+ LF LTTP+  ++ +
Sbjct:   12 SKAVFVRERLGLGERPNDSYCYNSAKNSTVLQGVTFGGIPTVLLLDVSCFLFLILVFSIIRRRFWDYGRIALVSEAGSEARFQRLSSSSSG---------QQDFENE--------------------------LGCCPWLTAIFRLHDDQILEWCGEDAIHYLSFQRHIIFLLVVISFLSLCVILPVNLSGDLLGKDPYSFGRTTIANLQTDNDLLWLHTVFSVIYLFLTVGFMWHHTRSIRYKEESLVRQTLFITGLPREAR-KETVESHFRDAYPTCEVVDVQLCYSVAKLIYLCKERKKTEKSLTYYTNLQAKTGRRTLINPKPCGQFCCCEVQGCEREDAISYYTRMNDSLL---ERITAEESRVQDQPLGMAFVTFREKSMATYILKDFNACKCQGLRCKGEPQPSSYSRELCVSKWTVTFASYPEDICWKNLSIQGVRWWLQWLGINFSLFVVLFFLTTPSIIMSTM 445          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Mouse
Match: Tmem63a (transmembrane protein 63a [Source:MGI Symbol;Acc:MGI:2384789])

HSP 1 Score: 206.838 bits (525), Expect = 8.641e-103
Identity = 98/218 (44.95%), Postives = 149/218 (68.35%), Query Frame = 2
Query: 1460 NIVLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFINSKIHRLAMSFTVFA 2113
            N V+++F P+ ++W+ S LLP IVYYS ++  HWT++ E+  ++ K Y FLI MVLILPSLG+ SL  F  WLF   + + +       C+F P   AFFVNY+I +AFIG+  EL+R+P LI+Y +  I+ +++ +   +++N  +E++FG  Y+W+LCVFTV + YS  CP+IVPFGLIYI+ K+ VDR+N+YFAY  + +  +IH  A++  + A
Sbjct:  459 NPVISQFFPTLLLWSFSALLPSIVYYSTLLESHWTRSGENRIMVSKVYIFLIFMVLILPSLGLTSLDFFFRWLFDKTSSETS---IRLECVFLPDQGAFFVNYVIASAFIGSGMELLRLPGLILYTFRMIMAKTAADRRNVKQNQAFEYEFGAMYAWMLCVFTVIMAYSITCPIIVPFGLIYILLKHMVDRHNLYFAYLPAKLEKRIHFAAVNQALAA 673          

HSP 2 Score: 188.734 bits (478), Expect = 8.641e-103
Identity = 141/473 (29.81%), Postives = 230/473 (48.63%), Query Frame = 3
Query:   90 SKATPVCDRVNIYRITNDT---------AVIYG--FEGIPQNFTINIVTFIILFVLFCFLRKNAWNHGRIALLTKN------RRKEQSSTGYNIWNTVTLSEKNENEETDSTEFDEKTYLRRASVIDTTSQFDKGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGNGTKVKYNDFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIRRTMVPKFCGRFHSCCI---EEVDVIDYY---NDEILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDYHS-SCSLL---NYPQTSALSNDIKSAYWTISYAPPSNVINWENLCHPYKKWLIKAXXXXXXXXXXXXXXTTPTYALNVL 1427
            SKA  V +R+ +    ND+          V+ G  F GIP    +++  F+ L ++F  +R+  W++GRIAL+++       +R   SS+G          +  ENE                           G   WL   + + D  I E  G DA  YL FQ+++IF   +I+ +SL VILPVN+ G+        F  TTI NL + + ++W+H V S +Y F  +  +WH   +++    +    TL I G+P+E+     +  HF++AYP C + D+Q  +++ KLI+L  +R+    +        A TG R  + PK CG+F  C +   E  D I YY   ND +L    +   E  +  D+ +G+AFVTF     A  +L+D+++  C  L     PQ S+ S ++  + WT+++A     I W+NL     +W ++ + IN  LF+ LF LTTP+  ++ +
Sbjct:   12 SKAVFVRERLGLGERPNDSYCYNSAKNSTVLQGVTFGGIPTVLLLDVSCFLFLILVFSIIRRRFWDYGRIALVSEAGSEARFQRLSSSSSG---------QQDFENE--------------------------LGCCPWLTAIFRLHDDQILEWCGEDAIHYLSFQRHIIFLLVVISFLSLCVILPVNLSGDLLGKDPYSFGRTTIANLQTDNDLLWLHTVFSVIYLFLTVGFMWHHTRSIRYKEESLVRQTLFITGLPREAR-KETVESHFRDAYPTCEVVDVQLCYSVAKLIYLCKERKKTEKSLTYYTNLQAKTGRRTLINPKPCGQFCCCEVQGCEREDAISYYTRMNDSLL---ERITAEESRVQDQPLGMAFVTFREKSMATYILKDFNACKCQGLRCKGEPQPSSYSRELCVSKWTVTFASYPEDICWKNLSIQGVRWWLQWLGINFSLFVVLFFLTTPSIIMSTM 445          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Mouse
Match: Tmem63b (transmembrane protein 63b [Source:MGI Symbol;Acc:MGI:2387609])

HSP 1 Score: 194.897 bits (494), Expect = 1.536e-51
Identity = 101/218 (46.33%), Postives = 147/218 (67.43%), Query Frame = 2
Query: 1460 NIVLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFINSKIHRLAMSFTVFA 2113
            N ++ +F P+ ++W  S LLP IVYYS     HWT++ E+   + K YTFLI MVL+LPSLG++SL  F  WLF  + +      F   C+F P N AFFVNY+I +AFIG   +L+RIP L++Y+    + RS+ E   ++++  +EFQFG  Y+W++CVFTV +TYS  CP+IVPFGL+Y++ K+ VDRYN+Y+AY  + ++ KIH  A++  V A
Sbjct:  472 NPIITQFFPTLLLWCFSALLPTIVYYSAFFEAHWTRSGENRTTMHKCYTFLIFMVLLLPSLGLSSLDLFFRWLFDKKFLAEAAIRFE--CVFLPDNGAFFVNYVIASAFIGNAMDLLRIPGLLMYMIRLCLARSAAERRNVKRHQAYEFQFGAAYAWMMCVFTVVMTYSITCPIIVPFGLMYMLLKHLVDRYNLYYAYLPAKLDKKIHSGAVNQVVAA 687          

HSP 2 Score: 177.948 bits (450), Expect = 5.985e-46
Identity = 120/403 (29.78%), Postives = 202/403 (50.12%), Query Frame = 3
Query:  162 FEGIPQNFTINIVTFIILFVLFCFLRKNAWNHGRIALLT---KNRRKEQSSTGYNIWNTVTLSEKNENEETDST-EFDEKTYLRRASVIDTTSQFDK---GFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGNGTKVKYNDFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIRRTMVPKFCGRFHSCC-----IEEVDVIDYYNDEILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDYH----SSCSLLNYPQTSALSNDIKSAYWTISYAPPSNVINWENL 1322
            F G+P    ++ + F+ L  LF  LRK AW++GR+AL+T   + RR+E+              E+ E E   S    D      R + + ++  FD+   GF SWL   + + D +IR+K G DA  YL FQ+++I    ++ V+S+ ++LPVN  G+  +     F  TTI NL S + ++W+H   +FLY    +  +    + ++    +    TL I+GI K +     I  HF+EAYP C + + +  +N+ +L+ L+ +R+ A   +       +   +   + PK CG  H CC      E+V+ I+YY      L+   ++E  K  +K +G+AFVTF        +L+D++      C+    P+ S+ S  +  + WT++YAP    I WE+L
Sbjct:   38 FGGVPTVLALDFMCFLALLFLFSILRKVAWDYGRLALVTDADRLRRQER--------------ERVEQEYVASAMHGDSHDRYERLTSVSSSVDFDQRDNGFCSWLTAIFRIKDDEIRDKCGGDAVHYLSFQRHIIGLLVVVGVLSVGIVLPVNFSGDLLENNAYSFGRTTIANLKSGNNLLWLHTSFAFLYLLLTVYSMRRHTSKMRYKEDDLVKRTLFINGISKYAE-SEKIKKHFEEAYPNCTVLEARPCYNVARLMFLDAERKKAERGKLYFTNLQSKENVPAMINPKPCG--HLCCCVVRGCEQVEAIEYYTKLEQRLKEDYRREKEKVNEKPLGMAFVTFHNETITAIILKDFNVCKCQGCTCRGEPRASSCSEALHISNWTVTYAPDPQNIYWEHL 423          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Mouse
Match: Tmem63c (transmembrane protein 63c [Source:MGI Symbol;Acc:MGI:2444386])

HSP 1 Score: 192.2 bits (487), Expect = 9.716e-51
Identity = 96/224 (42.86%), Postives = 144/224 (64.29%), Query Frame = 2
Query: 1442 IKKISMNIVLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFINSKIHRLAMSFTVFA 2113
            I+K+   IV  +F PS ++WA +  +P +VY S  +  HWT++ ++  ++ K Y FL+ MV+ILPS+G+ SL  F+ WLF I  ++  T  F   C+F P N AFF+NY+ITAA +GT  EL+R+  L  Y     + +S  E   IRKN   +FQFG  Y+W+L VF+V + YS  CP+IVPFGL+Y+  K+  DRYN+Y++Y  + +N++IH  A+   +FA
Sbjct:  441 IEKLQSPIV-TQFFPSVLLWAFTVTMPLLVYLSAFLEAHWTRSSQNLIIVHKCYIFLVFMVVILPSMGLTSLHVFLRWLFDIYYLEHATIRFQ--CVFLPDNGAFFINYVITAALLGTGMELMRLGSLCTYCTRLFLSKSEPERVHIRKNQATDFQFGREYAWMLNVFSVVMAYSITCPIIVPFGLLYLCMKHITDRYNMYYSYAPTKLNAQIHMAAVYQAIFA 661          

HSP 2 Score: 182.57 bits (462), Expect = 1.538e-47
Identity = 119/394 (30.20%), Postives = 200/394 (50.76%), Query Frame = 3
Query:  162 FEGIPQNFTINIVTFIILFVLFCFLRKNAWNHGRIALLTKNRRKEQSSTGYNIWNTVTLSEKNENEETDSTEFDEKTYLRRASVIDTTSQFDKGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGNGTKVKYND-FATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIRRTMVPKF-CGRFHSC----CIEEVDVIDYYNDEILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDY-HSSCSLLNYPQTSALSNDIKSAYWTISYAPPSNVINWENL 1322
            F GIP    +NI+ ++ + +L+ FLRK AW++GR+ALL  N          +   ++   E++E         + +   RR          D+GF SW      + D+D+  K G+DA  Y+ FQ +LI    I+ + SL +ILPVN    GT + +N  F  TTI+N+S+ S+ +W+H++ +FLYF   +A + H             + TL+I  +P E     II  HF EAYP C +  + F +++R LI L+ QR  A+  +     +   TG  + M+    C R   C    C +EVD   YY++    L  +   E+ +   K++ + FVTF+     R++ +DY +  C    +P+ S+++  +K+ +W +++AP    I W++L
Sbjct:   33 FGGIPTVLVLNIILWVFVVLLYSFLRKAAWDYGRLALLIHN----------DSLTSLIYGEQSEKSSPSEVSLEAE---RR----------DRGFSSWFFNSLTMRDRDLINKCGDDARIYITFQYHLIIFVLILCIPSLGIILPVNY--IGTVLDWNSHFGRTTIVNVSTESKFLWLHSLFAFLYFLINLAFMGHHCLGFVPKKSLHFTRTLMITYVPTEIQDPEIISKHFHEAYPGCVVTRVHFCYDVRNLIDLDDQRRHAMRGRLYYTAKAKKTG--KVMIKTHPCSRLCFCKCWTCFKEVDAEQYYSELEEQLTDEFNAELNRVQLKRLDLIFVTFQDARTVRRIYDDYKYIHCG--RHPKQSSVTTIVKNYHWRVAHAPHPKDIIWKHL 397          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Mouse
Match: Tmem63c (transmembrane protein 63c [Source:MGI Symbol;Acc:MGI:2444386])

HSP 1 Score: 192.2 bits (487), Expect = 9.716e-51
Identity = 96/224 (42.86%), Postives = 144/224 (64.29%), Query Frame = 2
Query: 1442 IKKISMNIVLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFINSKIHRLAMSFTVFA 2113
            I+K+   IV  +F PS ++WA +  +P +VY S  +  HWT++ ++  ++ K Y FL+ MV+ILPS+G+ SL  F+ WLF I  ++  T  F   C+F P N AFF+NY+ITAA +GT  EL+R+  L  Y     + +S  E   IRKN   +FQFG  Y+W+L VF+V + YS  CP+IVPFGL+Y+  K+  DRYN+Y++Y  + +N++IH  A+   +FA
Sbjct:  441 IEKLQSPIV-TQFFPSVLLWAFTVTMPLLVYLSAFLEAHWTRSSQNLIIVHKCYIFLVFMVVILPSMGLTSLHVFLRWLFDIYYLEHATIRFQ--CVFLPDNGAFFINYVITAALLGTGMELMRLGSLCTYCTRLFLSKSEPERVHIRKNQATDFQFGREYAWMLNVFSVVMAYSITCPIIVPFGLLYLCMKHITDRYNMYYSYAPTKLNAQIHMAAVYQAIFA 661          

HSP 2 Score: 182.57 bits (462), Expect = 1.538e-47
Identity = 119/394 (30.20%), Postives = 200/394 (50.76%), Query Frame = 3
Query:  162 FEGIPQNFTINIVTFIILFVLFCFLRKNAWNHGRIALLTKNRRKEQSSTGYNIWNTVTLSEKNENEETDSTEFDEKTYLRRASVIDTTSQFDKGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGNGTKVKYND-FATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIRRTMVPKF-CGRFHSC----CIEEVDVIDYYNDEILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDY-HSSCSLLNYPQTSALSNDIKSAYWTISYAPPSNVINWENL 1322
            F GIP    +NI+ ++ + +L+ FLRK AW++GR+ALL  N          +   ++   E++E         + +   RR          D+GF SW      + D+D+  K G+DA  Y+ FQ +LI    I+ + SL +ILPVN    GT + +N  F  TTI+N+S+ S+ +W+H++ +FLYF   +A + H             + TL+I  +P E     II  HF EAYP C +  + F +++R LI L+ QR  A+  +     +   TG  + M+    C R   C    C +EVD   YY++    L  +   E+ +   K++ + FVTF+     R++ +DY +  C    +P+ S+++  +K+ +W +++AP    I W++L
Sbjct:   33 FGGIPTVLVLNIILWVFVVLLYSFLRKAAWDYGRLALLIHN----------DSLTSLIYGEQSEKSSPSEVSLEAE---RR----------DRGFSSWFFNSLTMRDRDLINKCGDDARIYITFQYHLIIFVLILCIPSLGIILPVNY--IGTVLDWNSHFGRTTIVNVSTESKFLWLHSLFAFLYFLINLAFMGHHCLGFVPKKSLHFTRTLMITYVPTEIQDPEIISKHFHEAYPGCVVTRVHFCYDVRNLIDLDDQRRHAMRGRLYYTAKAKKTG--KVMIKTHPCSRLCFCKCWTCFKEVDAEQYYSELEEQLTDEFNAELNRVQLKRLDLIFVTFQDARTVRRIYDDYKYIHCG--RHPKQSSVTTIVKNYHWRVAHAPHPKDIIWKHL 397          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. UniProt/SwissProt
Match: sp|X1WEM4|CSC1_DANRE (Calcium permeable stress-gated cation channel 1 OS=Danio rerio OX=7955 GN=tmem63c PE=3 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 2.471e-108
Identity = 101/218 (46.33%), Postives = 146/218 (66.97%), Query Frame = 2
Query: 1460 NIVLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFINSKIHRLAMSFTVFA 2113
            N V+ +F P+ ++WA S LLPFIVYYS     HWT++ E+   + K +  L+ MV+ILPSLG++SL  F  WLF ++ +      F   C+F P N AFFVNY+IT++ IGT  EL+RIP L++Y       +S  E   ++ +  +EFQFGL Y+W +C+F+V++TYS  CP+IVPFGL+Y++ K+ VDRYNIY+AY  + +N +IH  A+S  V A
Sbjct:  463 NPVITQFFPTLLLWAFSILLPFIVYYSSFFEYHWTRSGENQVTMHKCFLLLVFMVIILPSLGLSSLNLFFRWLFDVRFLDETDVKFQ--CVFLPDNGAFFVNYVITSSLIGTAMELLRIPALLVYSLRLCFAKSKAECIHVKISQAYEFQFGLEYAWTMCIFSVSMTYSITCPVIVPFGLLYLVLKHMVDRYNIYYAYTPTKLNQRIHAAAISQVVVA 678          

