GTP cyclohydrolase 1

Overview
NameGTP cyclohydrolase 1
Smed IDSMED30029047
Length (bp)838
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GTP cyclohydrolase 1 (SMED30029047) t-SNE clustered cells

Violin plots show distribution of expression levels for GTP cyclohydrolase 1 (SMED30029047) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GTP cyclohydrolase 1 (SMED30029047) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GTP cyclohydrolase 1 (SMED30029047) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029047

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30029047SMESG000064560.1 dd_Smed_v4_11172_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30029047SMESG000064560.1 dd_Smed_v4_11172_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30029047SMESG000064560.1 dd_Smed_v4_11172_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30029047SMESG000064560.1 dd_Smed_v4_11172_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30029047SMESG000064560.1 dd_Smed_v4_11172_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029047SMESG000064560.1 Contig42591newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029047SMESG000064560.1 Contig42591uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30029047SMESG000064560.1 dd_Smed_v6_11172_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GTP cyclohydrolase 1 vs. Ensembl Human
Match: GCH1 (GTP cyclohydrolase 1 [Source:HGNC Symbol;Acc:HGNC:4193])

HSP 1 Score: 296.975 bits (759), Expect = 4.936e-101
Identity = 132/178 (74.16%), Postives = 161/178 (90.45%), Query Frame = 1
Query:  247 IADYYKDILMAVGEDVTRQGLLKTPDRAAKAMLYFTKGYENNIDEILNNAIFTEDHDEMVVVKDIEMFSLCEHHLVPFIGKVSIGYLPNKRIIGLSKIARIVEVYSRRLQVQERLTKEIAVALTKAIDPSGVGVIIEATHMCMVMRGVQKINAKTITSTMLGTFREDPKTREEFLTLV 780
            +A  Y  IL ++GE+  RQGLLKTP RAA AM +FTKGY+  I ++LN+AIF EDHDEMV+VKDI+MFS+CEHHLVPF+GKV IGYLPNK+++GLSK+ARIVE+YSRRLQVQERLTK+IAVA+T+A+ P+GVGV++EATHMCMVMRGVQK+N+KT+TSTMLG FREDPKTREEFLTL+
Sbjct:   71 LAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLI 248          
BLAST of GTP cyclohydrolase 1 vs. Ensembl Human
Match: GCH1 (GTP cyclohydrolase 1 [Source:HGNC Symbol;Acc:HGNC:4193])

HSP 1 Score: 296.975 bits (759), Expect = 4.936e-101
Identity = 132/178 (74.16%), Postives = 161/178 (90.45%), Query Frame = 1
Query:  247 IADYYKDILMAVGEDVTRQGLLKTPDRAAKAMLYFTKGYENNIDEILNNAIFTEDHDEMVVVKDIEMFSLCEHHLVPFIGKVSIGYLPNKRIIGLSKIARIVEVYSRRLQVQERLTKEIAVALTKAIDPSGVGVIIEATHMCMVMRGVQKINAKTITSTMLGTFREDPKTREEFLTLV 780
            +A  Y  IL ++GE+  RQGLLKTP RAA AM +FTKGY+  I ++LN+AIF EDHDEMV+VKDI+MFS+CEHHLVPF+GKV IGYLPNK+++GLSK+ARIVE+YSRRLQVQERLTK+IAVA+T+A+ P+GVGV++EATHMCMVMRGVQK+N+KT+TSTMLG FREDPKTREEFLTL+
Sbjct:   71 LAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLI 248          
BLAST of GTP cyclohydrolase 1 vs. Ensembl Human
Match: GCH1 (GTP cyclohydrolase 1 [Source:HGNC Symbol;Acc:HGNC:4193])

HSP 1 Score: 296.975 bits (759), Expect = 4.936e-101
Identity = 132/178 (74.16%), Postives = 161/178 (90.45%), Query Frame = 1
Query:  247 IADYYKDILMAVGEDVTRQGLLKTPDRAAKAMLYFTKGYENNIDEILNNAIFTEDHDEMVVVKDIEMFSLCEHHLVPFIGKVSIGYLPNKRIIGLSKIARIVEVYSRRLQVQERLTKEIAVALTKAIDPSGVGVIIEATHMCMVMRGVQKINAKTITSTMLGTFREDPKTREEFLTLV 780
            +A  Y  IL ++GE+  RQGLLKTP RAA AM +FTKGY+  I ++LN+AIF EDHDEMV+VKDI+MFS+CEHHLVPF+GKV IGYLPNK+++GLSK+ARIVE+YSRRLQVQERLTK+IAVA+T+A+ P+GVGV++EATHMCMVMRGVQK+N+KT+TSTMLG FREDPKTREEFLTL+
Sbjct:   71 LAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLI 248          
BLAST of GTP cyclohydrolase 1 vs. Ensembl Human
Match: GCH1 (GTP cyclohydrolase 1 [Source:HGNC Symbol;Acc:HGNC:4193])

HSP 1 Score: 221.09 bits (562), Expect = 8.064e-72
Identity = 98/139 (70.50%), Postives = 123/139 (88.49%), Query Frame = 1
Query:  247 IADYYKDILMAVGEDVTRQGLLKTPDRAAKAMLYFTKGYENNIDEILNNAIFTEDHDEMVVVKDIEMFSLCEHHLVPFIGKVSIGYLPNKRIIGLSKIARIVEVYSRRLQVQERLTKEIAVALTKAIDPSGVGVIIEAT 663
            +A  Y  IL ++GE+  RQGLLKTP RAA AM +FTKGY+  I ++LN+AIF EDHDEMV+VKDI+MFS+CEHHLVPF+GKV IGYLPNK+++GLSK+ARIVE+YSRRLQVQERLTK+IAVA+T+A+ P+GVGV++EAT
Sbjct:   71 LAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPAGVGVVVEAT 209          
BLAST of GTP cyclohydrolase 1 vs. Ensembl Human
Match: GCH1 (GTP cyclohydrolase 1 [Source:HGNC Symbol;Acc:HGNC:4193])

HSP 1 Score: 221.476 bits (563), Expect = 1.408e-71
Identity = 99/151 (65.56%), Postives = 127/151 (84.11%), Query Frame = 1
Query:  247 IADYYKDILMAVGEDVTRQGLLKTPDRAAKAMLYFTKGYENNIDEILNNAIFTEDHDEMVVVKDIEMFSLCEHHLVPFIGKVSIGYLPNKRIIGLSKIARIVEVYSRRLQVQERLTKEIAVALTKAIDPSGVGVIIEATHMCMVMRGVQKI 699
            +A  Y  IL ++GE+  RQGLLKTP RAA AM +FTKGY+  I ++LN+AIF EDHDEMV+VKDI+MFS+CEHHLVPF+GKV IGYLPNK+++GLSK+ARIVE+YSRRLQVQERLTK+IAVA+T+A+ P+GVGV++EAT      +G+  +
Sbjct:   71 LAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPAGVGVVVEATKSNKYNKGLSPL 221          
BLAST of GTP cyclohydrolase 1 vs. Ensembl Celegans
Match: cat-4 (GTP cyclohydrolase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q19980])

HSP 1 Score: 295.434 bits (755), Expect = 2.974e-101
Identity = 130/187 (69.52%), Postives = 163/187 (87.17%), Query Frame = 1
Query:  226 RQDTVDLIADYYKDILMAVGEDVTRQGLLKTPDRAAKAMLYFTKGYENNIDEILNNAIFTEDHDEMVVVKDIEMFSLCEHHLVPFIGKVSIGYLPNKRIIGLSKIARIVEVYSRRLQVQERLTKEIAVALTKAIDPSGVGVIIEATHMCMVMRGVQKINAKTITSTMLGTFREDPKTREEFLTLVGR 786
            ++D +  + + Y+ I+  VGED+ RQGLLKTP+RAAKAM+ FTKGY++ +DE+LN A+F EDHDEMV+VKDIEMFSLCEHHLVPF+GKV IGY+PNK+++GLSK+ARIVE++SRRLQVQERLTK+IA A+ +A+ PSGV V+IEA+HMCMVMRGVQKINA T TS MLG FR+DPKTREEFL L+ +
Sbjct:   36 KEDHLKSMCNAYQSIIQHVGEDINRQGLLKTPERAAKAMMAFTKGYDDQLDELLNEAVFDEDHDEMVIVKDIEMFSLCEHHLVPFMGKVHIGYIPNKKVLGLSKLARIVEMFSRRLQVQERLTKQIATAMVQAVQPSGVAVVIEASHMCMVMRGVQKINASTTTSCMLGVFRDDPKTREEFLNLINK 222          
BLAST of GTP cyclohydrolase 1 vs. Ensembl Fly
Match: Pu (gene:FBgn0003162 transcript:FBtr0071578)