HSP 2 Score: 205.682 bits (522), Expect = 2.471e-108
Identity = 147/444 (33.11%), Postives = 238/444 (53.60%), Query Frame = 3
Query:  126 YRITNDTAVIYG--FEGIPQNFTINIVTFIILFVLFCFLRKNAWNHGRIALLTKNRRKEQSSTGYNIWNTVTLSEKNENEETDSTEFDEKTYLRRASVIDTTSQFDKGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGNGTKVKYNDFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIRRTMVPKF-CGRFHSCCI---EEVDVIDYYN--DEILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDYHSSCSLLNYPQTSALSNDIKSAYWTISYAPPSNVINWENL--CHPYKKWLIKAXXXXXXXXXXXXXXTTPTYALNVL 1427
            YR  + ++V+ G  F G+P    IN+V ++IL ++F  LRK AW++GR+ALL KN          +   ++   E++E E+T S      +  +           D GF SWL   Y + D++IR K G DA  YL FQ+++I    ++ ++SL +ILPVN+ GN       +F  TT++N+ + +  +W+H++ + LYF   +  + H ++ L+     + + TL+I  IP+E S   +I  H  EAYP C + DI F  N++KL+ L+ +R  A+  +     +    G  R M+    C +   C I   E+VD   YY+  +E L  E   +K  +    K++G+AFVTF        +++DY S     + PQ S+++  ++S  W +SYAP  N I WENL  C P  +W ++ IL+N +LF+ LF LTTP   +N +
Sbjct:   34 YRSHSRSSVLQGLPFGGVPTVLAINVVLWLILLLIFSCLRKAAWDYGRLALLMKN----------DSLTSLFYGEQSEKEKTPSDSSPSDSETK-----------DMGFCSWLTSLYHMKDEEIRSKCGIDAVTYLSFQRHIILLMMVVCLLSLTIILPVNLSGNLLGDNPENFGRTTVVNVPAQNIFLWLHSIFALLYFVITVLCMAHHSSRLEYREDEKVARTLMITSIPREISDPGLITKHLHEAYPSCTVTDIHFCFNVQKLMKLDSERRKAMKGRLYFTTKAQKNG--RIMIKTHPCAQIFCCDICGFEKVDAEQYYSELEEKLTDEFNAEKNWISM--KRLGIAFVTFRDERMTAVIVKDY-SRARCRHKPQQSSITTVVRSHQWDVSYAPAPNDIIWENLSVCGP--RWWLRCILLNILLFLLLFFLTTPAIIVNTM 449          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q91YT8|CSCL1_MOUSE (CSC1-like protein 1 OS=Mus musculus OX=10090 GN=Tmem63a PE=1 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 5.258e-102
Identity = 98/218 (44.95%), Postives = 149/218 (68.35%), Query Frame = 2
Query: 1460 NIVLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFINSKIHRLAMSFTVFA 2113
            N V+++F P+ ++W+ S LLP IVYYS ++  HWT++ E+  ++ K Y FLI MVLILPSLG+ SL  F  WLF   + + +       C+F P   AFFVNY+I +AFIG+  EL+R+P LI+Y +  I+ +++ +   +++N  +E++FG  Y+W+LCVFTV + YS  CP+IVPFGLIYI+ K+ VDR+N+YFAY  + +  +IH  A++  + A
Sbjct:  459 NPVISQFFPTLLLWSFSALLPSIVYYSTLLESHWTRSGENRIMVSKVYIFLIFMVLILPSLGLTSLDFFFRWLFDKTSSETS---IRLECVFLPDQGAFFVNYVIASAFIGSGMELLRLPGLILYTFRMIMAKTAADRRNVKQNQAFEYEFGAMYAWMLCVFTVIMAYSITCPIIVPFGLIYILLKHMVDRHNLYFAYLPAKLEKRIHFAAVNQALAA 673          

HSP 2 Score: 188.734 bits (478), Expect = 5.258e-102
Identity = 141/473 (29.81%), Postives = 230/473 (48.63%), Query Frame = 3
Query:   90 SKATPVCDRVNIYRITNDT---------AVIYG--FEGIPQNFTINIVTFIILFVLFCFLRKNAWNHGRIALLTKN------RRKEQSSTGYNIWNTVTLSEKNENEETDSTEFDEKTYLRRASVIDTTSQFDKGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGNGTKVKYNDFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIRRTMVPKFCGRFHSCCI---EEVDVIDYY---NDEILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDYHS-SCSLL---NYPQTSALSNDIKSAYWTISYAPPSNVINWENLCHPYKKWLIKAXXXXXXXXXXXXXXTTPTYALNVL 1427
            SKA  V +R+ +    ND+          V+ G  F GIP    +++  F+ L ++F  +R+  W++GRIAL+++       +R   SS+G          +  ENE                           G   WL   + + D  I E  G DA  YL FQ+++IF   +I+ +SL VILPVN+ G+        F  TTI NL + + ++W+H V S +Y F  +  +WH   +++    +    TL I G+P+E+     +  HF++AYP C + D+Q  +++ KLI+L  +R+    +        A TG R  + PK CG+F  C +   E  D I YY   ND +L    +   E  +  D+ +G+AFVTF     A  +L+D+++  C  L     PQ S+ S ++  + WT+++A     I W+NL     +W ++ + IN  LF+ LF LTTP+  ++ +
Sbjct:   12 SKAVFVRERLGLGERPNDSYCYNSAKNSTVLQGVTFGGIPTVLLLDVSCFLFLILVFSIIRRRFWDYGRIALVSEAGSEARFQRLSSSSSG---------QQDFENE--------------------------LGCCPWLTAIFRLHDDQILEWCGEDAIHYLSFQRHIIFLLVVISFLSLCVILPVNLSGDLLGKDPYSFGRTTIANLQTDNDLLWLHTVFSVIYLFLTVGFMWHHTRSIRYKEESLVRQTLFITGLPREAR-KETVESHFRDAYPTCEVVDVQLCYSVAKLIYLCKERKKTEKSLTYYTNLQAKTGRRTLINPKPCGQFCCCEVQGCEREDAISYYTRMNDSLL---ERITAEESRVQDQPLGMAFVTFREKSMATYILKDFNACKCQGLRCKGEPQPSSYSRELCVSKWTVTFASYPEDICWKNLSIQGVRWWLQWLGINFSLFVVLFFLTTPSIIMSTM 445          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. UniProt/SwissProt
Match: sp|O94886|CSCL1_HUMAN (CSC1-like protein 1 OS=Homo sapiens OX=9606 GN=TMEM63A PE=1 SV=3)

HSP 1 Score: 202.216 bits (513), Expect = 3.214e-99
Identity = 96/218 (44.04%), Postives = 145/218 (66.51%), Query Frame = 2
Query: 1460 NIVLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFINSKIHRLAMSFTVFA 2113
            N ++++F P+ ++W+ S LLP IVYYS ++  HWTK+ E+  ++ K Y FLI MVLILPSLG+ SL  F  WLF   + + +       C+F P   AFFVNY+I +AFIG   EL+R+P LI+Y +  I+ +++ +   +++N  ++++FG  Y+W+LCVFTV V YS  CP+I PFGLIYI+ K+ VDR+N+YF Y  + +   IH  A++  + A
Sbjct:  460 NPIISQFFPTLLLWSFSALLPSIVYYSTLLESHWTKSGENQIMMTKVYIFLIFMVLILPSLGLTSLDFFFRWLFDKTSSEAS---IRLECVFLPDQGAFFVNYVIASAFIGNGMELLRLPGLILYTFRMIMAKTAADRRNVKQNQAFQYEFGAMYAWMLCVFTVIVAYSITCPIIAPFGLIYILLKHMVDRHNLYFVYLPAKLEKGIHFAAVNQALAA 674          

HSP 2 Score: 184.111 bits (466), Expect = 3.214e-99
Identity = 122/432 (28.24%), Postives = 207/432 (47.92%), Query Frame = 3
Query:  111 DRVN---IYRITNDTAVIYG--FEGIPQNFTINIVTFIILFVLFCFLRKNAWNHGRIALLTKNRRKEQSSTGYNIWNTVTLSEKNENEETDSTEFDEKTYLRRASVIDTTSQFD----KGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGNGTKVKYNDFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIRRTMVPKFCGRFHSCCIEEV-----DVIDYYNDEILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDYHS-SCSLL---NYPQTSALSNDIKSAYWTISYAPPSNVINWENLCHPYKKWLIK 1352
            DR N    Y    ++ V+ G  F GIP    I++  F+ L ++F  +R+  W++GRIAL++                                E D ++  +R S   ++ Q D     G   WL   + + D  I E  G DA  YL FQ+++IF   +++ +SL VILPVN+ G+        F  TTI NL + + ++W+H + + +Y F  +  + H   +++    N    TL I G+P+++     +  HF++AYP C + D+Q  +N+ KLI+L  +++    +          TG R  + PK CG+F  CC E +     D I YY      L  +  +E     D+ +G+AFVTF+    A  +L+D+++  C  L     PQ S+ S ++ ++ WT+++A     I W+NL     +W ++
Sbjct:   25 DRPNDSYCYNSAKNSTVLQGVTFGGIPTVLLIDVSCFLFLILVFSIIRRRFWDYGRIALVS--------------------------------EADSESRFQRLSSTSSSGQQDFENELGCCPWLTAIFRLHDDQILEWCGEDAIHYLSFQRHIIFLLVVVSFLSLCVILPVNLSGDLLDKDPYSFGRTTIANLQTDNDLLWLHTIFAVIYLFLTVGFMRHHTQSIKYKEENLVRRTLFITGLPRDAR-KETVESHFRDAYPTCEVVDVQLCYNVAKLIYLCKEKKKTEKSLTYYTNLQVKTGQRTLINPKPCGQF--CCCEVLGCEWEDAISYYTRMKDRLLERITEEERHVQDQPLGMAFVTFQEKSMATYILKDFNACKCQSLQCKGEPQPSSHSRELYTSKWTVTFAADPEDICWKNLSIQGLRWWLQ 421          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5R826|CSCL1_PONAB (CSC1-like protein 1 OS=Pongo abelii OX=9601 GN=TMEM63A PE=2 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 7.951e-99
Identity = 95/218 (43.58%), Postives = 145/218 (66.51%), Query Frame = 2
Query: 1460 NIVLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFINSKIHRLAMSFTVFA 2113
            N ++++F P+ ++W+ S LLP IVYYS ++  HWTK+ E+  ++ K Y FLI MVLILPSLG+ SL  F  WLF   + + +       C+F P   AFFVNY+I +AFIG   EL+R+P LI+Y +  I+ +++ +   +++N  ++++FG  Y+W+LCVFTV + YS  CP+I PFGLIYI+ K+ VDR+N+YF Y  + +   IH  A++  + A
Sbjct:  460 NPIISQFFPTLLLWSFSALLPSIVYYSTLLESHWTKSGENQIMMTKVYIFLIFMVLILPSLGLTSLDFFFRWLFDKTSSEAS---IRLECVFLPDQGAFFVNYVIASAFIGNGMELLRLPGLILYTFRMIMAKTAADRRNVKQNQAFQYEFGAMYAWMLCVFTVIMAYSITCPIIAPFGLIYILLKHMVDRHNLYFIYLPAKLEKGIHFAAVNQALAA 674          

HSP 2 Score: 184.496 bits (467), Expect = 7.951e-99
Identity = 121/430 (28.14%), Postives = 205/430 (47.67%), Query Frame = 3
Query:  111 DRVN---IYRITNDTAVIYG--FEGIPQNFTINIVTFIILFVLFCFLRKNAWNHGRIALLTKNRRKEQSSTGYNIWNTVTLSEKNENEETDSTEFDEKTYLRRASVIDTTSQFD----KGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGNGTKVKYNDFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIRRTMVPKFCGRFHSCCIEEV---DVIDYYNDEILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDYHS-SCSLL---NYPQTSALSNDIKSAYWTISYAPPSNVINWENLCHPYKKWLIK 1352
            DR N    Y    ++ V+ G  F GIP    I++  F+ L ++F  +R+  W++GRIAL++                                E D +   +R S   ++ Q D     G   WL   + + D  I E  G DA  YL FQ+++IF   +++ +SL VILPVN+ G+        F  TTI NL + + ++W+H + + +Y F  +  + H   +++    N    TL I G+P+++     +  HF++AYP C + D+Q  +N+ KLI+L  +R+    +          TG R  + PK CG+F  C ++     D I YY      L  +  +E     D+ +G+AFVTF+    A  +L+D+++  C  L     PQ S+ S ++ ++ WT+++A     I W+NL     +W ++
Sbjct:   25 DRPNDSYCYNSAKNSTVLQGVTFGGIPTVLLIDVSCFLFLILVFSIIRRRFWDYGRIALVS--------------------------------EADSEPRFQRLSSTSSSGQQDFENELGCCPWLTAIFRLHDDQILEWCGEDAIHYLSFQRHIIFLLVVVSFLSLCVILPVNLSGDLLDKDPYSFGRTTIANLQTDNDLLWLHTIFAVIYLFLTVGFMRHHTQSIKYKEENLVRRTLFITGLPRDAR-KETVESHFRDAYPTCEVVDVQLCYNVAKLIYLCKERKKTEKSLTYYTNLQVKTGQRTLINPKPCGQFCCCEVQGCEWEDAISYYTRMKDRLLERITEEERHVQDQPLGMAFVTFQEKSMATYILKDFNACKCQSLQCKGEPQPSSHSRELYTSKWTVTFAADPEDICWKNLSIQGLRWWLQ 421          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. UniProt/SwissProt
Match: sp|A0A452G813|CSCL1_CAPHI (CSC1-like protein 1 OS=Capra hircus OX=9925 GN=TMEM63A PE=1 SV=2)

HSP 1 Score: 199.904 bits (507), Expect = 9.841e-96
Identity = 94/218 (43.12%), Postives = 147/218 (67.43%), Query Frame = 2
Query: 1460 NIVLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFINSKIHRLAMSFTVFA 2113
            + ++++F P+ ++W+ S LLP IV YS ++  HWTK+ E+  ++ K Y FLI MVLILPSLG+ SL  F  WLF   + + +       C+F P   AFFVNY+I +AFIG   EL+R+P LI+Y +  ++ +++ +   ++++  +E++FG  Y+W+LCVFTV + YS  CP+IVPFGLIYI+ K+ VDR+N+YFAY  + +  +IH  A++  + A
Sbjct:  459 DPIISQFFPTLLLWSFSALLPTIVCYSTLLESHWTKSGENRIMMTKVYIFLIFMVLILPSLGLTSLDFFFRWLFDKTSSEAS---IRLECVFLPDQGAFFVNYVIASAFIGNGMELLRLPGLILYTFRMVMAKTAADRRNVKQHQAFEYEFGAMYAWMLCVFTVIMAYSITCPIIVPFGLIYILLKHMVDRHNLYFAYLPAKLEKRIHFAAVNQALAA 673          

HSP 2 Score: 174.866 bits (442), Expect = 9.841e-96
Identity = 125/443 (28.22%), Postives = 219/443 (49.44%), Query Frame = 3
Query:  126 YRITNDTAVIYG--FEGIPQNFTINIVTFIILFVLFCFLRKNAWNHGRIALLTKNRRKEQSSTGYNIWNTVTLSEKNENEETDSTEFDEKTYLRRASVIDTTSQFDKGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGNGTKVKYNDFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIRRTMVPKFCGRFHSCCI---EEVDVIDYYNDEILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDYHSS-CSLL---NYPQTSALSNDIKSAYWTISYAPPSNVINWENLCHPYKKWLIKAXXXXXXXXXXXXXXTTPTYALNVL 1427
            Y    ++ V+ G  F GIP    I++  F+ L V+F  +R+  W++GRIAL+++              N+ +   +  +  +   +F+ +                 G  SWL   + + D  I E  G DA  YL FQ+++IF   +++ +SL +ILPVN+ G+        F  TTI NL + + ++W+H + + LY    +  + H   +++    +    TL + G+PK++     +  HF++AYP C + ++Q  +N+ KLI+L  +R+    +          TG R  + PK CG+F  C +   E  D I YY      L  +  +E  +  D+ +G+AFVTF+    A  +L+D+++  C  L     PQ S+ S ++  + W++++A     I W+NL     +W  + + IN ILF+ LF LTTP+  L+ +
Sbjct:   33 YNSAKNSTVLQGVTFGGIPTVLFIDVSCFLFLIVVFSIIRRKFWDYGRIALVSEG-------------NSESRFRRLSSSSSGQQDFESEL----------------GCCSWLTAIFRLHDDQILEWCGEDAIHYLSFQRHIIFLLVVVSCLSLCIILPVNLSGDLLDKDPYSFGRTTIANLQTDNNLLWLHTIFAILYLILTVVFMRHHTQSIKYKEESLVRRTLFVTGLPKDAK-KETVESHFRDAYPTCEVVEVQLCYNVAKLIYLCKERKKTEKSLTYYTNLQVKTGQRTFINPKPCGQFCCCEVRGCEWEDAISYYTRMKDRLMERITEEECRVQDQPLGMAFVTFQEKSMATYILKDFNACKCQGLQCKGEPQPSSHSRELGISRWSVTFAAYPEDICWKNLSIQGFRWWFQWLGINFILFVGLFFLTTPSIILSTM 445          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. TrEMBL
Match: A0A2C9LU67 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106055488 PE=4 SV=1)

HSP 1 Score: 277.33 bits (708), Expect = 1.698e-132
Identity = 174/460 (37.83%), Postives = 254/460 (55.22%), Query Frame = 3
Query:   90 SKATPVCDRVNIYRITNDTAVIYGFEGIPQNFTINIVTFIILFVLFCFLRKNAWNHGRIALLTKNRRKE---QSSTGYNIWNTVTLSEKNENEETDSTEFDEKTYLRRASVIDTTSQFDKGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGN--GTKVKYNDFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIRRTMVPKFCGRFHSCCIEEVDVIDYYNDEILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDYHSSCSLLNYPQTSALSNDIKSAYWTISYAPPSNVINWENLCHPYKKWLIKAXXXXXXXXXXXXXXTTPTYALNVL-QLNFQSKK 1451
            S  +P C+ V  Y  +    +   + GIP    IN+V F+ L +LF  LRK AW++GR+AL+ +   KE   +  +GYN+W ++   +++    T S E  + T          TSQ DKG F W+  F+ + D DI  K G DA QYL FQ+YL+    IITV+S+ VILP+N  G+  GT     DF  TTI NL S   ++WVHAV++ +Y   +I ++ HF   L +    + S TL++  IPK   F S IL HF+EAYP+  + DIQFA+++  L+ L+  R+ A  A+      Y  TG R  M P  CG+   CC  EVD I++Y  E   L+  C++E   AY   +G+AF+T  +   A+++  D+ +SC   + PQ S+L  +++   W + +AP    I+WENL  P  +W   AI IN +L + LF LTTP   L+ L  LN   KK
Sbjct:   12 SNESPNCEEVARYGNSTHVFLYDKYNGIPDTLIINLVVFVCLLLLFTILRKIAWDYGRLALVNRTEEKEAIRKGRSGYNVWTSLFFGDRDRRSFTGSQESLDTT---------VTSQ-DKGMFRWIVAFWRLRDVDILNKCGRDAIQYLSFQRYLLVYISIITVLSVGVILPLNFQGSLLGTSA---DFGHTTIGNLESNDPILWVHAVMAVVYLVIVIGVLSHFRLNLDVEEDEQVSRTLMVSNIPKHKCFHSTILQHFEEAYPEANVTDIQFAYDIAGLVLLDKHRKRAAEAKQFCENIYKTTGQRPMMRPVICGQI-CCCCAEVDAINFYQAEEAELKKACEEEKETAYQTPLGIAFITLASESQAQRIRTDFRASCKGTHNPQMSSLYQELQVQNWIMHFAPSPESIHWENLSVPDWRWWTTAICINGVLIVLLFFLTTPIMFLHTLDMLNIDIKK 457          

HSP 2 Score: 227.639 bits (579), Expect = 1.698e-132
Identity = 125/278 (44.96%), Postives = 182/278 (65.47%), Query Frame = 2
Query: 1439 SIKKISMNI---VLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFINSKIHRLAMSFTVFAFXXXXXXXXXXXXVNKVKSNLVYIFVXXXXXXXXXXXXXXXXYGWFTQVK 2263
             IKK   N+    L +FLP+ ++W  S LLP IVY+S+ +IGHWTKT EH A++ KT+ F++ MVLILPSLG+ S  +   W+     +   T    W CIF PGN +FFVNYIIT+AFIG   EL+R  EL IY    +  RS  E   +RK+V+W+FQ+G+ Y+W+LC+  + V+YS  CPL+ PFGLIY++FK+ VDRYNI+FAY  S IN  IH  A++F ++A +LLQ N++ +  +     + V+IF  ++  ++L +F+    +GWF  ++
Sbjct:  454 DIKKPVENLHSAYLVQFLPTLLLWIFSALLPSIVYWSDQIIGHWTKTAEHHAIMRKTFIFILFMVLILPSLGLTSAKALFEWI-----VMSKTRSLQWQCIFLPGNGSFFVNYIITSAFIGAALELLRFSELFIYGVKLLFARSVAERAAVRKSVLWDFQYGVQYAWMLCMVAIIVSYSIPCPLVTPFGLIYLLFKHVVDRYNIFFAYNSSRINKHIHGSAVTFVLWAVILLQFNVVFFTGLRAEGFDPVFIFSCVALFITLIIFVGRISFGWFKHLR 726          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. TrEMBL
Match: A0A2C9LTU6 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106055488 PE=4 SV=1)

HSP 1 Score: 269.626 bits (688), Expect = 4.216e-130
Identity = 174/472 (36.86%), Postives = 255/472 (54.03%), Query Frame = 3
Query:   90 SKATPVCDRVNIYRITNDTAVIYGFEGIPQNFTINIVTFIILFVLFCFLRKNAWNHGRIALLTKN----------RRKE-----QSSTGYNIWNTVTLSEKNENEETDSTEFDEKTYLRRASVIDTTSQFDKGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGN--GTKVKYNDFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIRRTMVPKFCGRFHSCCIEEVDVIDYYNDEILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDYHSSCSLLNYPQTSALSNDIKSAYWTISYAPPSNVINWENLCHPYKKWLIKAXXXXXXXXXXXXXXTTPTYALNVL-QLNFQSKK 1451
            S  +P C+ V  Y  +    +   + GIP    IN+V F+ L +LF  LRK AW++GR+AL+ +           RR +     +  +GYN+W ++   +++    T S E  + T          TSQ DKG F W+  F+ + D DI  K G DA QYL FQ+YL+    IITV+S+ VILP+N  G+  GT     DF  TTI NL S   ++WVHAV++ +Y   +I ++ HF   L +    + S TL++  IPK   F S IL HF+EAYP+  + DIQFA+++  L+ L+  R+ A  A+      Y  TG R  M P  CG+   CC  EVD I++Y  E   L+  C++E   AY   +G+AF+T  +   A+++  D+ +SC   + PQ S+L  +++   W + +AP    I+WENL  P  +W   AI IN +L + LF LTTP   L+ L  LN   KK
Sbjct:   12 SNESPNCEEVARYGNSTHVFLYDKYNGIPDTLIINLVVFVCLLLLFTILRKIAWDYGRLALVNRTEENDGVPLVVRRPKVEAIRKGRSGYNVWTSLFFGDRDRRSFTGSQESLDTT---------VTSQ-DKGMFRWIVAFWRLRDVDILNKCGRDAIQYLSFQRYLLVYISIITVLSVGVILPLNFQGSLLGTSA---DFGHTTIGNLESNDPILWVHAVMAVVYLVIVIGVLSHFRLNLDVEEDEQVSRTLMVSNIPKHKCFHSTILQHFEEAYPEANVTDIQFAYDIAGLVLLDKHRKRAAEAKQFCENIYKTTGQRPMMRPVICGQI-CCCCAEVDAINFYQAEEAELKKACEEEKETAYQTPLGIAFITLASESQAQRIRTDFRASCKGTHNPQMSSLYQELQVQNWIMHFAPSPESIHWENLSVPDWRWWTTAICINGVLIVLLFFLTTPIMFLHTLDMLNIDIKK 469          

HSP 2 Score: 227.639 bits (579), Expect = 4.216e-130
Identity = 125/278 (44.96%), Postives = 182/278 (65.47%), Query Frame = 2
Query: 1439 SIKKISMNI---VLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFINSKIHRLAMSFTVFAFXXXXXXXXXXXXVNKVKSNLVYIFVXXXXXXXXXXXXXXXXYGWFTQVK 2263
             IKK   N+    L +FLP+ ++W  S LLP IVY+S+ +IGHWTKT EH A++ KT+ F++ MVLILPSLG+ S  +   W+     +   T    W CIF PGN +FFVNYIIT+AFIG   EL+R  EL IY    +  RS  E   +RK+V+W+FQ+G+ Y+W+LC+  + V+YS  CPL+ PFGLIY++FK+ VDRYNI+FAY  S IN  IH  A++F ++A +LLQ N++ +  +     + V+IF  ++  ++L +F+    +GWF  ++
Sbjct:  466 DIKKPVENLHSAYLVQFLPTLLLWIFSALLPSIVYWSDQIIGHWTKTAEHHAIMRKTFIFILFMVLILPSLGLTSAKALFEWI-----VMSKTRSLQWQCIFLPGNGSFFVNYIITSAFIGAALELLRFSELFIYGVKLLFARSVAERAAVRKSVLWDFQYGVQYAWMLCMVAIIVSYSIPCPLVTPFGLIYLLFKHVVDRYNIFFAYNSSRINKHIHGSAVTFVLWAVILLQFNVVFFTGLRAEGFDPVFIFSCVALFITLIIFVGRISFGWFKHLR 738          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. TrEMBL
Match: A0A2C9LTZ1 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106055488 PE=4 SV=1)

HSP 1 Score: 263.462 bits (672), Expect = 1.967e-128
Identity = 172/457 (37.64%), Postives = 250/457 (54.70%), Query Frame = 3
Query:   90 SKATPVCDRVNIYRITNDTAVIYGFEGIPQNFTINIVTFIILFVLFCFLRKNAWNHGRIALLTKNRRKEQSSTGYNIWNTVTLSEKNENEETDSTEFDEKTYLRRASVIDTTSQFDKGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGN--GTKVKYNDFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIRRTMVPKFCGRFHSCCIEEVDVIDYYNDEILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDYHSSCSLLNYPQTSALSNDIKSAYWTISYAPPSNVINWENLCHPYKKWLIKAXXXXXXXXXXXXXXTTPTYALNVL-QLNFQSKK 1451
            S  +P C+ V  Y  +    +   + GIP    IN+V F+ L +LF  LRK AW++GR+AL+  NR +E+       W ++   +++    T S E  + T          TSQ DKG F W+  F+ + D DI  K G DA QYL FQ+YL+    IITV+S+ VILP+N  G+  GT     DF  TTI NL S   ++WVHAV++ +Y   +I ++ HF   L +    + S TL++  IPK   F S IL HF+EAYP+  + DIQFA+++  L+ L+  R+ A  A+      Y  TG R  M P  CG+   CC  EVD I++Y  E   L+  C++E   AY   +G+AF+T  +   A+++  D+ +SC   + PQ S+L  +++   W + +AP    I+WENL  P  +W   AI IN +L + LF LTTP   L+ L  LN   KK
Sbjct:   12 SNESPNCEEVARYGNSTHVFLYDKYNGIPDTLIINLVVFVCLLLLFTILRKIAWDYGRLALV--NRTEEK-------WTSLFFGDRDRRSFTGSQESLDTT---------VTSQ-DKGMFRWIVAFWRLRDVDILNKCGRDAIQYLSFQRYLLVYISIITVLSVGVILPLNFQGSLLGTSA---DFGHTTIGNLESNDPILWVHAVMAVVYLVIVIGVLSHFRLNLDVEEDEQVSRTLMVSNIPKHKCFHSTILQHFEEAYPEANVTDIQFAYDIAGLVLLDKHRKRAAEAKQFCENIYKTTGQRPMMRPVICGQI-CCCCAEVDAINFYQAEEAELKKACEEEKETAYQTPLGIAFITLASESQAQRIRTDFRASCKGTHNPQMSSLYQELQVQNWIMHFAPSPESIHWENLSVPDWRWWTTAICINGVLIVLLFFLTTPIMFLHTLDMLNIDIKK 445          

HSP 2 Score: 228.024 bits (580), Expect = 1.967e-128
Identity = 125/278 (44.96%), Postives = 182/278 (65.47%), Query Frame = 2
Query: 1439 SIKKISMNI---VLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFINSKIHRLAMSFTVFAFXXXXXXXXXXXXVNKVKSNLVYIFVXXXXXXXXXXXXXXXXYGWFTQVK 2263
             IKK   N+    L +FLP+ ++W  S LLP IVY+S+ +IGHWTKT EH A++ KT+ F++ MVLILPSLG+ S  +   W+     +   T    W CIF PGN +FFVNYIIT+AFIG   EL+R  EL IY    +  RS  E   +RK+V+W+FQ+G+ Y+W+LC+  + V+YS  CPL+ PFGLIY++FK+ VDRYNI+FAY  S IN  IH  A++F ++A +LLQ N++ +  +     + V+IF  ++  ++L +F+    +GWF  ++
Sbjct:  442 DIKKPVENLHSAYLVQFLPTLLLWIFSALLPSIVYWSDQIIGHWTKTAEHHAIMRKTFIFILFMVLILPSLGLTSAKALFEWI-----VMSKTRSLQWQCIFLPGNGSFFVNYIITSAFIGAALELLRFSELFIYGVKLLFARSVAERAAVRKSVLWDFQYGVQYAWMLCMVAIIVSYSIPCPLVTPFGLIYLLFKHVVDRYNIFFAYNSSRINKHIHGSAVTFVLWAVILLQFNVVFFTGLRAEGFDPVFIFSCVALFITLIIFVGRISFGWFKHLR 714          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. TrEMBL
Match: A0A2C9LTR8 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106055488 PE=4 SV=1)