HSP 1 Score: 277.33 bits (708), Expect = 2.939e-93
Identity = 133/198 (67.17%), Postives = 167/198 (84.34%), Query Frame = 1
Query:  193 FQRDFQ--EKDDSRQDTVDLIADYYKDILMAVGEDVTRQGLLKTPDRAAKAMLYFTKGYENNIDEILNNAIFTEDHDEMVVVKDIEMFSLCEHHLVPFIGKVSIGYLPNKRIIGLSKIARIVEVYSRRLQVQERLTKEIAVALTKAIDPSGVGVIIEATHMCMVMRGVQKINAKTITSTMLGTFREDPKTREEFLTLV 780
            F  D +   K  +R+  +  +A  Y+ +L  +GE+  RQGL+KTP+RAAKAMLYFTKGY+ +++++LN A+F EDHDEMVVVKDIEMFS+CEHHLVPF GKVSIGYLP  +I+GLSK+ARIVE++SRRLQVQERLTK+IAVA+T+A+ P+GV V++E  HMCMVMRGVQKIN+KT+TSTMLG FR+DPKTREEFL LV
Sbjct:   73 FHHDLELDHKPPTREALLPDMARSYRLLLGGLGENPDRQGLIKTPERAAKAMLYFTKGYDQSLEDVLNGAVFDEDHDEMVVVKDIEMFSMCEHHLVPFYGKVSIGYLPCNKILGLSKLARIVEIFSRRLQVQERLTKQIAVAVTQAVQPAGVAVVVEGVHMCMVMRGVQKINSKTVTSTMLGVFRDDPKTREEFLNLV 270          
BLAST of GTP cyclohydrolase 1 vs. Ensembl Fly
Match: Pu (gene:FBgn0003162 transcript:FBtr0071580)

HSP 1 Score: 276.559 bits (706), Expect = 2.565e-92
Identity = 133/198 (67.17%), Postives = 167/198 (84.34%), Query Frame = 1
Query:  193 FQRDFQ--EKDDSRQDTVDLIADYYKDILMAVGEDVTRQGLLKTPDRAAKAMLYFTKGYENNIDEILNNAIFTEDHDEMVVVKDIEMFSLCEHHLVPFIGKVSIGYLPNKRIIGLSKIARIVEVYSRRLQVQERLTKEIAVALTKAIDPSGVGVIIEATHMCMVMRGVQKINAKTITSTMLGTFREDPKTREEFLTLV 780
            F  D +   K  +R+  +  +A  Y+ +L  +GE+  RQGL+KTP+RAAKAMLYFTKGY+ +++++LN A+F EDHDEMVVVKDIEMFS+CEHHLVPF GKVSIGYLP  +I+GLSK+ARIVE++SRRLQVQERLTK+IAVA+T+A+ P+GV V++E  HMCMVMRGVQKIN+KT+TSTMLG FR+DPKTREEFL LV
Sbjct:  124 FHHDLELDHKPPTREALLPDMARSYRLLLGGLGENPDRQGLIKTPERAAKAMLYFTKGYDQSLEDVLNGAVFDEDHDEMVVVKDIEMFSMCEHHLVPFYGKVSIGYLPCNKILGLSKLARIVEIFSRRLQVQERLTKQIAVAVTQAVQPAGVAVVVEGVHMCMVMRGVQKINSKTVTSTMLGVFRDDPKTREEFLNLV 321          
BLAST of GTP cyclohydrolase 1 vs. Ensembl Fly
Match: Pu (gene:FBgn0003162 transcript:FBtr0071579)

HSP 1 Score: 275.789 bits (704), Expect = 3.018e-92
Identity = 133/198 (67.17%), Postives = 167/198 (84.34%), Query Frame = 1
Query:  193 FQRDFQ--EKDDSRQDTVDLIADYYKDILMAVGEDVTRQGLLKTPDRAAKAMLYFTKGYENNIDEILNNAIFTEDHDEMVVVKDIEMFSLCEHHLVPFIGKVSIGYLPNKRIIGLSKIARIVEVYSRRLQVQERLTKEIAVALTKAIDPSGVGVIIEATHMCMVMRGVQKINAKTITSTMLGTFREDPKTREEFLTLV 780
            F  D +   K  +R+  +  +A  Y+ +L  +GE+  RQGL+KTP+RAAKAMLYFTKGY+ +++++LN A+F EDHDEMVVVKDIEMFS+CEHHLVPF GKVSIGYLP  +I+GLSK+ARIVE++SRRLQVQERLTK+IAVA+T+A+ P+GV V++E  HMCMVMRGVQKIN+KT+TSTMLG FR+DPKTREEFL LV
Sbjct:  108 FHHDLELDHKPPTREALLPDMARSYRLLLGGLGENPDRQGLIKTPERAAKAMLYFTKGYDQSLEDVLNGAVFDEDHDEMVVVKDIEMFSMCEHHLVPFYGKVSIGYLPCNKILGLSKLARIVEIFSRRLQVQERLTKQIAVAVTQAVQPAGVAVVVEGVHMCMVMRGVQKINSKTVTSTMLGVFRDDPKTREEFLNLV 305          
BLAST of GTP cyclohydrolase 1 vs. Ensembl Zebrafish
Match: gch1 (GTP cyclohydrolase 1 [Source:ZFIN;Acc:ZDB-GENE-070720-5])

HSP 1 Score: 291.197 bits (744), Expect = 4.728e-99
Identity = 132/178 (74.16%), Postives = 158/178 (88.76%), Query Frame = 1
Query:  247 IADYYKDILMAVGEDVTRQGLLKTPDRAAKAMLYFTKGYENNIDEILNNAIFTEDHDEMVVVKDIEMFSLCEHHLVPFIGKVSIGYLPNKRIIGLSKIARIVEVYSRRLQVQERLTKEIAVALTKAIDPSGVGVIIEATHMCMVMRGVQKINAKTITSTMLGTFREDPKTREEFLTLV 780
            IA  Y  IL  +GED  RQGLLKTP RAA AM +FTKGY+  I ++LN+AIF EDHDEMV+VKDI+MFS+CEHHLVP  G+V IGYLPNKR++GLSK+ARIVE+YSRRLQVQERLTK+IAVA+T+A+ P+GVGV++EATHMCMVMRGVQK+N+KT+TSTMLG FREDPKTR+EFLTL+
Sbjct:   72 IAAAYTTILRGLGEDPQRQGLLKTPWRAATAMQFFTKGYQEKIIDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPIFGRVHIGYLPNKRVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALQPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTRDEFLTLI 249          
BLAST of GTP cyclohydrolase 1 vs. Ensembl Zebrafish
Match: gch2 (GTP cyclohydrolase 2 [Source:ZFIN;Acc:ZDB-GENE-001205-3])

HSP 1 Score: 275.404 bits (703), Expect = 7.455e-93
Identity = 127/190 (66.84%), Postives = 158/190 (83.16%), Query Frame = 1
Query:  208 QEKDDSRQDTVDLIADYYKDILMAVGEDVTRQGLLKTPDRAAKAMLYFTKGYENNIDEILNNAIFTEDHDEMVVVKDIEMFSLCEHHLVPFIGKVSIGYLPNKRIIGLSKIARIVEVYSRRLQVQERLTKEIAVALTKAIDPSGVGVIIEATHMCMVMRGVQKINAKTITSTMLGTFREDPKTREEFLTL 777
            +E+D+SR   ++     Y  IL  +GE+  RQGLLKTP RAAKAM + TKGY   I +ILN+AIF EDH+E+V+VKDI+MFSLCEHHLVPF GKV IGYLP+K+++GLSK+ARIVE+YSRRLQVQERLTK+IA+A+++A+ P GV V+IEA HMCMVMRGVQK+N++T+TS MLG FREDPK REEFL L
Sbjct:   49 EEEDESRLPALEAA---YTTILRGLGENTDRQGLLKTPLRAAKAMQFLTKGYHETIYDILNDAIFDEDHEELVIVKDIDMFSLCEHHLVPFFGKVHIGYLPSKKVVGLSKLARIVEIYSRRLQVQERLTKQIAMAISEALQPVGVAVVIEAAHMCMVMRGVQKMNSRTVTSAMLGVFREDPKAREEFLAL 235          
BLAST of GTP cyclohydrolase 1 vs. Ensembl Zebrafish
Match: gch1 (GTP cyclohydrolase 1 [Source:ZFIN;Acc:ZDB-GENE-070720-5])