HSP 1 Score: 262.307 bits (669), Expect = 6.681e-128
Identity = 173/473 (36.58%), Postives = 254/473 (53.70%), Query Frame = 3
Query:   90 SKATPVCDRVNIYRITNDTAVIYGFEGIPQNFTINIVTFIILFVLFCFLRKNAWNHGRIALLTKN----------RRKE-----QSSTGY-NIWNTVTLSEKNENEETDSTEFDEKTYLRRASVIDTTSQFDKGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGN--GTKVKYNDFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIRRTMVPKFCGRFHSCCIEEVDVIDYYNDEILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDYHSSCSLLNYPQTSALSNDIKSAYWTISYAPPSNVINWENLCHPYKKWLIKAXXXXXXXXXXXXXXTTPTYALNVL-QLNFQSKK 1451
            S  +P C+ V  Y  +    +   + GIP    IN+V F+ L +LF  LRK AW++GR+AL+ +           RR +     +   G+ N+W ++   +++    T S E  + T          TSQ DKG F W+  F+ + D DI  K G DA QYL FQ+YL+    IITV+S+ VILP+N  G+  GT     DF  TTI NL S   ++WVHAV++ +Y   +I ++ HF   L +    + S TL++  IPK   F S IL HF+EAYP+  + DIQFA+++  L+ L+  R+ A  A+      Y  TG R  M P  CG+   CC  EVD I++Y  E   L+  C++E   AY   +G+AF+T  +   A+++  D+ +SC   + PQ S+L  +++   W + +AP    I+WENL  P  +W   AI IN +L + LF LTTP   L+ L  LN   KK
Sbjct:   12 SNESPNCEEVARYGNSTHVFLYDKYNGIPDTLIINLVVFVCLLLLFTILRKIAWDYGRLALVNRTEENDGVPLVVRRPKVINIWKGCMGWLNLWTSLFFGDRDRRSFTGSQESLDTT---------VTSQ-DKGMFRWIVAFWRLRDVDILNKCGRDAIQYLSFQRYLLVYISIITVLSVGVILPLNFQGSLLGTSA---DFGHTTIGNLESNDPILWVHAVMAVVYLVIVIGVLSHFRLNLDVEEDEQVSRTLMVSNIPKHKCFHSTILQHFEEAYPEANVTDIQFAYDIAGLVLLDKHRKRAAEAKQFCENIYKTTGQRPMMRPVICGQI-CCCCAEVDAINFYQAEEAELKKACEEEKETAYQTPLGIAFITLASESQAQRIRTDFRASCKGTHNPQMSSLYQELQVQNWIMHFAPSPESIHWENLSVPDWRWWTTAICINGVLIVLLFFLTTPIMFLHTLDMLNIDIKK 470          

HSP 2 Score: 227.639 bits (579), Expect = 6.681e-128
Identity = 125/278 (44.96%), Postives = 182/278 (65.47%), Query Frame = 2
Query: 1439 SIKKISMNI---VLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFINSKIHRLAMSFTVFAFXXXXXXXXXXXXVNKVKSNLVYIFVXXXXXXXXXXXXXXXXYGWFTQVK 2263
             IKK   N+    L +FLP+ ++W  S LLP IVY+S+ +IGHWTKT EH A++ KT+ F++ MVLILPSLG+ S  +   W+     +   T    W CIF PGN +FFVNYIIT+AFIG   EL+R  EL IY    +  RS  E   +RK+V+W+FQ+G+ Y+W+LC+  + V+YS  CPL+ PFGLIY++FK+ VDRYNI+FAY  S IN  IH  A++F ++A +LLQ N++ +  +     + V+IF  ++  ++L +F+    +GWF  ++
Sbjct:  467 DIKKPVENLHSAYLVQFLPTLLLWIFSALLPSIVYWSDQIIGHWTKTAEHHAIMRKTFIFILFMVLILPSLGLTSAKALFEWI-----VMSKTRSLQWQCIFLPGNGSFFVNYIITSAFIGAALELLRFSELFIYGVKLLFARSVAERAAVRKSVLWDFQYGVQYAWMLCMVAIIVSYSIPCPLVTPFGLIYLLFKHVVDRYNIFFAYNSSRINKHIHGSAVTFVLWAVILLQFNVVFFTGLRAEGFDPVFIFSCVALFITLIIFVGRISFGWFKHLR 739          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. TrEMBL
Match: A0A162R165 (Calcium permeable stress-gated cation channel 1 OS=Daphnia magna OX=35525 GN=APZ42_013125 PE=4 SV=1)

HSP 1 Score: 275.789 bits (704), Expect = 7.217e-126
Identity = 176/473 (37.21%), Postives = 259/473 (54.76%), Query Frame = 3
Query:   81 NVMSKATPVCDRVNIYRITNDTAVIY--------------GFEGIPQNFTINIVTFIILFVLFCFLRKNAWNHGRIALLTKNRRKEQSS--TGYNIWNTVTLSEKNENEETDSTEFDEKTYLRRASVIDTTSQFDKGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGNGTKVKYNDFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINE-ASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIRRTMVPKFCGRFHSCCI-----EEVDVIDYYNDEILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDYHSSCSLLNYPQTSALSNDIKSAYWTISYAPPSNVINWENLCHPYKKWLIKAXXXXXXXXXXXXXXTTPTYALNVLQL 1433
            N  S+A      V I R  ND+   Y              G+EGIPQN TIN++ +I L +LF  LRKNAWN+GR+ALL +  R+E +   + YNIW  +    + E+ + DS         + A   D  S +D G FSW+   + + D  IR K G+DA QYL FQ+++I    I  V+SL + LP+NM G+  K     F  TT+ NL   S  +W+H  LS L+    I I+ HF+  L I  ++   S TL+I+ IP+ S   + +L HF EAYP+  + DIQFA+++ KLI L+  R+ A+HA+N ++ + A +G R  + P  CG    CC       ++D  +YY  E   L +   +E +KA  + +G+AFVTF +   A KV +D+  +    + P +S+LS   K   W++ +AP  + INW NL  P + W +++ LINS LFI LF LTTP   +N L +
Sbjct:   13 NFYSRAAEFSQSVGIIRADNDSHCNYYRPKNSSHLVIIPGGYEGIPQNLTINVIAWICLIILFSVLRKNAWNYGRMALLQRRERRETAPGYSEYNIWTQIFY--RREDRDGDSEGH------KAAPSFDPGSHYDHGMFSWILAVFRIKDDQIRSKCGDDAVQYLSFQRHIIVMMSITMVVSLAIALPINMQGD-LKGDEKQFGHTTLSNLDPKSWYLWIHVGLSILFVPIAIFIMRHFSKRLDIPEVDSTVSRTLMINHIPRSSCNKADLLKHFNEAYPEYEVIDIQFAYDLSKLIKLDRARQFALHARNYSVSE-AMSGNRMLVRPFLCGNVCVCCDPCCPKSKIDAAEYYTSEERQLASLVDQEKLKAIKRPVGIAFVTFASNLQAAKVRQDHRPNWRCGSNPGSSSLSVMFKPHRWSVDFAPRPDEINWGNLAIPSRFWYLRSFLINSFLFIVLFFLTTPAVVVNTLDI 475          

HSP 2 Score: 207.223 bits (526), Expect = 7.217e-126
Identity = 98/220 (44.55%), Postives = 142/220 (64.55%), Query Frame = 2
Query: 1457 MNIVLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFINSKIHRLAMSFTVFAF 2116
            M+ VL++FLP+ ++W  S L+P +V YS+  + HWTK+  +  ++ KT+ FL+ MV+ILPSLG+ S  +F  W             + W C+F P N AFFVNY+IT++FIGT  EL+R  EL +Y       +S  E+ G+R+N++WEF FG+ Y+W L  F++   YS  CPLI PFG +Y++ K+ VDRYNI+FAY  S IN  IH  A++F + AF
Sbjct:  488 MSPVLSQFLPTLLLWTTSALMPVMVAYSDEWMSHWTKSTANHTIMRKTFIFLMFMVVILPSLGLTSAQAFFEWATRSNGT------YRWECVFLPDNGAFFVNYVITSSFIGTALELMRFSELFMYACKLSCAKSRAEVPGVRRNLLWEFNFGVQYAWTLLNFSLITMYSVSCPLITPFGFVYVLLKHFVDRYNIFFAYAPSRINKNIHTTAINFVMIAF 701          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Cavefish
Match: tmem63ba (transmembrane protein 63B [Source:NCBI gene;Acc:103024235])

HSP 1 Score: 192.971 bits (489), Expect = 1.026e-94
Identity = 102/218 (46.79%), Postives = 147/218 (67.43%), Query Frame = 2
Query: 1460 NIVLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFINSKIHRLAMSFTVFA 2113
            N ++ +F P+ ++W  S LLP IVYYS     HWT++ E+   + K YTFLI MVL+LPSLG++SL  F  WLF      L+     + C+F P N AFFVNY+I +AFIG   +L+RIP L++Y+   ++ RS+ E   ++K+  +EFQFG  Y+W++ VFTV +TYS  CP+IVPFGL+Y++ K+ VDRYN+Y+AY  S ++ KIH  A++  V A
Sbjct:  482 NPIITQFFPTLLLWCFSALLPTIVYYSAFFEAHWTRSGENRTTMHKCYTFLIFMVLLLPSLGLSSLDLFFRWLFD--KTFLDQAKVRFECVFLPDNGAFFVNYVIASAFIGNAMDLLRIPGLLMYMIRLLLARSAAERRNVKKHQAYEFQFGAAYAWLMNVFTVVMTYSITCPIIVPFGLMYMLLKHLVDRYNMYYAYLPSKLDKKIHSGAVNQVVAA 697          

HSP 2 Score: 175.252 bits (443), Expect = 1.026e-94
Identity = 130/432 (30.09%), Postives = 214/432 (49.54%), Query Frame = 3
Query:  162 FEGIPQNFTINIVTFIILFVLFCFLRKNAWNHGRIALLTKNRRKEQSSTGYNIWNTVTLSEKNENEETDSTEFDEKTYLRRASVIDTTS--QFDKGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGNGTKVKYNDFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIRRTMVPKFCGRFHSCCI----EEVDVIDYYNDEILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDYHS----SCSLLNYPQTSALSNDIKSAYWTISYAPPSNVINWENLCHPYKKWLIKAXXXXXXXXXXXXXXTTPTYALNVL 1427
            F G+P    ++ + F+ L  +F  LRK AW++GR+AL++   R++Q            L E+        T  D + Y R  SV  +    Q D GF SWL   + + D +IREK G DA  YL FQ+++I    ++ V+S+ +ILPVN  G+        F  TTI NL + + ++W+H   +FLY    +  +    + +     +    TL I GI K +   S I  HF++AY  C + + +   ++ KL++L  +R     ++       A   +   + PK CG    CCI    E+ D ++YY +    L  + +KE  K   K + +AFVTF+       +L+D+++     C     P++S  S+ +++  WT+SYAP    + WE+L      W ++ ++IN  LFI LF LTTP   ++ +
Sbjct:   48 FGGVPTVLALDFMCFLGLLFVFSILRKVAWDYGRLALVSDADRQDQRYR--------RLDEREYVASAMQTPVDAR-YERLTSVCSSVDFDQRDSGFCSWLTAIFRIKDDEIREKCGEDAVHYLSFQRHIIGLLVVVGVLSVGIILPVNFSGDLLDNNAYSFGRTTIANLKAGTNLLWLHTTFAFLYLLLTVYSMRRHTSKMHYKEDDLVKRTLFIHGINKYAE-ESQIKQHFEQAYENCVVLEARICFDVAKLMYLESERRKTERSKKFYTDLMAKEHVSTMINPKPCGHL-CCCIIKGCEQEDAVNYYTNLEAKLREEYKKEREKVNTKPLDMAFVTFQNEAMTALILKDFNACQCHGCHCRREPKSSPFSSILQTYNWTVSYAPDPQNVYWEHLSVGGLTWWLRCLIINCFLFILLFFLTTPAIIISTM 468          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Cavefish
Match: tmem63ba (transmembrane protein 63B [Source:NCBI gene;Acc:103024235])

HSP 1 Score: 192.971 bits (489), Expect = 2.842e-92
Identity = 102/218 (46.79%), Postives = 146/218 (66.97%), Query Frame = 2
Query: 1460 NIVLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFINSKIHRLAMSFTVFA 2113
            N ++ +F P+ ++W  S LLP IVYYS     HWT++ E+   + K YTFLI MVL+LPSLG++SL  F  WLF    +      F   C+F P N AFFVNY+I +AFIG   +L+RIP L++Y+   ++ RS+ E   ++K+  +EFQFG  Y+W++ VFTV +TYS  CP+IVPFGL+Y++ K+ VDRYN+Y+AY  S ++ KIH  A++  V A
Sbjct:  469 NPIITQFFPTLLLWCFSALLPTIVYYSAFFEAHWTRSGENRTTMHKCYTFLIFMVLLLPSLGLSSLDLFFRWLFDKTFLDQAKVRFE--CVFLPDNGAFFVNYVIASAFIGNAMDLLRIPGLLMYMIRLLLARSAAERRNVKKHQAYEFQFGAAYAWLMNVFTVVMTYSITCPIIVPFGLMYMLLKHLVDRYNMYYAYLPSKLDKKIHSGAVNQVVAA 684          

HSP 2 Score: 167.548 bits (423), Expect = 2.842e-92
Identity = 124/430 (28.84%), Postives = 209/430 (48.60%), Query Frame = 3
Query:  162 FEGIPQNFTINIVTFIILFVLFCFLRKNAWNHGRIALLTKNRRKEQSSTGYNIWNTVTLSEKNENEETDSTEFDEKTYLRRASVIDTTSQFDKGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGNGTKVKYNDFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIRRTMVPKFCGRFHSCCI----EEVDVIDYYNDEILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDYHS----SCSLLNYPQTSALSNDIKSAYWTISYAPPSNVINWENLCHPYKKWLIKAXXXXXXXXXXXXXXTTPTYALNVL 1427
            F G+P    ++ + F+ L  +F  LRK AW++GR+AL++     +  S    +   V    +       S +FD++               D GF SWL   + + D +IREK G DA  YL FQ+++I    ++ V+S+ +ILPVN  G+        F  TTI NL + + ++W+H   +FLY    +  +    + +     +    TL I GI K +   S I  HF++AY  C + + +   ++ KL++L  +R     ++       A   +   + PK CG    CCI    E+ D ++YY +    L  + +KE  K   K + +AFVTF+       +L+D+++     C     P++S  S+ +++  WT+SYAP    + WE+L      W ++ ++IN  LFI LF LTTP   ++ +
Sbjct:   48 FGGVPTVLALDFMCFLGLLFVFSILRKVAWDYGRLALVS-----DADSVASAMQTPVDARYERLTSVCSSVDFDQR---------------DSGFCSWLTAIFRIKDDEIREKCGEDAVHYLSFQRHIIGLLVVVGVLSVGIILPVNFSGDLLDNNAYSFGRTTIANLKAGTNLLWLHTTFAFLYLLLTVYSMRRHTSKMHYKEDDLVKRTLFIHGINKYAE-ESQIKQHFEQAYENCVVLEARICFDVAKLMYLESERRKTERSKKFYTDLMAKEHVSTMINPKPCGHL-CCCIIKGCEQEDAVNYYTNLEAKLREEYKKEREKVNTKPLDMAFVTFQNEAMTALILKDFNACQCHGCHCRREPKSSPFSSILQTYNWTVSYAPDPQNVYWEHLSVGGLTWWLRCLIINCFLFILLFFLTTPAIIISTM 455          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Cavefish
Match: tmem63ba (transmembrane protein 63B [Source:NCBI gene;Acc:103024235])

HSP 1 Score: 192.971 bits (489), Expect = 1.444e-85
Identity = 102/218 (46.79%), Postives = 147/218 (67.43%), Query Frame = 2
Query: 1460 NIVLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFINSKIHRLAMSFTVFA 2113
            N ++ +F P+ ++W  S LLP IVYYS     HWT++ E+   + K YTFLI MVL+LPSLG++SL  F  WLF      L+     + C+F P N AFFVNY+I +AFIG   +L+RIP L++Y+   ++ RS+ E   ++K+  +EFQFG  Y+W++ VFTV +TYS  CP+IVPFGL+Y++ K+ VDRYN+Y+AY  S ++ KIH  A++  V A
Sbjct:  401 NPIITQFFPTLLLWCFSALLPTIVYYSAFFEAHWTRSGENRTTMHKCYTFLIFMVLLLPSLGLSSLDLFFRWLFD--KTFLDQAKVRFECVFLPDNGAFFVNYVIASAFIGNAMDLLRIPGLLMYMIRLLLARSAAERRNVKKHQAYEFQFGAAYAWLMNVFTVVMTYSITCPIIVPFGLMYMLLKHLVDRYNMYYAYLPSKLDKKIHSGAVNQVVAA 616          

HSP 2 Score: 144.821 bits (364), Expect = 1.444e-85
Identity = 109/358 (30.45%), Postives = 179/358 (50.00%), Query Frame = 3
Query:  384 EKTYLRRASVIDTTS--QFDKGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGNGTKVKYNDFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIRRTMVPKFCGRFHSCCI----EEVDVIDYYNDEILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDYHS----SCSLLNYPQTSALSNDIKSAYWTISYAPPSNVINWENLCHPYKKWLIKAXXXXXXXXXXXXXXTTPTYALNVL 1427
            +  Y R  SV  +    Q D GF SWL   + + D +IREK G DA  YL FQ+++I    ++ V+S+ +ILPVN  G+        F  TTI NL + + ++W+H   +FLY    +  +    + +     +    TL I GI K +   S I  HF++AY  C + + +   ++ KL++L  +R     ++       A   +   + PK CG    CCI    E+ D ++YY +    L  + +KE  K   K + +AFVTF+       +L+D+++     C     P++S  S+ +++  WT+SYAP    + WE+L      W ++ ++IN  LFI LF LTTP   ++ +
Sbjct:   32 DARYERLTSVCSSVDFDQRDSGFCSWLTAIFRIKDDEIREKCGEDAVHYLSFQRHIIGLLVVVGVLSVGIILPVNFSGDLLDNNAYSFGRTTIANLKAGTNLLWLHTTFAFLYLLLTVYSMRRHTSKMHYKEDDLVKRTLFIHGINKYAE-ESQIKQHFEQAYENCVVLEARICFDVAKLMYLESERRKTERSKKFYTDLMAKEHVSTMINPKPCGHL-CCCIIKGCEQEDAVNYYTNLEAKLREEYKKEREKVNTKPLDMAFVTFQNEAMTALILKDFNACQCHGCHCRREPKSSPFSSILQTYNWTVSYAPDPQNVYWEHLSVGGLTWWLRCLIINCFLFILLFFLTTPAIIISTM 387          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Cavefish
Match: tmem63ba (transmembrane protein 63B [Source:NCBI gene;Acc:103024235])

HSP 1 Score: 192.586 bits (488), Expect = 6.643e-81
Identity = 102/218 (46.79%), Postives = 146/218 (66.97%), Query Frame = 2
Query: 1460 NIVLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFINSKIHRLAMSFTVFA 2113
            N ++ +F P+ ++W  S LLP IVYYS     HWT++ E+   + K YTFLI MVL+LPSLG++SL  F  WLF    +      F   C+F P N AFFVNY+I +AFIG   +L+RIP L++Y+   ++ RS+ E   ++K+  +EFQFG  Y+W++ VFTV +TYS  CP+IVPFGL+Y++ K+ VDRYN+Y+AY  S ++ KIH  A++  V A
Sbjct:  426 NPIITQFFPTLLLWCFSALLPTIVYYSAFFEAHWTRSGENRTTMHKCYTFLIFMVLLLPSLGLSSLDLFFRWLFDKTFLDQAKVRFE--CVFLPDNGAFFVNYVIASAFIGNAMDLLRIPGLLMYMIRLLLARSAAERRNVKKHQAYEFQFGAAYAWLMNVFTVVMTYSITCPIIVPFGLMYMLLKHLVDRYNMYYAYLPSKLDKKIHSGAVNQVVAA 641          

HSP 2 Score: 129.798 bits (325), Expect = 6.643e-81
Identity = 98/324 (30.25%), Postives = 164/324 (50.62%), Query Frame = 3
Query:  480 DKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGNGTKVKYNDFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIRRTMVPKFCGRFHSCCI----EEVDVIDYYNDEILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDYHS----SCSLLNYPQTSALSNDIKSAYWTISYAPPSNVINWENLCHPYKKWLIKAXXXXXXXXXXXXXXTTPTYALNVL 1427
            D +IREK G DA  YL FQ+++I    ++ V+S+ +ILPVN  G+        F  TTI NL + + ++W+H   +FLY    +  +    + +     +    TL I GI K +   S I  HF++AY  C + + +   ++ KL++L  +R     ++       A   +   + PK CG    CCI    E+ D ++YY +    L  + +KE  K   K + +AFVTF+       +L+D+++     C     P++S  S+ +++  WT+SYAP    + WE+L      W ++ ++IN  LFI LF LTTP   ++ +
Sbjct:   91 DDEIREKCGEDAVHYLSFQRHIIGLLVVVGVLSVGIILPVNFSGDLLDNNAYSFGRTTIANLKAGTNLLWLHTTFAFLYLLLTVYSMRRHTSKMHYKEDDLVKRTLFIHGINKYAE-ESQIKQHFEQAYENCVVLEARICFDVAKLMYLESERRKTERSKKFYTDLMAKEHVSTMINPKPCGHL-CCCIIKGCEQEDAVNYYTNLEAKLREEYKKEREKVNTKPLDMAFVTFQNEAMTALILKDFNACQCHGCHCRREPKSSPFSSILQTYNWTVSYAPDPQNVYWEHLSVGGLTWWLRCLIINCFLFILLFFLTTPAIIISTM 412          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007564.1 (pep scaffold:Pmarinus_7.0:GL487470:69:7815:1 gene:ENSPMAG00000006813.1 transcript:ENSPMAT00000007564.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.109 bits (331), Expect = 1.574e-44
Identity = 68/152 (44.74%), Postives = 96/152 (63.16%), Query Frame = 2
Query: 1439 SIKKISMNIVLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNV 1894
            S+ +   + ++ +FLP+ ++WA S +LPF+VYYS  +  HWT++ E+   + K Y +LI MVLILPSLG+ SL  F  WLF    ++  +  F   C+F P N AFFVNY+IT+AFIGT  EL+R+P L++Y       RS  E    RKNV
Sbjct:  176 SLNRGPQSPIVTQFLPTLLLWAFSAVLPFLVYYSVFLESHWTRSTENRTTMHKCYFYLIFMVLILPSLGLTSLNVFFRWLFDKDFLEQGSVRFE--CVFLPDNGAFFVNYVITSAFIGTAMELLRVPGLLLYALRLCWARSKAE----RKNV 321          

HSP 2 Score: 66.2402 bits (160), Expect = 1.574e-44
Identity = 50/159 (31.45%), Postives = 81/159 (50.94%), Query Frame = 3
Query:  963 EAIRQYANTGIRRTMVPKFCGRFHSCCI----EEVDVIDYYNDEILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDYHSSCSLLNYPQTSALSNDIKSAYWTISYAPPSNVINWENLCHPYKKWLIKAXXXXXXXXXXXXXXTTPTYALNVL 1427
            +A++ Y       T+ P+ CG    C      +EV+ +++Y      L A+C+KE  K   + +G+AFVTF+       +L DY+        P  S LS ++ ++ W + YAP  N I WENL      W  +  ++N++LF+ LF LTTP   +N +
Sbjct:    8 KALKYYDVRPEGETIDPRPCGHLCCCKCCGNHQEVNAVEHYRGLKNSLSAECEKERSKVRSQPLGMAFVTFQDDRMTSDILADYN-LLRCWRRPHVSRLSEELGASSWRVRYAPDPNSIIWENLQVQGLMWWCRVFVLNALLFLLLFFLTTPAIIVNTM 165          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010831.1 (pep scaffold:Pmarinus_7.0:GL479264:5728:18673:-1 gene:ENSPMAG00000009814.1 transcript:ENSPMAT00000010831.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 106.686 bits (265), Expect = 5.831e-31
Identity = 80/239 (33.47%), Postives = 118/239 (49.37%), Query Frame = 3
Query:  777 NEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIRRTMVPKFCGRFHSCCIE-----EVDVIDYYNDEILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDYH----SSCS-------------LLNYPQTSALSNDIKSAYWTISYAPPSNVINWENLCHPYKKWLIKAXXXXXXXXXXXXXXTTPTYALNVL 1427
             + S TL I GIPK      I+  HF EAYP C I D+QF +N+ KLI L+ +R+ A  A     R Y +     TM PK  G    CC +     +V+ +++Y      L  +C++E  K  D  +G+AFVTF   + A + L          C+              L  P+TS+  + ++S +W + YAP  N I WENL      W +K I++N+ LFI LF  +TP+  +N +
Sbjct:    9 GQVSRTLFIIGIPKHLDKEDILKSHFYEAYPSCTITDVQFCYNVEKLIKLDKERKKAAKA-----RAYYDNMTDETMRPKMYGEL--CCCDCYGYRKVNALEFYTALESRLTDECEEEKRKIPDNPLGMAFVTFHDDKSATQNLTTESLAIVVGCAKLPALEVPGIWRGCLGSPKTSSFGDMLRSKHWGVKYAPDPNSIIWENLTVQGFSWWVKVIVLNTFLFILLFFFSTPSIVVNTI 240          

HSP 2 Score: 46.2098 bits (108), Expect = 5.831e-31
Identity = 17/42 (40.48%), Postives = 30/42 (71.43%), Query Frame = 2
Query: 1466 VLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVI 1591
            ++ +FLP+ ++W  S+LLP +VYYS  +  HWT++ E+ A +
Sbjct:  256 IITQFLPTLLLWTFSSLLPLLVYYSVFLEAHWTRSSENRATM 297          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001941.1 (pep scaffold:Pmarinus_7.0:GL486132:403265:408064:1 gene:ENSPMAG00000001762.1 transcript:ENSPMAT00000001941.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.145 bits (261), Expect = 1.416e-25
Identity = 45/102 (44.12%), Postives = 65/102 (63.73%), Query Frame = 2
Query: 1727 CIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDR 2032
            C+F P N AFFVNY++TAA +G+ + L+R+PEL +Y     + RS      +RK   +EF +GL Y+W +C+ TVT++YS  CP+I PF L+Y     S  R
Sbjct:    4 CVFLPDNGAFFVNYVVTAALLGSAARLLRLPELALYGLRLCLARSDAHRHHVRKRCCYEFPYGLEYAWTMCIITVTMSYSVTCPIITPFVLLYSKLTLSARR 105          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Nematostella
Match: EDO49424 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGG4])

HSP 1 Score: 178.718 bits (452), Expect = 1.810e-89
Identity = 91/234 (38.89%), Postives = 136/234 (58.12%), Query Frame = 2
Query: 1415 VKCVAVEFSIK-KISMNIVLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYER---SFINSKIHRLAMSFT 2104
            +K   VE + K +++ N    +FLP+ ++W  S +LP +V YS     HWT++    +V+IKTY FL++MV++LPSL + S     + LF +             C+F P N AFFVNY++T+A IGT  EL R PEL  Y       +   E   +R+  + EF FG  Y+W++ +F+V V YS  CPL+ PFGL+Y+ FK+ VDRYN+YF Y      +++  +H  A+ FT
Sbjct:  386 IKASIVEKNPKLRVAPNPFFTQFLPTIMLWTFSAILPVVVSYSSYFEAHWTRSRLEHSVMIKTYVFLLLMVIVLPSLALTS----ADALFQVTLSGSALLKSRLACVFLPNNGAFFVNYLVTSALIGTALELCRFPELAAYAVRMCFAKDEGEKRLVRRESVREFAFGHQYAWMIVIFSVMVVYSIACPLVTPFGLLYLTFKHVVDRYNLYFNYRSPAYKYVDPSVHSTAVVFT 615          

HSP 2 Score: 170.629 bits (431), Expect = 1.810e-89
Identity = 130/401 (32.42%), Postives = 212/401 (52.87%), Query Frame = 3
Query:  216 FVLFCFLRKNAWNHGRIALLTKNRRKEQSSTGYNIWNTVTLSEKNENEETDSTEFDEKTYLRRASVIDTTSQFDKGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGNGTKVKYNDFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIR-RTMV--PKFCGRFHSCCIEEVDVIDYYNDEILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDYHSSCSLLNYPQTSALSNDIKSAYWTISYAPPSNVINWENLCHPYKKWLIKAXXXXXXXXXXXXXXTTPT 1409
             VLFC +R+  W++GR+A+ T+      +S  Y +   V  + K++ E+  S  F E                DKG  SW+     V+D+ I  K G DA QY+ FQK+LI  + II  +S+ ++LP+N  G   + + N F  TT+ NL + S M W+HAV + LY   I+ I+ HF +   + +++E++ T++I  IPK  +   +I  HF E Y    I+++Q A+N  KL  +  + E A   +          G R +T V   K       C ++ VD I+Y+ +  +  +A+ + E  K   K +GVAFVTF   E ++K L+D++   ++ +    S++S  I S +W ++ AP +  I WE+L    + W  +A++IN ILFIF+  +TTPT
Sbjct:    1 MVLFCVIRRLVWDYGRLAV-TQKEDLGWTSVFYGL--NVNGNGKDKQEDKPSVTFPEVK--------------DKGLLSWVPVLLRVTDEHIHVKCGMDALQYIQFQKHLIVYSVIIFCLSIGIVLPINYSGTN-EYERNSFGATTVSNLEAQSSMFWLHAVFALLYIIIIVVILRHFTSLFNMESLHESATTVMITNIPKNVT-KELIQQHFVEVYDDSMIEEVQLAYNCDKLQSIERKLEAARLGREHCQELLQLNGERPQTTVSTSKVSPCMMCCGVKHVDGIEYFTE--VEGKARVEFEQTKQSLKSLGVAFVTFVNEETSQKCLKDFN---TIKHGSPESSVSRKIFSDHWNVASAPLTGDILWEHLSVDPESWWARALIINIILFIFVLFITTPT 377          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Nematostella
Match: EDO41712 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3E8])

HSP 1 Score: 69.707 bits (169), Expect = 2.960e-12
Identity = 59/269 (21.93%), Postives = 113/269 (42.01%), Query Frame = 3
Query:  420 TTSQFDKGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGNGTKVKYNDFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIW------------HFATTLQ---ITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIRRTMVPKFCGRFHSCCIEEVDVIDYYNDEILILEAQCQKEIVKAYDKKIGVAFVTFETIEDA 1181
            T  +++  FF WL       D  I E+ G DA  Y+ F K  I  + ++    ++V++P+N++G G +   +     T+ NL+  +   W H +  + Y   I  +++            H A  L       + E S  LL             IL  + EA     + +     N++K + L  + + A+ +  +A  Q    G R    PK       CC E+ D I ++ + + +++ + + E+ +     I  AF+ F++++ A
Sbjct:   59 TPQKYNNSFFGWLLLSKAADDDTIFEEAGIDALVYMRFIKLCIKISIVLLPYGIVVLIPLNVYG-GLEKPLSGLDVLTMSNLAEKASKGWAHLIAVWGYTLIICYLLYQEWGVYISYRQKHLAVGLPNQYAVFVRELSPKLLDKS----------ILSKYMEALFPGQVSEAIIVQNLKKWVALIGKHDAAVLSLEKARHQLLTKGDRPQHRPK-------CCGEKTDSITFHENNLKVMQGRLEDEL-RCDHPSIPCAFIVFKSLQSA 308          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Medaka
Match: tmem63c (transmembrane protein 63C [Source:NCBI gene;Acc:101164362])

HSP 1 Score: 214.927 bits (546), Expect = 1.461e-110
Identity = 101/216 (46.76%), Postives = 144/216 (66.67%), Query Frame = 2
Query: 1466 VLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFINSKIHRLAMSFTVFA 2113
            V+ +FLP+ ++WA S LLPFIVYYS     HWT++ ++   + K +  L+ MV+ILPSLG++SL  F  WLF +  ++     F   C+F P N AFFVNY+IT++ IGT  EL+RIP L +Y +     +S  E   ++K+  +EFQFGL Y+W +C+F V++TYS  CP+I PFGL+Y I K+ VDRYNIY+AY  + +N +IHR A S  + A
Sbjct:  472 VITQFLPTLLLWAFSVLLPFIVYYSAFFESHWTRSGQNQVTMHKCFLLLVFMVIILPSLGLSSLDLFFTWLFDVNFLEEKEVKFQ--CVFLPDNGAFFVNYVITSSLIGTSMELLRIPALTVYAFRLCFAKSQAERIHVKKSQAYEFQFGLEYAWTMCIFAVSMTYSITCPIITPFGLLYAILKHMVDRYNIYYAYIPTKLNQRIHRAATSQVIVA 685          