HSP 1 Score: 174.096 bits (440), Expect = 3.632e-55
Identity = 77/95 (81.05%), Postives = 93/95 (97.89%), Query Frame = 1
Query:  496 IGYLPNKRIIGLSKIARIVEVYSRRLQVQERLTKEIAVALTKAIDPSGVGVIIEATHMCMVMRGVQKINAKTITSTMLGTFREDPKTREEFLTLV 780
            IGYLPNKR++GLSK+ARIVE+YSRRLQVQERLTK+IAVA+T+A+ P+GVGV++EATHMCMVMRGVQK+N+KT+TSTMLG FREDPKTR+EFLTL+
Sbjct:    3 IGYLPNKRVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALQPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTRDEFLTLI 97          
BLAST of GTP cyclohydrolase 1 vs. Ensembl Zebrafish
Match: CU464134.2 (pep chromosome:GRCz11:17:15111319:15165592:1 gene:ENSDARG00000113158.1 transcript:ENSDART00000185099.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CU464134.2)

HSP 1 Score: 58.151 bits (139), Expect = 6.096e-11
Identity = 29/70 (41.43%), Postives = 40/70 (57.14%), Query Frame = 1
Query:  571 LQVQERLTKEIAVALTKAIDPSGVGVIIEATHMCMVMRGVQKINAKTITSTMLGTFREDPKTREEFLTLV 780
            LQVQ+RLTK++ V    +  P G G      H+C+V++ V K N +++T   L  F  DPKTR  F  LV
Sbjct:    1 LQVQKRLTKQVRVIRQASFQPVGAGDNTTQCHLCLVLKAVNKQNLESVTLLKLNYFLNDPKTRRSFQKLV 70          
BLAST of GTP cyclohydrolase 1 vs. Ensembl Zebrafish
Match: gch1 (GTP cyclohydrolase 1 [Source:ZFIN;Acc:ZDB-GENE-070720-5])

HSP 1 Score: 57.7658 bits (138), Expect = 1.824e-10
Identity = 30/59 (50.85%), Postives = 38/59 (64.41%), Query Frame = 1
Query:  208 QEKDDSRQD---TVDLIADYYKDILMAVGEDVTRQGLLKTPDRAAKAMLYFTKGYENNI 375
            +E+  S +D   ++  IA  Y  IL  +GED  RQGLLKTP RAA AM +FTKGY+  I
Sbjct:   27 EERTRSLEDNEMSLPSIAAAYTTILRGLGEDPQRQGLLKTPWRAATAMQFFTKGYQEKI 85          
BLAST of GTP cyclohydrolase 1 vs. Ensembl Xenopus
Match: gch1 (GTP cyclohydrolase 1 [Source:NCBI gene;Acc:448485])

HSP 1 Score: 299.671 bits (766), Expect = 3.574e-102
Identity = 136/178 (76.40%), Postives = 161/178 (90.45%), Query Frame = 1
Query:  247 IADYYKDILMAVGEDVTRQGLLKTPDRAAKAMLYFTKGYENNIDEILNNAIFTEDHDEMVVVKDIEMFSLCEHHLVPFIGKVSIGYLPNKRIIGLSKIARIVEVYSRRLQVQERLTKEIAVALTKAIDPSGVGVIIEATHMCMVMRGVQKINAKTITSTMLGTFREDPKTREEFLTLV 780
            +A  Y  IL A+GED  RQGLLKTP RAA AM YFTKGY+  I ++LN+AIF EDHDEMV+VKDI+MFS+CEHHLVPFIGKV IGYLPNK+++GLSK+ARIVE+YSRRLQVQERLTK+IA+A+T+A+ PSGVGV++EATHMCMVMRGVQK+N+KT+TSTMLG FREDPKTREEFLTL+
Sbjct:   68 LATAYGTILRALGEDPGRQGLLKTPWRAATAMQYFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFIGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAIAITEALHPSGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLI 245          
BLAST of GTP cyclohydrolase 1 vs. Ensembl Xenopus
Match: tekt3 (tektin 3 [Source:Xenbase;Acc:XB-GENE-989321])

HSP 1 Score: 267.314 bits (682), Expect = 8.198e-90
Identity = 120/189 (63.49%), Postives = 154/189 (81.48%), Query Frame = 1
Query:  214 KDDSRQDTVDLIADYYKDILMAVGEDVTRQGLLKTPDRAAKAMLYFTKGYENNIDEILNNAIFTEDHDEMVVVKDIEMFSLCEHHLVPFIGKVSIGYLPNKRIIGLSKIARIVEVYSRRLQVQERLTKEIAVALTKAIDPSGVGVIIEATHMCMVMRGVQKINAKTITSTMLGTFREDPKTREEFLTLV 780
            ++   Q+    I   Y  IL  +GE+  R+GLL TP RAAKAM + TKGY+  + +++NNA+F EDHDE+V+VKDI++FSLCEHHLVPF GKV IGY+PNK+++GLSK+ARI E+YSRRLQVQERLTK+IA A+ +A+ P GV V++EA+HMCMVMRGVQKIN++TITSTM G F EDPKTREEFL+L+
Sbjct:   38 REGHEQEKAGAIERAYSTILRELGENPEREGLLLTPSRAAKAMQFLTKGYKETVYDVMNNAVFDEDHDEIVIVKDIDIFSLCEHHLVPFFGKVHIGYIPNKKVVGLSKLARIAEIYSRRLQVQERLTKQIAFAILEALQPIGVAVVMEASHMCMVMRGVQKINSRTITSTMHGVFLEDPKTREEFLSLI 226          
BLAST of GTP cyclohydrolase 1 vs. Ensembl Xenopus
Match: gch1 (GTP cyclohydrolase 1 [Source:NCBI gene;Acc:448485])

HSP 1 Score: 263.462 bits (672), Expect = 2.202e-88
Identity = 123/178 (69.10%), Postives = 150/178 (84.27%), Query Frame = 1
Query:  247 IADYYKDILMAVGEDVTRQGLLKTPDRAAKAMLYFTKGYENNIDEILNNAIFTEDHDEMVVVKDIEMFSLCEHHLVPFIGKVSIGYLPNKRIIGLSKIARIVEVYSRRLQVQERLTKEIAVALTKAIDPSGVGVIIEATHMCMVMRGVQKINAKTITSTMLGTFREDPKTREEFLTLV 780
            +A  Y  IL A+GED  RQGLLKTP RAA AM YFTKGY+  I ++LN+AIF EDHDEMV+VKDI+MFS+CEHHLVPFIGKV IGYLPNK+++G  K    + +++    VQERLTK+IA+A+T+A+ PSGVGV++EATHMCMVMRGVQK+N+KT+TSTMLG FREDPKTREEFLTL+
Sbjct:   46 LATAYGTILRALGEDPGRQGLLKTPWRAATAMQYFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFIGKVHIGYLPNKQVLGYCKNYLYLFIFA----VQERLTKQIAIAITEALHPSGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLI 219          
BLAST of GTP cyclohydrolase 1 vs. Ensembl Xenopus
Match: gch1 (GTP cyclohydrolase 1 [Source:NCBI gene;Acc:448485])

HSP 1 Score: 263.848 bits (673), Expect = 3.853e-88
Identity = 126/194 (64.95%), Postives = 157/194 (80.93%), Query Frame = 1
Query:  208 QEKDDSRQDT---VDLIADYYKDILMAVGEDVTRQGLLKTPDRAAKAMLYFTKGYENNIDEILNNAIFTEDHDEMVVVKDIEMFSLCEHHLVPFIGKVSIGYLPNKRIIGLSKIARIVEVYSRRLQVQERLTKEIAVALTKAIDPSGVGVIIEATHMCMVMRGVQKINAKTITSTMLGTFREDPKTREEFLTLV 780
            +E+  S +D    +  +A  Y  IL A+GED  RQGLLKTP RAA AM YFTKGY+  I ++LN+AIF EDHDEMV+VKDI+MFS+CEHHLVPFIGKV IGYLPNK+++G  K    + +++    VQERLTK+IA+A+T+A+ PSGVGV++EATHMCMVMRGVQK+N+KT+TSTMLG FREDPKTREEFLTL+
Sbjct:   52 EERARSEEDNELNLPSLATAYGTILRALGEDPGRQGLLKTPWRAATAMQYFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFIGKVHIGYLPNKQVLGYCKNYLYLFIFA----VQERLTKQIAIAITEALHPSGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLI 241          
BLAST of GTP cyclohydrolase 1 vs. Ensembl Mouse
Match: Gch1 (GTP cyclohydrolase 1 [Source:MGI Symbol;Acc:MGI:95675])

HSP 1 Score: 300.827 bits (769), Expect = 5.882e-103
Identity = 135/188 (71.81%), Postives = 166/188 (88.30%), Query Frame = 1
Query:  217 DDSRQDTVDLIADYYKDILMAVGEDVTRQGLLKTPDRAAKAMLYFTKGYENNIDEILNNAIFTEDHDEMVVVKDIEMFSLCEHHLVPFIGKVSIGYLPNKRIIGLSKIARIVEVYSRRLQVQERLTKEIAVALTKAIDPSGVGVIIEATHMCMVMRGVQKINAKTITSTMLGTFREDPKTREEFLTLV 780
            ++  Q  +  +A  Y  IL+++GED  RQGLLKTP RAA AM YFTKGY+  I ++LN+AIF EDHDEMV+VKDI+MFS+CEHHLVPF+G+V IGYLPNK+++GLSK+ARIVE+YSRRLQVQERLTK+IAVA+T+A+ P+GVGV+IEATHMCMVMRGVQK+N+KT+TSTMLG FREDPKTREEFLTL+
Sbjct:   52 EEENQVNLPKLAAAYSSILLSLGEDPQRQGLLKTPWRAATAMQYFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGRVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALQPAGVGVVIEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLI 239          
BLAST of GTP cyclohydrolase 1 vs. UniProt/SwissProt
Match: sp|Q05915|GCH1_MOUSE (GTP cyclohydrolase 1 OS=Mus musculus OX=10090 GN=Gch1 PE=1 SV=1)

HSP 1 Score: 300.827 bits (769), Expect = 4.114e-102
Identity = 135/188 (71.81%), Postives = 166/188 (88.30%), Query Frame = 1
Query:  217 DDSRQDTVDLIADYYKDILMAVGEDVTRQGLLKTPDRAAKAMLYFTKGYENNIDEILNNAIFTEDHDEMVVVKDIEMFSLCEHHLVPFIGKVSIGYLPNKRIIGLSKIARIVEVYSRRLQVQERLTKEIAVALTKAIDPSGVGVIIEATHMCMVMRGVQKINAKTITSTMLGTFREDPKTREEFLTLV 780
            ++  Q  +  +A  Y  IL+++GED  RQGLLKTP RAA AM YFTKGY+  I ++LN+AIF EDHDEMV+VKDI+MFS+CEHHLVPF+G+V IGYLPNK+++GLSK+ARIVE+YSRRLQVQERLTK+IAVA+T+A+ P+GVGV+IEATHMCMVMRGVQK+N+KT+TSTMLG FREDPKTREEFLTL+
Sbjct:   52 EEENQVNLPKLAAAYSSILLSLGEDPQRQGLLKTPWRAATAMQYFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGRVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALQPAGVGVVIEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLI 239          
BLAST of GTP cyclohydrolase 1 vs. UniProt/SwissProt
Match: sp|P22288|GCH1_RAT (GTP cyclohydrolase 1 OS=Rattus norvegicus OX=10116 GN=Gch1 PE=1 SV=1)

HSP 1 Score: 297.36 bits (760), Expect = 1.217e-100
Identity = 133/178 (74.72%), Postives = 161/178 (90.45%), Query Frame = 1
Query:  247 IADYYKDILMAVGEDVTRQGLLKTPDRAAKAMLYFTKGYENNIDEILNNAIFTEDHDEMVVVKDIEMFSLCEHHLVPFIGKVSIGYLPNKRIIGLSKIARIVEVYSRRLQVQERLTKEIAVALTKAIDPSGVGVIIEATHMCMVMRGVQKINAKTITSTMLGTFREDPKTREEFLTLV 780
            +A  Y  IL ++GED  RQGLLKTP RAA AM +FTKGY+  I ++LN+AIF EDHDEMV+VKDI+MFS+CEHHLVPF+G+V IGYLPNK+++GLSK+ARIVE+YSRRLQVQERLTK+IAVA+T+A+ P+GVGV+IEATHMCMVMRGVQK+N+KT+TSTMLG FREDPKTREEFLTL+
Sbjct:   62 LAAAYSSILRSLGEDPQRQGLLKTPWRAATAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGRVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALQPAGVGVVIEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLI 239          
BLAST of GTP cyclohydrolase 1 vs. UniProt/SwissProt
Match: sp|P30793|GCH1_HUMAN (GTP cyclohydrolase 1 OS=Homo sapiens OX=9606 GN=GCH1 PE=1 SV=1)

HSP 1 Score: 296.975 bits (759), Expect = 2.370e-100
Identity = 132/178 (74.16%), Postives = 161/178 (90.45%), Query Frame = 1
Query:  247 IADYYKDILMAVGEDVTRQGLLKTPDRAAKAMLYFTKGYENNIDEILNNAIFTEDHDEMVVVKDIEMFSLCEHHLVPFIGKVSIGYLPNKRIIGLSKIARIVEVYSRRLQVQERLTKEIAVALTKAIDPSGVGVIIEATHMCMVMRGVQKINAKTITSTMLGTFREDPKTREEFLTLV 780
            +A  Y  IL ++GE+  RQGLLKTP RAA AM +FTKGY+  I ++LN+AIF EDHDEMV+VKDI+MFS+CEHHLVPF+GKV IGYLPNK+++GLSK+ARIVE+YSRRLQVQERLTK+IAVA+T+A+ P+GVGV++EATHMCMVMRGVQK+N+KT+TSTMLG FREDPKTREEFLTL+
Sbjct:   71 LAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLI 248          
BLAST of GTP cyclohydrolase 1 vs. UniProt/SwissProt
Match: sp|Q19980|GCH1_CAEEL (GTP cyclohydrolase 1 OS=Caenorhabditis elegans OX=6239 GN=cat-4 PE=1 SV=1)

HSP 1 Score: 295.434 bits (755), Expect = 3.783e-100
Identity = 130/187 (69.52%), Postives = 163/187 (87.17%), Query Frame = 1
Query:  226 RQDTVDLIADYYKDILMAVGEDVTRQGLLKTPDRAAKAMLYFTKGYENNIDEILNNAIFTEDHDEMVVVKDIEMFSLCEHHLVPFIGKVSIGYLPNKRIIGLSKIARIVEVYSRRLQVQERLTKEIAVALTKAIDPSGVGVIIEATHMCMVMRGVQKINAKTITSTMLGTFREDPKTREEFLTLVGR 786
            ++D +  + + Y+ I+  VGED+ RQGLLKTP+RAAKAM+ FTKGY++ +DE+LN A+F EDHDEMV+VKDIEMFSLCEHHLVPF+GKV IGY+PNK+++GLSK+ARIVE++SRRLQVQERLTK+IA A+ +A+ PSGV V+IEA+HMCMVMRGVQKINA T TS MLG FR+DPKTREEFL L+ +
Sbjct:   36 KEDHLKSMCNAYQSIIQHVGEDINRQGLLKTPERAAKAMMAFTKGYDDQLDELLNEAVFDEDHDEMVIVKDIEMFSLCEHHLVPFMGKVHIGYIPNKKVLGLSKLARIVEMFSRRLQVQERLTKQIATAMVQAVQPSGVAVVIEASHMCMVMRGVQKINASTTTSCMLGVFRDDPKTREEFLNLINK 222          
BLAST of GTP cyclohydrolase 1 vs. UniProt/SwissProt
Match: sp|P50141|GCH1_CHICK (GTP cyclohydrolase 1 OS=Gallus gallus OX=9031 GN=GCH1 PE=2 SV=1)

HSP 1 Score: 295.434 bits (755), Expect = 5.834e-100
Identity = 137/193 (70.98%), Postives = 167/193 (86.53%), Query Frame = 1
Query:  211 EKDDSRQD---TVDLIADYYKDILMAVGEDVTRQGLLKTPDRAAKAMLYFTKGYENNIDEILNNAIFTEDHDEMVVVKDIEMFSLCEHHLVPFIGKVSIGYLPNKRIIGLSKIARIVEVYSRRLQVQERLTKEIAVALTKAIDPSGVGVIIEATHMCMVMRGVQKINAKTITSTMLGTFREDPKTREEFLTLV 780
            E+  S +D   ++  +A  Y  IL A+GED  RQGLLKTP RAA AM +FTKGY+  I ++LN+AIF EDHDEMV+VK+I+MFSLCEHHLVPF+GKV IGYLPNK+++GLSK+ARIVE+YSRRLQVQERLTK+IA+A+T+A+ P+GVGV+IEATHMCMVMRGVQK+N+KT TSTMLG FREDPKTREEFLTL+
Sbjct:   42 ERPRSEEDNELSLPSLAAAYTTILRALGEDPERQGLLKTPWRAATAMQFFTKGYQETIADVLNDAIFDEDHDEMVIVKNIDMFSLCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAIAITEALQPAGVGVVIEATHMCMVMRGVQKMNSKTATSTMLGVFREDPKTREEFLTLI 234          
BLAST of GTP cyclohydrolase 1 vs. TrEMBL
Match: V4AKS7 (GTP_cyclohydroI domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_118558 PE=3 SV=1)