HSP 2 Score: 206.068 bits (523), Expect = 1.461e-110
Identity = 139/436 (31.88%), Postives = 226/436 (51.83%), Query Frame = 3
Query:  138 NDTAVIYG--FEGIPQNFTINIVTFIILFVLFCFLRKNAWNHGRIALLTKNRRKEQSSTGYNIWNTVTLSEKNENEETDSTEFDEKTYLRRASVIDTTSQFDKGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGNGTKVKYNDFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIRRTMVP-KFCGRFHSCCI---EEVDVIDYYNDEILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDYHSSCSLLNYPQTSALSNDIKSAYWTISYAPPSNVINWENLCHPYKKWLIKAXXXXXXXXXXXXXXTTPTYALNVL 1427
            + ++V+ G  F G+P    IN+V ++ L ++F  LRK AW++GR+ALL +N          +   ++   E +E E+T S            S  D+ ++ D GF SWL   Y + D +IR K G DA  YL FQ+++I    +++++SL VILPVN  GN       +F  TT+ N+S+    +W+H++ + +YF   +  + H A  L+     + + TL+I  IP+E     +I  HF EAYP C + D +F  ++ KLI L+L+R  A+  +     +    G  + M+    C     C I   E VD   YY++       +   E  +   K++G+AFVTF        +++DY S       PQ S+++  ++S  W +SYAP  + I WENL     +W ++ +L+N +LF+ LF LTTP   +N +
Sbjct:   45 SRSSVLQGLPFGGVPTVLAINVVLWMFLLLIFSCLRKAAWDYGRLALLMEN----------DSLTSLFYGEPSEKEKTPS----------ETSPSDSDTK-DMGFCSWLLSLYYMKDGEIRSKCGIDAVTYLSFQRHIILLMTVVSLLSLAVILPVNFSGNLLGDSPQNFGRTTLANVSAKDNFLWLHSIFALVYFIITMLCMAHHAIRLEYREDEKVARTLMITSIPREICDPGLITKHFHEAYPSCTVTDNRFCFDVHKLIKLDLERRKAMKGRLYFTTKAQKEG--KIMIKTHLCAHIFGCDICGFERVDAEQYYSELEEKRTDEFNAEKSRISLKRLGIAFVTFRDERMTAVIVKDY-SRVRCRRRPQQSSITTVVQSHKWGVSYAPAPSDIIWENLSVCGSRWWLRCVLLNILLFLLLFFLTTPAIIVNTM 456          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Medaka
Match: tmem63c (transmembrane protein 63C [Source:NCBI gene;Acc:101164362])

HSP 1 Score: 214.927 bits (546), Expect = 1.461e-110
Identity = 101/216 (46.76%), Postives = 144/216 (66.67%), Query Frame = 2
Query: 1466 VLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFINSKIHRLAMSFTVFA 2113
            V+ +FLP+ ++WA S LLPFIVYYS     HWT++ ++   + K +  L+ MV+ILPSLG++SL  F  WLF +  ++     F   C+F P N AFFVNY+IT++ IGT  EL+RIP L +Y +     +S  E   ++K+  +EFQFGL Y+W +C+F V++TYS  CP+I PFGL+Y I K+ VDRYNIY+AY  + +N +IHR A S  + A
Sbjct:  472 VITQFLPTLLLWAFSVLLPFIVYYSAFFESHWTRSGQNQVTMHKCFLLLVFMVIILPSLGLSSLDLFFTWLFDVNFLEEKEVKFQ--CVFLPDNGAFFVNYVITSSLIGTSMELLRIPALTVYAFRLCFAKSQAERIHVKKSQAYEFQFGLEYAWTMCIFAVSMTYSITCPIITPFGLLYAILKHMVDRYNIYYAYIPTKLNQRIHRAATSQVIVA 685          

HSP 2 Score: 206.068 bits (523), Expect = 1.461e-110
Identity = 139/436 (31.88%), Postives = 226/436 (51.83%), Query Frame = 3
Query:  138 NDTAVIYG--FEGIPQNFTINIVTFIILFVLFCFLRKNAWNHGRIALLTKNRRKEQSSTGYNIWNTVTLSEKNENEETDSTEFDEKTYLRRASVIDTTSQFDKGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGNGTKVKYNDFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIRRTMVP-KFCGRFHSCCI---EEVDVIDYYNDEILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDYHSSCSLLNYPQTSALSNDIKSAYWTISYAPPSNVINWENLCHPYKKWLIKAXXXXXXXXXXXXXXTTPTYALNVL 1427
            + ++V+ G  F G+P    IN+V ++ L ++F  LRK AW++GR+ALL +N          +   ++   E +E E+T S            S  D+ ++ D GF SWL   Y + D +IR K G DA  YL FQ+++I    +++++SL VILPVN  GN       +F  TT+ N+S+    +W+H++ + +YF   +  + H A  L+     + + TL+I  IP+E     +I  HF EAYP C + D +F  ++ KLI L+L+R  A+  +     +    G  + M+    C     C I   E VD   YY++       +   E  +   K++G+AFVTF        +++DY S       PQ S+++  ++S  W +SYAP  + I WENL     +W ++ +L+N +LF+ LF LTTP   +N +
Sbjct:   45 SRSSVLQGLPFGGVPTVLAINVVLWMFLLLIFSCLRKAAWDYGRLALLMEN----------DSLTSLFYGEPSEKEKTPS----------ETSPSDSDTK-DMGFCSWLLSLYYMKDGEIRSKCGIDAVTYLSFQRHIILLMTVVSLLSLAVILPVNFSGNLLGDSPQNFGRTTLANVSAKDNFLWLHSIFALVYFIITMLCMAHHAIRLEYREDEKVARTLMITSIPREICDPGLITKHFHEAYPSCTVTDNRFCFDVHKLIKLDLERRKAMKGRLYFTTKAQKEG--KIMIKTHLCAHIFGCDICGFERVDAEQYYSELEEKRTDEFNAEKSRISLKRLGIAFVTFRDERMTAVIVKDY-SRVRCRRRPQQSSITTVVQSHKWGVSYAPAPSDIIWENLSVCGSRWWLRCVLLNILLFLLLFFLTTPAIIVNTM 456          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000014664.2 (CSC1-like protein 2 [Source:NCBI gene;Acc:101164671])

HSP 1 Score: 214.542 bits (545), Expect = 1.136e-101
Identity = 100/218 (45.87%), Postives = 146/218 (66.97%), Query Frame = 2
Query: 1460 NIVLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFINSKIHRLAMSFTVFA 2113
            N ++ +F P+ ++W+ S LLP IVYYS     HWT++ E+   + K YTFLI MVL+LPSLG+ SL  F  WLF  + +      F   C+F P N AFFVNY+I +AFIG   +L+RIP L++Y+    + RS+ +   ++++  +EFQFG  Y+W++CVFTV +TYS  CP+IVPFGL+Y++ K+  DRYN+Y+AY  S ++ KIH  A++  V A
Sbjct:  487 NPIVTQFFPTLLLWSFSALLPTIVYYSAFFEAHWTRSGENRTTMHKCYTFLIFMVLLLPSLGLTSLDVFFRWLFDKKFLADAKVRFE--CVFLPDNGAFFVNYVIASAFIGNAMDLLRIPGLLMYMIRLCLARSAADRRNVKRHQAYEFQFGAAYAWMMCVFTVVMTYSITCPIIVPFGLMYMLLKHLADRYNMYYAYLPSKLDKKIHSGAVNQVVAA 702          

HSP 2 Score: 177.178 bits (448), Expect = 1.136e-101
Identity = 130/431 (30.16%), Postives = 213/431 (49.42%), Query Frame = 3
Query:  162 FEGIPQNFTINIVTFIILFVLFCFLRKNAWNHGRIALLTKNRRKEQSSTGYNIWNTVTLSEKNENEETDSTEFDEKTYLRRASVIDTTS--QFDKGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGNGTKVKYNDFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIRRTMVPKFCGRFHSCCI---EEVDVIDYYNDEILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDYHS----SCSLLNYPQTSALSNDIKSAYWTISYAPPSNVINWENLCHPYKKWLIKAXXXXXXXXXXXXXXTTPTYALNVL 1427
            F G+P    ++ + F+ L  LF  LRK AW++GR+AL+ K+  +      Y   +         +E +D        Y R ASV  +    Q D GF SWL   + + + ++REK G DA  YL FQ+++I    ++ V+S+ +ILPVN  GN  +     F  TTI NL   ++++W+H   +FLY    +  +    + +     +    TL I+GI K+     I   HF+ AY  C + + +  +++ KL+ LN +R+ A  ++   I    N      + PK CG    C I   E+ + + YY +    +  Q + E  K   K +G+AFVTF+       +L+D+++     C     P+ S  S  +++  WT+ YAP    + WE+L     KW ++ +LIN ILF+ LF LTTP   ++ +
Sbjct:   51 FGGVPTVLALDFMCFLGLLFLFSILRKLAWDYGRLALIAKDDSERSMDQRYCRLDGREYMSAVTSETSDR-------YERLASVSSSLDFDQTDHGFCSWLTAVFRIKEDELREKCGEDAIHYLSFQRHIIGLLVVVGVLSVGIILPVNFSGNLLENNAYSFGRTTIANLDVGNKLLWLHTTFAFLYLLLTVFSMRRHTSKMHYKENDLVKRTLFINGISKQGEEREIK-QHFESAYSNCTVLETRICYDVAKLMQLNSERKKAERSKKYFIDLDKNASEPSKVNPKPCGHLCCCAIKGCEQENAVSYYTNLEAEIRQQYRTEREKVNKKPLGMAFVTFQNETITATILKDFNACKCQGCHCRREPRRSNHSKTLQTHNWTVMYAPHPQNVYWEHLSVGGAKWWLRCLLINCILFLLLFFLTTPAIIISTM 473          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000014669.2 (CSC1-like protein 2 [Source:NCBI gene;Acc:101164671])

HSP 1 Score: 214.542 bits (545), Expect = 2.833e-101
Identity = 100/218 (45.87%), Postives = 146/218 (66.97%), Query Frame = 2
Query: 1460 NIVLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFINSKIHRLAMSFTVFA 2113
            N ++ +F P+ ++W+ S LLP IVYYS     HWT++ E+   + K YTFLI MVL+LPSLG+ SL  F  WLF  + +      F   C+F P N AFFVNY+I +AFIG   +L+RIP L++Y+    + RS+ +   ++++  +EFQFG  Y+W++CVFTV +TYS  CP+IVPFGL+Y++ K+  DRYN+Y+AY  S ++ KIH  A++  V A
Sbjct:  473 NPIVTQFFPTLLLWSFSALLPTIVYYSAFFEAHWTRSGENRTTMHKCYTFLIFMVLLLPSLGLTSLDVFFRWLFDKKFLADAKVRFE--CVFLPDNGAFFVNYVIASAFIGNAMDLLRIPGLLMYMIRLCLARSAADRRNVKRHQAYEFQFGAAYAWMMCVFTVVMTYSITCPIIVPFGLMYMLLKHLADRYNMYYAYLPSKLDKKIHSGAVNQVVAA 688          

HSP 2 Score: 175.637 bits (444), Expect = 2.833e-101
Identity = 128/429 (29.84%), Postives = 212/429 (49.42%), Query Frame = 3
Query:  162 FEGIPQNFTINIVTFIILFVLFCFLRKNAWNHGRIALLTKNRRKEQSSTGYNIWNTVTLSEKNENEETDSTEFDEKTYLRRASVIDTTSQFDKGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGNGTKVKYNDFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIRRTMVPKFCGRFHSCCI---EEVDVIDYYNDEILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDYHS----SCSLLNYPQTSALSNDIKSAYWTISYAPPSNVINWENLCHPYKKWLIKAXXXXXXXXXXXXXXTTPTYALNVL 1427
            F G+P    ++ + F+ L  LF  LRK AW++GR+AL+ K+  +  S+       T   S++ E   + S+  D               Q D GF SWL   + + + ++REK G DA  YL FQ+++I    ++ V+S+ +ILPVN  GN  +     F  TTI NL   ++++W+H   +FLY    +  +    + +     +    TL I+GI K+     I   HF+ AY  C + + +  +++ KL+ LN +R+ A  ++   I    N      + PK CG    C I   E+ + + YY +    +  Q + E  K   K +G+AFVTF+       +L+D+++     C     P+ S  S  +++  WT+ YAP    + WE+L     KW ++ +LIN ILF+ LF LTTP   ++ +
Sbjct:   51 FGGVPTVLALDFMCFLGLLFLFSILRKLAWDYGRLALIAKDDSESMSAV------TSETSDRYERLASVSSSLD-------------FDQTDHGFCSWLTAVFRIKEDELREKCGEDAIHYLSFQRHIIGLLVVVGVLSVGIILPVNFSGNLLENNAYSFGRTTIANLDVGNKLLWLHTTFAFLYLLLTVFSMRRHTSKMHYKENDLVKRTLFINGISKQGEEREIK-QHFESAYSNCTVLETRICYDVAKLMQLNSERKKAERSKKYFIDLDKNASEPSKVNPKPCGHLCCCAIKGCEQENAVSYYTNLEAEIRQQYRTEREKVNKKPLGMAFVTFQNETITATILKDFNACKCQGCHCRREPRRSNHSKTLQTHNWTVMYAPHPQNVYWEHLSVGGAKWWLRCLLINCILFLLLFFLTTPAIIISTM 459          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Medaka
Match: tmem63a (transmembrane protein 63B [Source:NCBI gene;Acc:101167416])

HSP 1 Score: 198.364 bits (503), Expect = 3.205e-99
Identity = 129/420 (30.71%), Postives = 210/420 (50.00%), Query Frame = 3
Query:  135 TNDTAVIYG--FEGIPQNFTINIVTFIILFVLFCFLRKNAWNHGRIALLTKNRRKEQSSTGYNIWNTVTLSEKNENEETDSTEFDEKTYLRRASVIDTTSQF--DKGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGNGTKVKYNDFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIRRTMVPKFCGRFHSCCIE---EVDVIDYY--NDEILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDYHS-----SCSLLNYPQTSALSNDIKSAYWTISYAPPSNVINWENLCHPYKKWLIK 1352
            TN + V+ G  F GIP    ++   FI+L VLF  +R+  W++GR+AL++        S G+N                   E   + Y R +S    T  F  + GF SWL +   + ++ I+EK G DA  YL FQ++LI    +ITV SL +I+PVNM G+  K    +F  TTI NL + + ++W+H V + +Y    + ++    + ++      A NTL +  +PK ++    +  HF EAYP C +  +   +++ +L+HL+ +R  A        R    TG R  + P+ CG  H CC     +VD I+YY   ++ L+ E + + EIV  +   +G+AFVT +    A+ +L+D+++     S      PQ S+ S  +K   W +S+AP    + WENL      W ++
Sbjct:   29 TNQSTVLSGLNFGGIPLVLLLDFCVFIVLLVLFSIIREKFWDYGRLALVS-------DSDGFN-------------------ESTHRRYGRMSSAASNTEDFGYESGFCSWLPYIVRMDEEKIKEKCGIDAVHYLSFQRHLIILLVVITVTSLAIIMPVNMSGDLLKNDPQNFGRTTIGNLKTGNNLLWLHTVFAVIYLALTVVMLRVHTSQMKGLRKETARNTLFVSPVPKTAT-EEDVKAHFVEAYPTCEVCAVTLGYDVARLMHLDKERLRAGKNLRYYERVLDKTGQRELINPRLCG--HICCCSGCVKVDAIEYYCGKEKFLLEEVRQEAEIVPQH--TLGIAFVTLKNEAMAKYILKDFNAIECRGSTCCGREPQPSSQSRALKVNKWRVSFAPHPKSVYWENLSVRGFTWAVR 417          