HSP 1 Score: 313.153 bits (801), Expect = 1.243e-104
Identity = 140/186 (75.27%), Postives = 171/186 (91.94%), Query Frame = 1
Query:  223 SRQDTVDLIADYYKDILMAVGEDVTRQGLLKTPDRAAKAMLYFTKGYENNIDEILNNAIFTEDHDEMVVVKDIEMFSLCEHHLVPFIGKVSIGYLPNKRIIGLSKIARIVEVYSRRLQVQERLTKEIAVALTKAIDPSGVGVIIEATHMCMVMRGVQKINAKTITSTMLGTFREDPKTREEFLTLV 780
            + ++ +  ++ ++K IL  VGED  RQGLLKTP+RAAKA++YFTKGY  NI+++LNNA+F EDHDEMV+VKDIEMFS+CEHHLVPF+GKVSIGYLPNK+I+GLSK+ARIVE++SRRLQ+QERLTK+IAVA+T+AI PSGVGV+IEATHMCMVMRGVQKI++KT+TSTMLG FREDPKTREEFLTLV
Sbjct:   44 TEEERIAYVSSHFKHILQGVGEDPERQGLLKTPERAAKALMYFTKGYSENIEDVLNNAVFDEDHDEMVIVKDIEMFSMCEHHLVPFMGKVSIGYLPNKKILGLSKLARIVEIFSRRLQIQERLTKQIAVAITEAICPSGVGVVIEATHMCMVMRGVQKISSKTVTSTMLGVFREDPKTREEFLTLV 229          
BLAST of GTP cyclohydrolase 1 vs. TrEMBL
Match: A0A1S3JBS5 (GTP cyclohydrolase 1 OS=Lingula unguis OX=7574 GN=LOC106171897 PE=3 SV=1)

HSP 1 Score: 309.686 bits (792), Expect = 4.352e-103
Identity = 142/190 (74.74%), Postives = 170/190 (89.47%), Query Frame = 1
Query:  208 QEKDDSRQDTVDLIADYYKDILMAVGEDVTRQGLLKTPDRAAKAMLYFTKGYENNIDEILNNAIFTEDHDEMVVVKDIEMFSLCEHHLVPFIGKVSIGYLPNKRIIGLSKIARIVEVYSRRLQVQERLTKEIAVALTKAIDPSGVGVIIEATHMCMVMRGVQKINAKTITSTMLGTFREDPKTREEFLTL 777
            +E  +  ++ +  + D Y  +L  +GEDV+R+GLLKTP RA+KAML+FTKGYE  I ++LN+AIF EDHDEMV+VKDIEMFS+CEHHLVPFIGKVSIGYLPNKR++GLSK+ARIVE++SRRLQVQERLTK+IAVALT+AI P+GVGV+IEATHMCMVMRGVQK+N+KTITSTMLG FREDPKTREEFLTL
Sbjct:   47 EENQNEEKERLCEMTDAYTHLLKGIGEDVSREGLLKTPARASKAMLFFTKGYEEKIQDVLNDAIFDEDHDEMVIVKDIEMFSMCEHHLVPFIGKVSIGYLPNKRVLGLSKLARIVEIFSRRLQVQERLTKQIAVALTEAIQPAGVGVVIEATHMCMVMRGVQKLNSKTITSTMLGVFREDPKTREEFLTL 236          
BLAST of GTP cyclohydrolase 1 vs. TrEMBL
Match: A0A210PGZ7 (GTP cyclohydrolase 1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT10588 PE=3 SV=1)

HSP 1 Score: 309.686 bits (792), Expect = 7.404e-103
Identity = 141/177 (79.66%), Postives = 164/177 (92.66%), Query Frame = 1
Query:  247 IADYYKDILMAVGEDVTRQGLLKTPDRAAKAMLYFTKGYENNIDEILNNAIFTEDHDEMVVVKDIEMFSLCEHHLVPFIGKVSIGYLPNKRIIGLSKIARIVEVYSRRLQVQERLTKEIAVALTKAIDPSGVGVIIEATHMCMVMRGVQKINAKTITSTMLGTFREDPKTREEFLTL 777
            + + YK IL  +GED +RQGLL+TP+RAAKAM++FTKGY  NI + LN+AIF EDHD+MV+VKDIEMFSLCEHHLVPFIGKVSIGYLPNKR++GLSK+ARIVE+YSRRLQVQERLTK+IAVA+T+AI PSGVGV+IEATHMCMVMRGVQK+N+KT+TSTMLG FREDPKTREEFLTL
Sbjct:   70 LQENYKGILKGLGEDTSRQGLLRTPERAAKAMMFFTKGYRENIKDALNDAIFDEDHDDMVIVKDIEMFSLCEHHLVPFIGKVSIGYLPNKRVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEAIQPSGVGVVIEATHMCMVMRGVQKLNSKTVTSTMLGVFREDPKTREEFLTL 246          
BLAST of GTP cyclohydrolase 1 vs. TrEMBL
Match: A0A097EU88 (GTP cyclohydrolase OS=Platynereis dumerilii OX=6359 GN=gch PE=2 SV=1)

HSP 1 Score: 309.686 bits (792), Expect = 3.845e-102
Identity = 140/213 (65.73%), Postives = 181/213 (84.98%), Query Frame = 1
Query:  145 DNVFHSNR-RRKFSENDFQRDFQEKDDSRQDTVDLIADYYKDILMAVGEDVTRQGLLKTPDRAAKAMLYFTKGYENNIDEILNNAIFTEDHDEMVVVKDIEMFSLCEHHLVPFIGKVSIGYLPNKRIIGLSKIARIVEVYSRRLQVQERLTKEIAVALTKAIDPSGVGVIIEATHMCMVMRGVQKINAKTITSTMLGTFREDPKTREEFLTLV 780
            D+  HS+R  R       + D + + ++++  +  +   Y+ +LM+VGED +RQGLLKTP+RAAKA+LYFTKGY+  I ++LN+AIF EDHDEMV+V+DIEMFS+CEHH+VPFIGKVSIGYLPNKR++GLSK+ARIVEVY RRLQVQERLTK+IAVA+T+A+ P+GVGV+IEATHMCMVMRGVQK+N++T+TSTMLGTFR+DPKTREEF  ++
Sbjct:   75 DDEDHSHRAHRSLYSPSPRMDERNRAENKEQALAEMTQSYRSLLMSVGEDPSRQGLLKTPERAAKALLYFTKGYDEKISDVLNDAIFDEDHDEMVIVRDIEMFSMCEHHMVPFIGKVSIGYLPNKRVVGLSKLARIVEVYCRRLQVQERLTKQIAVAITEAVQPAGVGVVIEATHMCMVMRGVQKLNSRTLTSTMLGTFRDDPKTREEFXCVI 287          
BLAST of GTP cyclohydrolase 1 vs. TrEMBL
Match: A0A087TTQ4 (GTP cyclohydrolase 1 (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_08934 PE=3 SV=1)

HSP 1 Score: 305.834 bits (782), Expect = 1.268e-101
Identity = 139/197 (70.56%), Postives = 171/197 (86.80%), Query Frame = 1
Query:  190 DFQRDFQEKDDSRQDTVDLIADYYKDILMAVGEDVTRQGLLKTPDRAAKAMLYFTKGYENNIDEILNNAIFTEDHDEMVVVKDIEMFSLCEHHLVPFIGKVSIGYLPNKRIIGLSKIARIVEVYSRRLQVQERLTKEIAVALTKAIDPSGVGVIIEATHMCMVMRGVQKINAKTITSTMLGTFREDPKTREEFLTLV 780
             + RD   ++   Q  ++L    Y+ +L  + ED  RQGLLKTP+RAAKA L+FTKGYE  +++++N+AIF EDHDEMV+VKDIEMFS+CEHHLVPFIGKVS+GYLPNK+++GLSK+ARIVEVYSRRLQVQERLTK+IAVA+T+AI P+GVGV+IEATHMCMVMRGVQK+N+KTITSTMLG FREDPKTREEFL+L+
Sbjct:   37 SYDRDLAPEEPESQQVLEL-TRVYRQLLTGIREDPNRQGLLKTPERAAKAFLFFTKGYEQTLEDVVNDAIFEEDHDEMVIVKDIEMFSMCEHHLVPFIGKVSVGYLPNKKVLGLSKLARIVEVYSRRLQVQERLTKQIAVAVTEAIGPTGVGVVIEATHMCMVMRGVQKLNSKTITSTMLGVFREDPKTREEFLSLI 232          
BLAST of GTP cyclohydrolase 1 vs. Ensembl Cavefish
Match: gch1 (GTP cyclohydrolase 1 [Source:NCBI gene;Acc:103046294])

HSP 1 Score: 292.352 bits (747), Expect = 3.027e-99
Identity = 133/178 (74.72%), Postives = 158/178 (88.76%), Query Frame = 1
Query:  247 IADYYKDILMAVGEDVTRQGLLKTPDRAAKAMLYFTKGYENNIDEILNNAIFTEDHDEMVVVKDIEMFSLCEHHLVPFIGKVSIGYLPNKRIIGLSKIARIVEVYSRRLQVQERLTKEIAVALTKAIDPSGVGVIIEATHMCMVMRGVQKINAKTITSTMLGTFREDPKTREEFLTLV 780
            IA  Y  IL  +GED  RQGLLKTP RAA AM +FTKGY+  I ++LN+AIF EDHDEMV+VKDI+MFS+CEHHLVP  G+V IGYLPNKR++GLSK+ARIVE+YSRRLQVQERLTK+IAVA+T+A+ P+GVGV+IEATHMCMVMRGVQK+N+KT+TSTMLG FREDPKTR+EFLTL+
Sbjct:   88 IAAAYTTILRGLGEDPQRQGLLKTPWRAATAMQFFTKGYQEKIIDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPIFGRVHIGYLPNKRVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALQPAGVGVVIEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTRDEFLTLI 265          
BLAST of GTP cyclohydrolase 1 vs. Ensembl Cavefish
Match: gch2 (GTP cyclohydrolase 1-like [Source:NCBI gene;Acc:103043231])

HSP 1 Score: 281.182 bits (718), Expect = 3.139e-95
Identity = 129/189 (68.25%), Postives = 160/189 (84.66%), Query Frame = 1
Query:  214 KDDSRQDTVDLIADYYKDILMAVGEDVTRQGLLKTPDRAAKAMLYFTKGYENNIDEILNNAIFTEDHDEMVVVKDIEMFSLCEHHLVPFIGKVSIGYLPNKRIIGLSKIARIVEVYSRRLQVQERLTKEIAVALTKAIDPSGVGVIIEATHMCMVMRGVQKINAKTITSTMLGTFREDPKTREEFLTLV 780
            +D+SR   ++     Y  IL  +GE+  RQGLL+TP RAAKAM + TKGY   I +ILN+AIF EDHDEMV+VKDI+MFSLCEHHLVPF GKV IGYLP+K+++GLSK+ARIVE+YSRRLQVQERLTK+IA+A+++A+ P+GV V+IEA HMCMVMRGVQK+N++T+TS MLG FREDPKTREEFL+LV
Sbjct:   53 EDESRLPALEAA---YTTILRGLGENTERQGLLRTPLRAAKAMQFLTKGYHETIYDILNDAIFDEDHDEMVIVKDIDMFSLCEHHLVPFFGKVHIGYLPSKKVVGLSKLARIVEIYSRRLQVQERLTKQIAMAISEALQPAGVAVVIEAAHMCMVMRGVQKMNSRTVTSAMLGVFREDPKTREEFLSLV 238          
BLAST of GTP cyclohydrolase 1 vs. Ensembl Sea Lamprey
Match: gch1 (GTP cyclohydrolase 1 [Source:ZFIN;Acc:ZDB-GENE-070720-5])

HSP 1 Score: 236.113 bits (601), Expect = 1.320e-79
Identity = 105/143 (73.43%), Postives = 133/143 (93.01%), Query Frame = 1
Query:  361 YENNIDEILNNAIFTEDHDEMVVVKDIEMFSLCEHHLVPFIGK---VSIGYLPNKRIIGLSKIARIVEVYSRRLQVQERLTKEIAVALTKAIDPSGVGVIIEATHMCMVMRGVQKINAKTITSTMLGTFREDPKTREEFLTLV 780
            + + + +ILN+AIF EDHDEMV+VKDI+MFS+CEHH+VPF+GK   V IGYLPNK+++GLSK+ARIVE++SRRLQVQERLTK+IAVA+T+A+ P+GVGV+IEATHMCM+MRGVQK+N+KT+TSTMLG FREDPKTREEFL+L+
Sbjct:    1 FSSPLADILNDAIFNEDHDEMVIVKDIDMFSMCEHHMVPFVGKRVQVHIGYLPNKKVVGLSKLARIVEMFSRRLQVQERLTKQIAVAVTEALQPAGVGVVIEATHMCMLMRGVQKMNSKTLTSTMLGVFREDPKTREEFLSLI 143          
BLAST of GTP cyclohydrolase 1 vs. Ensembl Yeast
Match: FOL2 (GTP-cyclohydrolase I, catalyzes first step in folic acid biosynthesis; human homolog GCH1 is implicated in dopa-responsive dystonia (DRD), and can complement yeast null mutant [Source:SGD;Acc:S000003499])

HSP 1 Score: 258.07 bits (658), Expect = 5.826e-87
Identity = 120/184 (65.22%), Postives = 151/184 (82.07%), Query Frame = 1
Query:  238 VDLIADYYKDILMAVGEDVTRQGLLKTPDRAAKAMLYFTKGYENNI-DEILNNAIFTEDHDEMVVVKDIEMFSLCEHHLVPFIGKVSIGYLPNKRIIGLSKIARIVEVYSRRLQVQERLTKEIAVALTKAIDPSGVGVIIEATHMCMVMRGVQKINAKTITSTMLGTFREDPKTREEFLTLVGR 786
            +  I+   K IL  +GEDV R+GLL TP R AKAMLYFTKGY+ NI D+++ NA+F EDHDEMV+V+DIE++SLCEHHLVPF GKV IGY+PNK++IGLSK+AR+ E+Y+RRLQVQERLTK+IA+AL+  + P GV V++EA+HMCMV RG+QK  + T+TS MLG FR   KTREEFLTL+GR
Sbjct:   58 IQRISGAIKTILTELGEDVNREGLLDTPQRYAKAMLYFTKGYQTNIMDDVIKNAVFEEDHDEMVIVRDIEIYSLCEHHLVPFFGKVHIGYIPNKKVIGLSKLARLAEMYARRLQVQERLTKQIAMALSDILKPLGVAVVMEASHMCMVSRGIQKTGSSTVTSCMLGGFRAH-KTREEFLTLLGR 240          
BLAST of GTP cyclohydrolase 1 vs. Ensembl Nematostella
Match: EDO46820 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNY6])

HSP 1 Score: 287.73 bits (735), Expect = 9.587e-99
Identity = 129/183 (70.49%), Postives = 162/183 (88.52%), Query Frame = 1
Query:  238 VDLIADYYKDILMAVGEDVTRQGLLKTPDRAAKAMLYFTKGYENNIDEILNNAIFTEDHDEMVVVKDIEMFSLCEHHLVPFIGKVSIGYLPNKRIIGLSKIARIVEVYSRRLQVQERLTKEIAVALTKAIDPSGVGVIIEATHMCMVMRGVQKINAKTITSTMLGTFREDPKTREEFLTLVGR 786
            V  I+  Y+ IL  +GED  RQGLLKTP+RAAKAMLYFTKGYE  + EILN+A+F EDHDE+V+VKDIEMFSLCEHHLVPF+GKV IGYLPNK+I+GLSK+AR+VE++SRRLQVQERLTK+IA+A+ +A++P+GVGV+IEA HMCMVMRGVQK +++T+TS MLG  REDP++R+EFLTL+ +
Sbjct:   23 VAAISKAYETILSNIGEDKDRQGLLKTPERAAKAMLYFTKGYEEKVQEILNDAVFDEDHDELVIVKDIEMFSLCEHHLVPFMGKVHIGYLPNKKIVGLSKLARLVEMFSRRLQVQERLTKQIAMAIVEAVNPAGVGVVIEAKHMCMVMRGVQKPSSETVTSCMLGVLREDPRSRDEFLTLIHK 205          
BLAST of GTP cyclohydrolase 1 vs. Ensembl Nematostella
Match: EDO25857 (pep supercontig:ASM20922v1:NEMVEscaffold_9951:275:692:-1 gene:NEMVEDRAFT_v1g156255 transcript:EDO25857 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 127.872 bits (320), Expect = 7.577e-38
Identity = 57/73 (78.08%), Postives = 65/73 (89.04%), Query Frame = 1
Query:  268 ILMAVGEDVTRQGLLKTPDRAAKAMLYFTKGYENNIDEILNNAIFTEDHDEMVVVKDIEMFSLCEHHLVPFIG 486
            IL  +GED  RQGLLKTP+RAAKAMLYFTKGYE  + EILN+A+F EDHDE+V+VKDIEMFSLCEHHLVPF+G
Sbjct:    4 ILSNIGEDKDRQGLLKTPERAAKAMLYFTKGYEEKVQEILNDAVFDEDHDELVIVKDIEMFSLCEHHLVPFMG 76          
BLAST of GTP cyclohydrolase 1 vs. Ensembl Medaka
Match: gch1 (GTP cyclohydrolase 1 [Source:NCBI gene;Acc:101168423])