HSP 2 Score: 185.267 bits (469), Expect = 3.205e-99
Identity = 93/216 (43.06%), Postives = 144/216 (66.67%), Query Frame = 2
Query: 1466 VLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFINSKIHRLAMSFTVFA 2113
            ++ +F P+ ++W+ S LLP IVYYS +   HW+++ E  +++ K Y FL+ MVLILPSLG+ SL  F  WLF  + + L    F   C+F P   AFFVNY+I A  +G+  +L+R+P L++YL   ++ RS+ E   +++N  +EF++G  Y W LCVFTV + YS ICP+IVPFGL+Y++ K+ VDR+N+YFAY  + ++ ++H  A+   + A
Sbjct:  458 IITQFFPTLLLWSFSALLPTIVYYSTLGEAHWSRSSEQLSMMRKLYFFLLFMVLILPSLGLTSLAVFFRWLFDKEFLNLGKLRFE--CVFLPDQGAFFVNYVIAAGLVGSGMDLLRLPGLLLYLIRMMLARSAAERKYVKQNQAYEFEYGAMYGWTLCVFTVIMAYSIICPIIVPFGLLYMLLKHLVDRHNLYFAYLPTRLDHQVHMGAVDQALAA 671          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Planmine SMEST
Match: SMESG000061308.1 (SMESG000061308.1)

HSP 1 Score: 909.827 bits (2350), Expect = 0.000e+0
Identity = 454/455 (99.78%), Postives = 454/455 (99.78%), Query Frame = 3
Query:   87 MSKATPVCDRVNIYRITNDTAVIYGFEGIPQNFTINIVTFIILFVLFCFLRKNAWNHGRIALLTKNRRKEQSSTGYNIWNTVTLSEKNENEETDSTEFDEKTYLRRASVIDTTSQFDKGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGNGTKVKYNDFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIRRTMVPKFCGRFHSCCIEEVDVIDYYNDEILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDYHSSCSLLNYPQTSALSNDIKSAYWTISYAPPSNVINWENLCHPYKKWLIKAXXXXXXXXXXXXXXTTPTYALNVLQLNFQSKK 1451
            MSKATPVCDRVNIYRITNDTAVIYGFEGIPQNFTINIVT IILFVLFCFLRKNAWNHGRIALLTKNRRKEQSSTGYNIWNTVTLSEKNENEETDSTEFDEKTYLRRASVIDTTSQFDKGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGNGTKVKYNDFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIRRTMVPKFCGRFHSCCIEEVDVIDYYNDEILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDYHSSCSLLNYPQTSALSNDIKSAYWTISYAPPSNVINWENLCHPYKKWLIKAILINSILFIFLFMLTTPTYALNVLQLNFQSKK
Sbjct:    1 MSKATPVCDRVNIYRITNDTAVIYGFEGIPQNFTINIVTSIILFVLFCFLRKNAWNHGRIALLTKNRRKEQSSTGYNIWNTVTLSEKNENEETDSTEFDEKTYLRRASVIDTTSQFDKGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGNGTKVKYNDFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIRRTMVPKFCGRFHSCCIEEVDVIDYYNDEILILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLEDYHSSCSLLNYPQTSALSNDIKSAYWTISYAPPSNVINWENLCHPYKKWLIKAILINSILFIFLFMLTTPTYALNVLQLNFQSKK 455          

HSP 2 Score: 562.762 bits (1449), Expect = 0.000e+0
Identity = 310/317 (97.79%), Postives = 313/317 (98.74%), Query Frame = 2
Query: 1424 VAVEFSIKKISMNIVLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFINSKIHRLAMSFTVFAFXXXXXXXXXXXXVNKVKSNLVYIFVXXXXXXXXXXXXXXXXYGWFTQVKTKVTNEENFGQIVLPTTPLMPSLMATLNLIPSAKNRP 2374
            + + F  KKISMNIVLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFINSKIHRLAMSFTVFAFLLLQINLLIYLNVNKVKSNLVYIFVFISCILSLTLF+FFTFYGWFTQVKTKVTNEENFGQIVLPTTPLMPSLMATLNLIPSAKNRP
Sbjct:  447 LQLNFQSKKISMNIVLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFINSKIHRLAMSFTVFAFLLLQINLLIYLNVNKVKSNLVYIFVFISCILSLTLFMFFTFYGWFTQVKTKVTNEENFGQIVLPTTPLMPSLMATLNLIPSAKNRP 763          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Planmine SMEST
Match: SMESG000061529.1 (SMESG000061529.1)

HSP 1 Score: 187.963 bits (476), Expect = 6.205e-95
Identity = 96/214 (44.86%), Postives = 134/214 (62.62%), Query Frame = 2
Query: 1460 NIVLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFINSKIHRLAMSF 2101
            N ++ +F PS +M  VS ++P IVY+S+ +  HWTKT ++ AV+ K +T L+I VLILPSLG+ S+P  I WLF   +   NT    W CIF     A F NYIITA+FIGT  EL+R+ EL +Y   +   RS  E   I K+V+W+FQFG+ Y+W L +F+V   YS I P+I PFGL Y++ K+ VDRYN+      S +++ +H  A   
Sbjct:  460 NPLVAQFAPSLVMVLVSAVMPLIVYWSDQLSAHWTKTTQNIAVMNKLFTVLVITVLILPSLGLNSVPELIKWLFITNSTAPNTI--KWECIFMADGGALFCNYIITASFIGTALELLRLGELFMYTVKRSCSRSRAEDNAIIKSVLWDFQFGVGYAWTLALFSVVSAYSVIVPIITPFGLTYLLLKHLVDRYNLIHVNVPSIVHNSVHTNAAQL 671          

HSP 2 Score: 180.644 bits (457), Expect = 6.205e-95
Identity = 135/455 (29.67%), Postives = 215/455 (47.25%), Query Frame = 3
Query:   99 TPVCDRVNIY--RITNDTAVIYGFEGIPQNFTINIVTFIILFVLFCFLRKNAWNHGRIALLTKNRRKEQSSTGYNIWNTVTLSEKNENEETDSTEFDEKTYLRRASVIDTTSQFDKGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGNGTKVKYNDFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIRRTMVPKFCGRF---HSCC----IEEVDVIDYYNDEILILEAQCQKEIVKAYD-KKIGVAFVTFETIEDARKVLEDYHSS---CSLLNYPQTSALSNDIKSAYWTISYAPPSNVINWENLCHPYKKWLIKAXXXXXXXXXXXXXXTTPTYALNV 1424
            TP CDR N Y  R  N   +   +EGIPQN  IN+V + I+  LF FLRK AWN+G +A L K    E  +             K    E     F +   +     I+ T  F +   + L  F  ++D+ ++++ G+DA  Y  FQ+ LI    ++ V+SL +I+P+N+ G+      + F++ TI N+   S  +W+H  +S  +   +  I       +      E S T++I+ +P E     II  HF+EAYP      +Q  + +  LI L  Q+  A  A      +  +   R  ++P  CGR      CC       +D I++Y  E++ L      E   A + KK+ + FVTFE ++ A +V  DY      C   +    S+ S+ + S  WT+++AP    I W+NL     +W +  I+IN  + I + +L+TP  ALN+
Sbjct:    4 TPQCDRYNSYIPRKNNTFTISTAYEGIPQNVFINVVAYTIIISLFLFLRKKAWNYGNLAWLGKPLNIEHVA-----------PRKESRSEHSEAIFSDTDPIASKENINLT--FKEKLLNILPLFVKMNDEALKQRCGSDAVIYCRFQRNLIAIVSVMMVLSLTIIVPLNLRGSFLSSNSSMFSSLTIANVPKESPFLWIHFTVSLGFMLFVFFISSQHLNNIDFKAKEEPSFTVMINNVPTEFCDEMIIAQHFREAYPSINPIKVQVTYEVSTLISLYTQKVAAEEALQFCYEELEHDNHRVKVIPNLCGRVCLTCKCCQGKKCTPIDGIEFYTHEVMRLTNLFTTEKSNAINYKKLPIFFVTFENLDQALRVRRDYMYQNYLCFNKSMKGRSSYSHQLNSDDWTVTFAPMPKDILWQNLHKHGWRWWLPIIVINMFVGIVIIILSTPAVALNI 445          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Planmine SMEST
Match: SMESG000061535.1 (SMESG000061535.1)

HSP 1 Score: 184.882 bits (468), Expect = 8.359e-85
Identity = 140/459 (30.50%), Postives = 239/459 (52.07%), Query Frame = 3
Query:  108 CDRVNIYRITNDTAVIYGFEGIPQNFTINIVTFIILFVLFCFLRKNAWNHGRIALLTKNRRKEQSSTGYNIWNTVTLSEKNENEETDSTEFDEKTYLRRASVIDTTSQFDKGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGNGTKVKYNDFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIRRTMVPKFCGRF---HSCC---IEEVDVIDYYNDEI---LILEAQCQKEIVKAYDKKIGVAFVTFETIEDARKVLED--YHSSCSLLNYPQT-SALSNDIKSAYWTISYAPPSNVINWENLCHPYKKWLIKAXXXXXXXXXXXXXXTTPTYALNVLQLNFQSK 1448
            CDR N Y+ TN + +   +EGIP N  IN++ ++IL  +F  LRK AWN+G IA  TK              N ++L+ KN    T S + +E    R   + ++ ++F   F+  L  F  +SD+D+ ++ G DA  Y  FQ+ L+  + ++ V  L++I+P+N+ G+      + F T TI N+ + S+++ VH +++FL    +  I   F   +      + S +L+I  +P E+   S+I  HF+E YP+     +Q A+ +  +I+L + + +A  A    + +  +   R  + P   GR      CC    + +D I+YY  E+     L  + QK+ +K  +KK+ + FV+F++IE A  +  +  Y + C +  YP++ S+LS  + S  W + +AP S  I WENL     K  +K ILINS + + +  L+TP+  +     NFQS+
Sbjct:    3 CDRYNSYK-TNVSFIPNSYEGIPLNLLINVIVYLILIGVFLILRKRAWNYGDIAWFTKP------------INIMSLALKNRLSVTSSDKTEEHEE-REKLMENSKNRFIDRFWKALPLFIKISDQDLEKRCGCDAVIYCKFQRMLLLISTVMVVAGLIIIVPLNLSGHSLSKDTSSFKTLTIANIGTGSKVLSVHLIVAFLLMIFVFFISNKFLKYVDDHGKEKVSYSLMITRVPLEACDESLIEQHFREIYPEISNMKVQRAYEIECMINLYISKVLAEEALEYCVDELEHFNRRVKVAPNVFGRMCIACKCCEAICKPIDGIEYYMKEVKRTTELFNEEQKKTLK--EKKLPIFFVSFDSIEHALLIRREYIYQNYCCIKPYPKSQSSLSKILNSDNWKVIFAPISKDILWENLHKKGWKLWVKIILINSFVALLVITLSTPSMIIKFWNDNFQSQ 445          

HSP 2 Score: 149.828 bits (377), Expect = 8.359e-85
Identity = 76/204 (37.25%), Postives = 121/204 (59.31%), Query Frame = 2
Query: 1472 NRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFINSKIH 2083
            ++F PS +M  V+  +P ++  S  +  H T+T +  A++ K +T L + VLILPSLG+ S    +  +F+  N  + T  F W CIF     A F NY+I+A FIG   E++RI  L +++      +S  E  GI ++++WEF +G+ Y+W L +F++   YS I PLI PFGL+Y++ K+ VDRYN+   +  + I S +H
Sbjct:  455 SQFFPSIVMVLVTATMPLLICLSNEISAHQTRTKQSIAIMNKLFTVLTVTVLILPSLGLNSAQELMLQIFNRTNASIFTI-FKWDCIFLYDGGALFCNYLISAGFIGMGLEILRIGPLFLFMIKMSTAKSEAENNGIAQSLLWEFPYGINYAWTLALFSIISAYSVIVPLITPFGLVYLVSKHMVDRYNMVHVFIPAVIESSVH 657          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Planmine SMEST
Match: SMESG000061530.1 (SMESG000061530.1)

HSP 1 Score: 149.443 bits (376), Expect = 5.589e-73
Identity = 75/205 (36.59%), Postives = 127/205 (61.95%), Query Frame = 2
Query: 1469 LNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYTFLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAFFVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEFQFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYERSFINSKIH 2083
            +++F PS IM  V++++P +V ++  M  HWT+T ++ A++ K +  L++ VL LPSLG++S    + W F  +N   N   F W C+F     + F NY+I+A FIG   E++R+ +L++ ++     RS  E  GI +++ WEF +G+ Y+W L +F++  TY+ I PLI PFGL Y+I KY VDRY++      + +++ +H
Sbjct:  447 ISQFFPSLIMVIVTSIMPVLVCWANDMSAHWTRTKQNIAIMNKLFAVLVLTVLFLPSLGLSSAHELL-WSFFNKNETFNKI-FKWECLFLADGGSIFCNYLISAGFIGMGLEILRLGQLLLIIFKLSWSRSKAEERGIVQSLSWEFPYGINYAWTLALFSIISTYAVIVPLITPFGLFYLISKYLVDRYSMIHVNIPALVDNDVH 649          

HSP 2 Score: 145.976 bits (367), Expect = 5.589e-73
Identity = 134/441 (30.39%), Postives = 204/441 (46.26%), Query Frame = 3
Query:  162 FEGIPQNFTINIVTFIILFVLFCFLRKNAWNHGRIALLTK--NRRKEQSSTGYNIWNTVTLSEKNENEETDSTEFDEKTYLRRASVIDTTSQFDKGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGNGTKVKYNDFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIRRTMVPKFCGRF---HSCCI---EEVDVIDYYNDEILILEAQCQKEIVKAYDK-KIGVAFVTFETIEDARKVLED--YHSSCSLLNYPQT-SALSNDIKSAYWTISYAPPSNVINWENLCHPYKKWLIKAXXXXXXXXXXXXXXTTPTYALNVLQLNFQSK 1448
            +EGIP N  IN+V +I+L ++F  LRKNAWN+G I  LTK  N  +E +            S     E+   +  D    L+              F  W+  F  +SDK +R++ G DA  Y MFQ+ LI  + ++TV+ L +ILP+N  G+      + F T TI N+   S  +  H  +SF+    +  I   F   +      +   TL+I  IP E     +I  HFKEAYP      +Q  + + KL  L   + +A  A    + QY     R  +     GR     +CC+   + +D I YY +E+        KE    +D  K+ + FV+F++IE A  +  +  Y + C +  YP++ S+LS  +KS  W + +AP    I WENL      + +K I IN  +   +  L+TP   L +    FQ K
Sbjct:   20 YEGIPFNILINVVVYILLILIFLMLRKNAWNYGVIEWLTKPVNVMEEAADQ----------SGLTSPEDCVESNGDNNRALQ-----------SNIFCRWIPLFIRMSDKCLRKRCGFDAVIYCMFQRMLILISSVMTVLCLTIILPLNFSGSLLSDDSSSFKTLTIANIEVGSTKLAFHLSISFILMIFVFFISNWFLKFVDTKIHKKTGVTLMITNIPIEVYDEQLIEQHFKEAYPTISNMKVQKTYAIGKLFDLYTNKVLAEEALEYCVTQYERFDRRVKVASNAFGRMCVSCNCCVAKCQPIDGIGYYTEEVKRCTELFYKEQKLTFDSGKLPIVFVSFDSIEHAVVIRREYIYQNYCCIKQYPKSQSSLSMRLKSDNWKVIFAPIPKDILWENLHKQGLVFWLKIIFINLFVAFIVITLSTPPIILQIWNKFFQDK 439          
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Planmine SMEST
Match: SMESG000061530.1 (SMESG000061530.1)