HSP 1 Score: 291.967 bits (746), Expect = 2.497e-99
Identity = 131/178 (73.60%), Postives = 158/178 (88.76%), Query Frame = 1
Query:  247 IADYYKDILMAVGEDVTRQGLLKTPDRAAKAMLYFTKGYENNIDEILNNAIFTEDHDEMVVVKDIEMFSLCEHHLVPFIGKVSIGYLPNKRIIGLSKIARIVEVYSRRLQVQERLTKEIAVALTKAIDPSGVGVIIEATHMCMVMRGVQKINAKTITSTMLGTFREDPKTREEFLTLV 780
            +A  Y  IL  +GED  RQGLLKTP RAA AM +FTKGY+  I ++LN+AIF EDHDEMV+VKDI+MFS+CEHHLVP  G+V IGYLPNKR++GLSK+ARIVE+YSRRLQVQERLTK+IAVA+T+A+ P+GVGV++EATHMCMVMRGVQK+N+KT+TSTMLG FREDPKTR+EFLTL+
Sbjct:   75 LAAAYSTILRGLGEDPQRQGLLKTPWRAATAMQFFTKGYQEKITDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPIFGRVHIGYLPNKRVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALQPTGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTRDEFLTLI 252          
BLAST of GTP cyclohydrolase 1 vs. Ensembl Medaka
Match: ENSORLT00000023429.2 (GTP cyclohydrolase 1 [Source:NCBI gene;Acc:101161367])

HSP 1 Score: 277.715 bits (709), Expect = 5.026e-94
Identity = 128/193 (66.32%), Postives = 161/193 (83.42%), Query Frame = 1
Query:  208 QEKDDSRQDTVDLIADYYKDILMAVGEDVTRQGLLKTPDRAAKAMLYFTKGYENNIDEILNNAIFTEDHDEMVVVKDIEMFSLCEHHLVPFIGKVSIGYLPNKRIIGLSKIARIVEVYSRRLQVQERLTKEIAVALTKAIDPSGVGVIIEATHMCMVMRGVQKINAKTITSTMLGTFREDPKTREEFLTLVGR 786
            + +D+SR   + L+   Y  IL  +GED  R+GLL+TP RAAKA+ +FTKGY   ID+ILNNAIF EDH+EMV+VKDI++FSLCEHHLVPF GKV IGY+PNK+++GLSK+ARI E++SRRLQVQERLTK+IA+A+ +A+ P GV V+IEA HMCMVMRGVQK+N++T+TSTMLG + EDPKTREEFLTL  R
Sbjct:   46 ESEDESR---LPLLEAAYTSILRHLGEDTDREGLLRTPLRAAKAIQFFTKGYHETIDDILNNAIFDEDHEEMVIVKDIDVFSLCEHHLVPFFGKVHIGYIPNKKVVGLSKLARIAEIFSRRLQVQERLTKQIAMAICEALQPKGVAVVIEAAHMCMVMRGVQKMNSRTVTSTMLGIYLEDPKTREEFLTLAMR 235          
BLAST of GTP cyclohydrolase 1 vs. Ensembl Medaka
Match: gch1 (GTP cyclohydrolase 1 [Source:NCBI gene;Acc:101168423])

HSP 1 Score: 218.009 bits (554), Expect = 3.271e-70
Identity = 98/143 (68.53%), Postives = 122/143 (85.31%), Query Frame = 1
Query:  235 TVDLIADYYKDILMAVGEDVTRQGLLKTPDRAAKAMLYFTKGYENNIDEILNNAIFTEDHDEMVVVKDIEMFSLCEHHLVPFIGKVSIGYLPNKRIIGLSKIARIVEVYSRRLQVQERLTKEIAVALTKAIDPSGVGVIIEAT 663
            ++  +A  Y  IL  +GED  RQGLLKTP RAA AM +FTKGY+  I ++LN+AIF EDHDEMV+VKDI+MFS+CEHHLVP  G+V IGYLPNKR++GLSK+ARIVE+YSRRLQVQERLTK+IAVA+T+A+ P+GVGV++EAT
Sbjct:   71 SLPSLAAAYSTILRGLGEDPQRQGLLKTPWRAATAMQFFTKGYQEKITDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPIFGRVHIGYLPNKRVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALQPTGVGVVVEAT 213          
BLAST of GTP cyclohydrolase 1 vs. Planmine SMEST
Match: SMESG000064560.1 (SMESG000064560.1)

HSP 1 Score: 462.225 bits (1188), Expect = 3.136e-167
Identity = 222/224 (99.11%), Postives = 224/224 (100.00%), Query Frame = 1
Query:  115 MAENSNNNCVDNVFHSNRRRKFSENDFQRDFQEKDDSRQDTVDLIADYYKDILMAVGEDVTRQGLLKTPDRAAKAMLYFTKGYENNIDEILNNAIFTEDHDEMVVVKDIEMFSLCEHHLVPFIGKVSIGYLPNKRIIGLSKIARIVEVYSRRLQVQERLTKEIAVALTKAIDPSGVGVIIEATHMCMVMRGVQKINAKTITSTMLGTFREDPKTREEFLTLVGR 786
            MAENSNNNCVDNVFHSNRRRKFSENDFQRDFQEKDDSRQDTVDLIADYYKDIL+AVGEDVTRQGLLKTPDRAAKAMLYFTKGYENNIDEILNNAIFTEDHDEMVVVKDIEMFSLCEHHLVPFIGKVSIGYLPNKRIIGLSKIARIVEVYSRRLQVQERLTKEIA+ALTKAIDPSGVGVIIEATHMCMVMRGVQKINAKTITSTMLGTFREDPKTREEFLTLVGR
Sbjct:    1 MAENSNNNCVDNVFHSNRRRKFSENDFQRDFQEKDDSRQDTVDLIADYYKDILLAVGEDVTRQGLLKTPDRAAKAMLYFTKGYENNIDEILNNAIFTEDHDEMVVVKDIEMFSLCEHHLVPFIGKVSIGYLPNKRIIGLSKIARIVEVYSRRLQVQERLTKEIAIALTKAIDPSGVGVIIEATHMCMVMRGVQKINAKTITSTMLGTFREDPKTREEFLTLVGR 224          
The following BLAST results are available for this feature:
BLAST of GTP cyclohydrolase 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GCH14.936e-10174.16GTP cyclohydrolase 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
GCH14.936e-10174.16GTP cyclohydrolase 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
GCH14.936e-10174.16GTP cyclohydrolase 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
GCH18.064e-7270.50GTP cyclohydrolase 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
GCH11.408e-7165.56GTP cyclohydrolase 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of GTP cyclohydrolase 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cat-42.974e-10169.52GTP cyclohydrolase 1 [Source:UniProtKB/Swiss-Prot... [more]
back to top
BLAST of GTP cyclohydrolase 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Pu2.939e-9367.17gene:FBgn0003162 transcript:FBtr0071578[more]
Pu2.565e-9267.17gene:FBgn0003162 transcript:FBtr0071580[more]
Pu3.018e-9267.17gene:FBgn0003162 transcript:FBtr0071579[more]
back to top
BLAST of GTP cyclohydrolase 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gch14.728e-9974.16GTP cyclohydrolase 1 [Source:ZFIN;Acc:ZDB-GENE-070... [more]
gch27.455e-9366.84GTP cyclohydrolase 2 [Source:ZFIN;Acc:ZDB-GENE-001... [more]
gch13.632e-5581.05GTP cyclohydrolase 1 [Source:ZFIN;Acc:ZDB-GENE-070... [more]
CU464134.26.096e-1141.43pep chromosome:GRCz11:17:15111319:15165592:1 gene:... [more]
gch11.824e-1050.85GTP cyclohydrolase 1 [Source:ZFIN;Acc:ZDB-GENE-070... [more]
back to top
BLAST of GTP cyclohydrolase 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
gch13.574e-10276.40GTP cyclohydrolase 1 [Source:NCBI gene;Acc:448485][more]
tekt38.198e-9063.49tektin 3 [Source:Xenbase;Acc:XB-GENE-989321][more]
gch12.202e-8869.10GTP cyclohydrolase 1 [Source:NCBI gene;Acc:448485][more]
gch13.853e-8864.95GTP cyclohydrolase 1 [Source:NCBI gene;Acc:448485][more]
back to top
BLAST of GTP cyclohydrolase 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Gch15.882e-10371.81GTP cyclohydrolase 1 [Source:MGI Symbol;Acc:MGI:95... [more]
back to top
BLAST of GTP cyclohydrolase 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q05915|GCH1_MOUSE4.114e-10271.81GTP cyclohydrolase 1 OS=Mus musculus OX=10090 GN=G... [more]
sp|P22288|GCH1_RAT1.217e-10074.72GTP cyclohydrolase 1 OS=Rattus norvegicus OX=10116... [more]
sp|P30793|GCH1_HUMAN2.370e-10074.16GTP cyclohydrolase 1 OS=Homo sapiens OX=9606 GN=GC... [more]
sp|Q19980|GCH1_CAEEL3.783e-10069.52GTP cyclohydrolase 1 OS=Caenorhabditis elegans OX=... [more]
sp|P50141|GCH1_CHICK5.834e-10070.98GTP cyclohydrolase 1 OS=Gallus gallus OX=9031 GN=G... [more]
back to top
BLAST of GTP cyclohydrolase 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4AKS71.243e-10475.27GTP_cyclohydroI domain-containing protein OS=Lotti... [more]
A0A1S3JBS54.352e-10374.74GTP cyclohydrolase 1 OS=Lingula unguis OX=7574 GN=... [more]
A0A210PGZ77.404e-10379.66GTP cyclohydrolase 1 OS=Mizuhopecten yessoensis OX... [more]
A0A097EU883.845e-10265.73GTP cyclohydrolase OS=Platynereis dumerilii OX=635... [more]
A0A087TTQ41.268e-10170.56GTP cyclohydrolase 1 (Fragment) OS=Stegodyphus mim... [more]
back to top
BLAST of GTP cyclohydrolase 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
gch13.027e-9974.72GTP cyclohydrolase 1 [Source:NCBI gene;Acc:1030462... [more]
gch23.139e-9568.25GTP cyclohydrolase 1-like [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of GTP cyclohydrolase 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gch11.320e-7973.43GTP cyclohydrolase 1 [Source:ZFIN;Acc:ZDB-GENE-070... [more]
back to top
BLAST of GTP cyclohydrolase 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
FOL25.826e-8765.22GTP-cyclohydrolase I, catalyzes first step in foli... [more]
back to top
BLAST of GTP cyclohydrolase 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO468209.587e-9970.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO258577.577e-3878.08pep supercontig:ASM20922v1:NEMVEscaffold_9951:275:... [more]
back to top
BLAST of GTP cyclohydrolase 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
gch12.497e-9973.60GTP cyclohydrolase 1 [Source:NCBI gene;Acc:1011684... [more]
ENSORLT00000023429.25.026e-9466.32GTP cyclohydrolase 1 [Source:NCBI gene;Acc:1011613... [more]
gch13.271e-7068.53GTP cyclohydrolase 1 [Source:NCBI gene;Acc:1011684... [more]
back to top
BLAST of GTP cyclohydrolase 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000064560.13.136e-16799.11SMESG000064560.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029047 ID=SMED30029047|Name=GTP cyclohydrolase 1|organism=Schmidtea mediterranea sexual|type=transcript|length=838bp
TACAAACATATTCACCAGTTTTCGGTTGAACTGACGATTAATTATTCAGA
CATTATATATTCTAAATACACTGTCTTGTTAATTCATTACATGATTTACC
AATTCACCTAATCTATGGCCGAAAATTCTAACAACAATTGCGTTGATAAC
GTTTTTCACTCAAATCGACGGAGGAAATTTTCTGAAAACGATTTTCAGAG
AGATTTTCAAGAGAAAGATGATTCAAGACAGGATACAGTTGATCTCATAG
CAGACTATTACAAAGATATATTGATGGCCGTTGGAGAGGATGTGACAAGA
CAAGGTCTTTTGAAAACTCCAGATAGAGCAGCAAAAGCTATGCTTTATTT
TACCAAAGGATATGAAAACAATATTGACGAGATACTAAACAATGCAATTT
TCACGGAAGATCACGATGAAATGGTTGTTGTAAAGGACATTGAAATGTTT
TCGTTGTGTGAACATCATCTAGTTCCATTTATCGGAAAAGTCTCAATTGG
CTATTTACCAAACAAGCGCATTATAGGCCTGAGTAAAATTGCGAGGATTG
TCGAAGTGTACAGTCGAAGATTACAAGTGCAAGAACGATTAACCAAAGAA
ATCGCAGTAGCTCTCACAAAAGCCATTGATCCGAGTGGTGTTGGGGTTAT
TATTGAAGCAACGCATATGTGCATGGTAATGAGAGGCGTTCAAAAAATAA
ACGCTAAAACAATTACTAGTACAATGCTAGGGACATTCAGAGAAGATCCA
AAAACGAGAGAAGAATTTTTAACTTTAGTTGGTAGATGATAAACTGTTAG
GCTCAGATTTAGAAATTTGCTTTTCAAATTGTAATGCC
back to top

protein sequence of SMED30029047-orf-1

>SMED30029047-orf-1 ID=SMED30029047-orf-1|Name=SMED30029047-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=225bp
MAENSNNNCVDNVFHSNRRRKFSENDFQRDFQEKDDSRQDTVDLIADYYK
DILMAVGEDVTRQGLLKTPDRAAKAMLYFTKGYENNIDEILNNAIFTEDH
DEMVVVKDIEMFSLCEHHLVPFIGKVSIGYLPNKRIIGLSKIARIVEVYS
RRLQVQERLTKEIAVALTKAIDPSGVGVIIEATHMCMVMRGVQKINAKTI
TSTMLGTFREDPKTREEFLTLVGR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR043134GTP-CH-I_N
IPR043133GTP-CH-I_C/QueF
IPR001474GTP_CycHdrlase_I
IPR020602GTP_CycHdrlase_I_dom
IPR018234GTP_CycHdrlase_I_CS
Vocabulary: molecular function
TermDefinition
GO:0003934GTP cyclohydrolase I activity
GO:0000166nucleotide binding
GO:0003824catalytic activity
GO:0005509calcium ion binding
GO:0005525GTP binding
GO:0008270zinc ion binding
GO:0016787hydrolase activity
GO:0030742GTP-dependent protein binding
GO:0031369translation initiation factor binding
GO:0042803protein homodimerization activity
GO:0046872metal ion binding
GO:0050662coenzyme binding
GO:0051019mitogen-activated protein kinase binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005829cytosol
GO:0031410cytoplasmic vesicle
GO:0031965nuclear membrane
GO:0043234protein complex
Vocabulary: biological process
TermDefinition
GO:0046654tetrahydrofolate biosynthetic process
GO:0006461protein complex assembly
GO:0006729tetrahydrobiopterin biosynthetic process
GO:0008152metabolic process
GO:0008217regulation of blood pressure
GO:0010460positive regulation of heart rate
GO:0014916regulation of lung blood pressure
GO:0032496response to lipopolysaccharide
GO:0034341response to interferon-gamma
GO:0034612response to tumor necrosis factor
GO:00359987,8-dihydroneopterin 3'-triphosphate biosynthetic process
GO:0042311vasodilation
GO:0042416dopamine biosynthetic process
GO:0042559pteridine-containing compound biosynthetic process
GO:0045776negative regulation of blood pressure
GO:0048265response to pain
GO:0050884neuromuscular process controlling posture
GO:0051000positive regulation of nitric-oxide synthase activity
GO:0051066dihydrobiopterin metabolic process
GO:0051260protein homooligomerization
GO:0051291protein heterooligomerization
GO:0071222cellular response to lipopolysaccharide
GO:1905627regulation of serotonin biosynthetic process
GO:2000121regulation of removal of superoxide radicals
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR043134GTP cyclohydrolase I, N-terminal domainGENE3DG3DSA:1.10.286.10coord: 31..90
e-value: 6.9E-22
score: 78.7
IPR043133GTP cyclohydrolase I, C-terminal/NADPH-dependent 7-cyano-7-deazaguanine reductaseGENE3DG3DSA:3.30.1130.10coord: 93..223
e-value: 5.8E-64
score: 215.5
IPR020602GTP cyclohydrolase I domainPFAMPF01227GTP_cyclohydroIcoord: 47..222
e-value: 1.4E-74
score: 249.4
IPR001474GTP cyclohydrolase ITIGRFAMTIGR00063TIGR00063coord: 45..223
e-value: 1.1E-79
score: 264.1
IPR001474GTP cyclohydrolase IPANTHERPTHR11109GTP CYCLOHYDROLASE Icoord: 44..222
NoneNo IPR availablePANTHERPTHR11109:SF5GTP CYCLOHYDROLASE 1coord: 44..222
NoneNo IPR availableCDDcd00642GTP_cyclohydro1coord: 42..224
e-value: 2.59201E-110
score: 312.393
NoneNo IPR availableSUPERFAMILYSSF55620Tetrahydrobiopterin biosynthesis enzymes-likecoord: 33..223
IPR018234GTP cyclohydrolase I, conserved sitePROSITEPS00859GTP_CYCLOHYDROL_1_1coord: 102..118
IPR018234GTP cyclohydrolase I, conserved sitePROSITEPS00860GTP_CYCLOHYDROL_1_2coord: 150..160