HSP 1 Score: 140.584 bits (353), Expect = 9.862e-36
Identity = 118/394 (29.95%), Postives = 183/394 (46.45%), Query Frame = 3
Query:  162 FEGIPQNFTINIVTFIILFVLFCFLRKNAWNHGRIALLTKNRRKEQSSTGYNIWNTVTLSEKNENEETDSTEFDEKTYLRRASVIDTTSQFDKGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQKYLIFTTFIITVISLMVILPVNMHGNGTKVKYNDFATTTILNLSSYSQMIWVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLSIILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYANTGIRRTMVPKFCGRF---HSCCI---EEVDVIDYYNDEILILEAQCQKEIVKAYDK-KIGVAFVTFETIEDARKVLED--YHSSCSLLNYPQT-SALSNDIKSAYWTISYAPPSNVINW 1313
            +EGIP N  IN+V +I+L ++F  LRKNAWN+G I  LTK                V + E    E  D +          ++  +  +     F  W+  F  +SDK +R++ G DA  Y MFQ+ LI  + ++TV+ L +ILP+N  G+      + F T TI N+   S  +  H  +SF+    +  I   F   +      +   TL+I  IP E     +I  HFKEAYP      +Q  + + KL  L   + +A  A    + QY     R  +     GR     +CC+   + +D I YY +E+        KE    +D  K+ + FV+F++IE A  +  +  Y + C +  YP++ S+LS  +KS  W + +AP    I W
Sbjct:   20 YEGIPFNILINVVVYILLILIFLMLRKNAWNYGVIEWLTK---------------PVNVME----EAADQSGLTSPEDCVESNGDNNRALQSNIFCRWIPLFIRMSDKCLRKRCGFDAVIYCMFQRMLILISSVMTVLCLTIILPLNFSGSLLSDDSSSFKTLTIANIEVGSTKLAFHLSISFILMIFVFFISNWFLKFVDTKIHKKTGVTLMITNIPIEVYDEQLIEQHFKEAYPTISNMKVQKTYAIGKLFDLYTNKVLAEEALEYCVTQYERFDRRVKVASNAFGRMCVSCNCCVAKCQPIDGIGYYTEEVKRCTELFYKEQKLTFDSGKLPIVFVSFDSIEHAVVIRREYIYQNYCCIKQYPKSQSSLSMRLKSDNWKVIFAPIPKDILW 394          
The following BLAST results are available for this feature:
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TMEM63A7.255e-10044.04transmembrane protein 63A [Source:HGNC Symbol;Acc:... [more]
TMEM63B7.587e-5346.33transmembrane protein 63B [Source:HGNC Symbol;Acc:... [more]
TMEM63C5.874e-5242.86transmembrane protein 63C [Source:HGNC Symbol;Acc:... [more]
TMEM63B1.217e-5146.33transmembrane protein 63B [Source:HGNC Symbol;Acc:... [more]
TMEM63B2.280e-5146.33transmembrane protein 63B [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Tmem636.548e-4942.59gene:FBgn0033259 transcript:FBtr0088781[more]
back to top
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmem63c3.657e-10946.33transmembrane protein 63C [Source:ZFIN;Acc:ZDB-GEN... [more]
tmem63c4.007e-10946.33transmembrane protein 63C [Source:ZFIN;Acc:ZDB-GEN... [more]
tmem63c3.749e-10846.33transmembrane protein 63C [Source:ZFIN;Acc:ZDB-GEN... [more]
tmem63ba1.161e-9446.79transmembrane protein 63Ba [Source:ZFIN;Acc:ZDB-GE... [more]
tmem63ba1.415e-9346.79transmembrane protein 63Ba [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmem63c1.041e-10444.80transmembrane protein 63C [Source:NCBI gene;Acc:10... [more]
tmem63c1.015e-10344.80transmembrane protein 63C [Source:NCBI gene;Acc:10... [more]
tmem63c1.148e-10044.80transmembrane protein 63C [Source:NCBI gene;Acc:10... [more]
tmem63a1.134e-9547.60transmembrane protein 63A [Source:NCBI gene;Acc:77... [more]
tmem63a4.921e-9347.60transmembrane protein 63A [Source:NCBI gene;Acc:77... [more]
back to top
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tmem63a8.641e-10344.95transmembrane protein 63a [Source:MGI Symbol;Acc:M... [more]
Tmem63a8.641e-10344.95transmembrane protein 63a [Source:MGI Symbol;Acc:M... [more]
Tmem63b1.536e-5146.33transmembrane protein 63b [Source:MGI Symbol;Acc:M... [more]
Tmem63c9.716e-5142.86transmembrane protein 63c [Source:MGI Symbol;Acc:M... [more]
Tmem63c9.716e-5142.86transmembrane protein 63c [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|X1WEM4|CSC1_DANRE2.471e-10846.33Calcium permeable stress-gated cation channel 1 OS... [more]
sp|Q91YT8|CSCL1_MOUSE5.258e-10244.95CSC1-like protein 1 OS=Mus musculus OX=10090 GN=Tm... [more]
sp|O94886|CSCL1_HUMAN3.214e-9944.04CSC1-like protein 1 OS=Homo sapiens OX=9606 GN=TME... [more]
sp|Q5R826|CSCL1_PONAB7.951e-9943.58CSC1-like protein 1 OS=Pongo abelii OX=9601 GN=TME... [more]
sp|A0A452G813|CSCL1_CAPHI9.841e-9643.12CSC1-like protein 1 OS=Capra hircus OX=9925 GN=TME... [more]
back to top
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9LU671.698e-13237.83Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2C9LTU64.216e-13036.86Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2C9LTZ11.967e-12837.64Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2C9LTR86.681e-12836.58Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A162R1657.217e-12637.21Calcium permeable stress-gated cation channel 1 OS... [more]
back to top
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tmem63ba1.026e-9446.79transmembrane protein 63B [Source:NCBI gene;Acc:10... [more]
tmem63ba2.842e-9246.79transmembrane protein 63B [Source:NCBI gene;Acc:10... [more]
tmem63ba1.444e-8546.79transmembrane protein 63B [Source:NCBI gene;Acc:10... [more]
tmem63ba6.643e-8146.79transmembrane protein 63B [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000007564.11.574e-4444.74pep scaffold:Pmarinus_7.0:GL487470:69:7815:1 gene:... [more]
ENSPMAT00000010831.15.831e-3133.47pep scaffold:Pmarinus_7.0:GL479264:5728:18673:-1 g... [more]
ENSPMAT00000001941.11.416e-2544.12pep scaffold:Pmarinus_7.0:GL486132:403265:408064:1... [more]
back to top
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO494241.810e-8938.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO417122.960e-1221.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmem63c1.461e-11046.76transmembrane protein 63C [Source:NCBI gene;Acc:10... [more]
tmem63c1.461e-11046.76transmembrane protein 63C [Source:NCBI gene;Acc:10... [more]
ENSORLT00000014664.21.136e-10145.87CSC1-like protein 2 [Source:NCBI gene;Acc:10116467... [more]
ENSORLT00000014669.22.833e-10145.87CSC1-like protein 2 [Source:NCBI gene;Acc:10116467... [more]
tmem63a3.205e-9930.71transmembrane protein 63B [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of 4Fe-4S ferredoxin-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000061308.10.000e+099.78SMESG000061308.1[more]
SMESG000061529.16.205e-9544.86SMESG000061529.1[more]
SMESG000061535.18.359e-8530.50SMESG000061535.1[more]
SMESG000061530.15.589e-7336.59SMESG000061530.1[more]
SMESG000061530.19.862e-3629.95SMESG000061530.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029064 ID=SMED30029064|Name=4Fe-4S ferredoxin-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2397bp
CTTAATCAAATTATAAATTATATTCTGGTATAATTAATCAAAAACCTATT
GTCAATTATAGGTTATTAGATAATGAAATAAACGTAATGAGCAAAGCCAC
CCCAGTGTGTGACAGAGTAAACATCTATAGAATAACAAACGACACTGCAG
TTATTTACGGATTTGAAGGAATTCCTCAAAATTTCACAATTAATATTGTC
ACATTTATTATTCTTTTTGTTTTGTTTTGTTTTCTTCGGAAAAACGCTTG
GAATCATGGCAGAATAGCTTTGTTAACTAAAAATCGTCGTAAAGAACAGA
GCAGTACTGGCTACAATATATGGAATACCGTCACGCTTTCAGAGAAGAAT
GAAAATGAGGAGACTGATTCTACAGAGTTCGACGAAAAGACATACTTAAG
AAGAGCTTCAGTGATAGACACGACATCTCAATTTGACAAAGGATTTTTCA
GTTGGTTGAAATTCTTCTATGTTGTAAGTGACAAAGATATTAGAGAGAAA
AAAGGTAACGACGCTTATCAGTACCTAATGTTCCAAAAATATCTCATTTT
TACCACCTTTATCATTACTGTCATTTCATTAATGGTCATCTTGCCTGTAA
ATATGCATGGAAATGGAACTAAAGTTAAGTATAATGATTTTGCTACGACT
ACTATTTTGAATTTATCCTCTTACTCACAAATGATATGGGTCCATGCAGT
TCTTTCATTTCTTTATTTTTTTGGAATTATTGCCATTATTTGGCATTTTG
CTACAACTCTTCAAATTACAACTATTAATGAAGCGTCCAATACTCTGTTA
ATAGACGGAATACCAAAGGAGTCCAGTTTCCTAAGTATTATATTAGATCA
TTTCAAAGAGGCGTATCCAAAGTGTGGAATTAAAGACATTCAGTTTGCCC
ATAACATGAGAAAATTGATTCATTTAAATTTACAAAGAGAAATAGCAATC
CATGCGCAAAATGAGGCCATTCGACAATATGCAAATACCGGAATCCGCCG
TACGATGGTTCCAAAATTTTGCGGCCGATTTCATTCATGTTGTATTGAAG
AAGTCGATGTTATAGACTATTATAACGATGAGATTTTGATTCTAGAAGCT
CAATGTCAAAAAGAAATTGTAAAAGCCTATGACAAAAAAATCGGTGTAGC
TTTCGTCACGTTTGAAACCATTGAAGACGCTCGCAAAGTTTTGGAGGATT
ATCACTCATCTTGCTCCCTTCTCAATTATCCTCAAACATCTGCATTGTCA
AATGACATTAAAAGTGCTTATTGGACCATTTCATATGCTCCTCCTTCAAA
TGTCATTAATTGGGAAAATCTTTGTCACCCATACAAAAAATGGCTAATAA
AAGCTATTCTTATTAATTCGATTCTTTTTATATTTTTATTCATGTTAACA
ACTCCAACATATGCGTTAAATGTGTTGCAGTTGAATTTTCAATCAAAAAA
ATTTCAATGAATATTGTTCTCAATCGCTTTTTACCATCATTTATAATGTG
GGCTGTGTCAACGCTTTTGCCGTTTATTGTATATTATTCGGAAGTCATGA
TAGGCCATTGGACGAAAACGGATGAGCATACAGCTGTGATTATTAAGACA
TATACATTTTTAATAATTATGGTTTTAATCTTACCATCATTAGGTATCGC
AAGTTTACCTTCATTTATCAATTGGCTCTTTTCAATTCAAAATATTCAAT
TAAACACATTCTATTTTCACTGGCTCTGTATATTTGCTCCTGGAAATTGT
GCCTTTTTTGTTAATTATATTATAACTGCGGCCTTCATTGGAACAATTTC
AGAGCTCATCAGAATTCCTGAATTGATCATTTATTTATATTACCAAATTG
TTGTACGATCTAGTGTAGAAATGTGGGGAATTAGAAAGAATGTTATTTGG
GAATTTCAATTTGGATTGTGCTATTCATGGATTTTATGTGTTTTCACAGT
GACAGTAACGTACAGTTTTATTTGCCCTTTGATTGTTCCATTTGGCTTGA
TTTACATAATTTTCAAGTACTCCGTCGACAGATACAATATTTATTTTGCC
TATGAGCGCAGTTTTATCAATTCCAAAATTCACAGATTGGCAATGTCCTT
TACAGTTTTCGCCTTCCTTTTGTTGCAAATAAATTTGCTCATTTATTTGA
ATGTTAACAAAGTCAAGAGCAATTTGGTTTATATTTTTGTTTTCATCAGC
TGCATTCTCAGCTTAACGTTGTTTTTGTTCTTTACGTTTTACGGATGGTT
TACGCAAGTCAAAACAAAAGTCACGAACGAAGAAAACTTTGGCCAAATAG
TGCTACCGACTACACCTTTGATGCCATCACTGATGGCCACATTAAATTTG
ATTCCTAGTGCTAAAAATAGACCTTAATAACATTTTGTCAATCCTAG
back to top

protein sequence of SMED30029064-orf-1

>SMED30029064-orf-1 ID=SMED30029064-orf-1|Name=SMED30029064-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=458bp
MSKATPVCDRVNIYRITNDTAVIYGFEGIPQNFTINIVTFIILFVLFCFL
RKNAWNHGRIALLTKNRRKEQSSTGYNIWNTVTLSEKNENEETDSTEFDE
KTYLRRASVIDTTSQFDKGFFSWLKFFYVVSDKDIREKKGNDAYQYLMFQ
KYLIFTTFIITVISLMVILPVNMHGNGTKVKYNDFATTTILNLSSYSQMI
WVHAVLSFLYFFGIIAIIWHFATTLQITTINEASNTLLIDGIPKESSFLS
IILDHFKEAYPKCGIKDIQFAHNMRKLIHLNLQREIAIHAQNEAIRQYAN
TGIRRTMVPKFCGRFHSCCIEEVDVIDYYNDEILILEAQCQKEIVKAYDK
KIGVAFVTFETIEDARKVLEDYHSSCSLLNYPQTSALSNDIKSAYWTISY
APPSNVINWENLCHPYKKWLIKAILINSILFIFLFMLTTPTYALNVLQLN
FQSKKFQ*
back to top

protein sequence of SMED30029064-orf-2

>SMED30029064-orf-2 ID=SMED30029064-orf-2|Name=SMED30029064-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=307bp
MNIVLNRFLPSFIMWAVSTLLPFIVYYSEVMIGHWTKTDEHTAVIIKTYT
FLIIMVLILPSLGIASLPSFINWLFSIQNIQLNTFYFHWLCIFAPGNCAF
FVNYIITAAFIGTISELIRIPELIIYLYYQIVVRSSVEMWGIRKNVIWEF
QFGLCYSWILCVFTVTVTYSFICPLIVPFGLIYIIFKYSVDRYNIYFAYE
RSFINSKIHRLAMSFTVFAFLLLQINLLIYLNVNKVKSNLVYIFVFISCI
LSLTLFLFFTFYGWFTQVKTKVTNEENFGQIVLPTTPLMPSLMATLNLIP
SAKNRP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR003864RSN1_7TM
IPR027815PHM7_cyt
IPR032880Csc1_N
IPR012677Nucleotide-bd_a/b_plait_sf
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR02781510TM putative phosphate transporter, cytosolic domainPFAMPF14703PHM7_cytcoord: 235..411
e-value: 2.2E-29
score: 102.9
IPR032880Calcium permeable stress-gated cation channel 1, N-terminal transmembrane domainPFAMPF13967RSN1_TMcoord: 32..220
e-value: 3.3E-19
score: 69.2
NoneNo IPR availablePANTHERPTHR13018PROBABLE MEMBRANE PROTEIN DUF221-RELATEDcoord: 23..448
NoneNo IPR availablePANTHERPTHR13018:SF21CALCIUM PERMEABLE STRESS-GATED CATION CHANNEL 1coord: 23..448
NoneNo IPR availableTMHMMTMhelixcoord: 152..174
NoneNo IPR availableTMHMMTMhelixcoord: 424..446
NoneNo IPR availableTMHMMTMhelixcoord: 28..50
NoneNo IPR availableTMHMMTMhelixcoord: 199..221