ADAMTS-like protein 3

Overview
NameADAMTS-like protein 3
Smed IDSMED30029046
Length (bp)2382
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ADAMTS-like protein 3 (SMED30029046) t-SNE clustered cells

Violin plots show distribution of expression levels for ADAMTS-like protein 3 (SMED30029046) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ADAMTS-like protein 3 (SMED30029046) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ADAMTS-like protein 3 (SMED30029046) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029046

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30029046SMESG000073134.1 dd_Smed_v4_6962_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30029046SMESG000073134.1 dd_Smed_v4_6962_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029046SMESG000073134.1 dd_Smed_v4_6962_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30029046SMESG000073134.1 dd_Smed_v4_6962_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30029046SMESG000073134.1 dd_Smed_v4_6962_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30029046SMESG000073134.1 dd_Smed_v4_6962_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30029046SMESG000073134.1 dd_Smed_v4_6962_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ADAMTS-like protein 3 vs. Ensembl Human
Match: ADAMTSL3 (ADAMTS like 3 [Source:HGNC Symbol;Acc:HGNC:14633])

HSP 1 Score: 119.783 bits (299), Expect = 7.622e-27
Identity = 91/304 (29.93%), Postives = 136/304 (44.74%), Query Frame = 3
Query:  231 EIDIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYH--SSGQVVD--QEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACY---AKGLVPPASWRQCFDHIDPKKCFKKSEFLPEIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWGHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIK 1121
             +  W  CS TCG G+Q +   C           P ++C    +     + CN  DC  G  W   +W +CS TCG  G Q R V C    + G  ++   E+C +  K  S + C R +CPP+    +W K  V    C  G QRR   C  L   G+ I L    C       LV      +C   I  +   K  E  P+I+S +R  +Q R  +++NL +G  +Y+ P T + + CPV+ F  S + W  K        K   R+ +T+ G L I      D G +RC+AG+  +++V+K
Sbjct:  708 HVGSWGPCSATCGVGIQTRDVYCLHPGE---TPAPPEECRD--EKPHALQACNQFDCPPG--WHIEEWQQCSRTCG-GGTQNRRVTCRQLLTDGSFLNLSDELC-QGPKASSHKSCARTDCPPHLAVGDWSKCSV---SCGVGIQRRKQVCQRLAAKGRRIPLSEMMCRDLPGLPLVRSCQMPEC-SKIKSEMKTKLGEQGPQILSVQRVYIQTREEKRINLTIGSRAYLLPNTSVIIKCPVRRFQKSLIQW-EKDGRCLQNSK---RLGITKSGSLKIHGLAAPDIGVYRCIAGSAQETVVLK 994          

HSP 2 Score: 75.485 bits (184), Expect = 3.100e-13
Identity = 95/428 (22.20%), Postives = 165/428 (38.55%), Query Frame = 3
Query:  813 PEIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWGHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGN-----ISDSIV--IKSKSPSD------GYKDWAIRNSISNKDMPNELVQLDMMQENHVRWVIGDWSQCSVSCENTGFQSRMVR---------------CESLQK---------------RFYYQL----------------------SDDECVQRVAPKPFAKRECPR------NFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEKCDSTRKPVYE--CYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSCNPPKCNLKCVDMHPSCKRKKE--YCRMGIYSFSCCKTCQE 1871
            P I+S +R + +      L++ VG I     G  +T+ CPVK     N+ W  +       G     + +   G L++++  ++++G + C+A N     ++ S++  ++ + P        G+K + I  + + +   N+       QE    W  G+WS CS +C + G  +R+ R               C+ LQK               R++  +                        +  VQ V+P+  A ++ P         PC QW       N+C   C+G  +A  +       Q+ S     CD  ++P     C +  C V W    W  C+  CG+ G Q+R + C+   S  P     + +  + P   + C  P C+  C D    C   K    C +  Y   CC++CQE
Sbjct: 1284 PVILSVERNITKPEH-NHLSVVVGGIVEAALGANVTIRCPVKGVPQPNITWLKRG------GSLSGNVSLLFNGSLLLQNVSLENEGTYVCIATNALGKAVATSVLHLLERRWPESRIVFLQGHKKY-ILQATNTRTNSNDPTGEPPPQEPF--WEPGNWSHCSATCGHLG--ARIQRPQCVMANGQEVSEALCDHLQKPLAGFEPCNIRDCPARWFTSVWSQCSVSCGEGYHSRQVTCKRTKANGTVQVVSPRACAPKDRPLGRKPCFGHPCVQWEPG----NRCPGRCMG--RAVRMQQRHTACQHNSSD-SNCDDRKRPTLRRNCTSGACDVCWHTGPWKPCTAACGR-GFQSRKVDCIHTRSCKPVAKR-HCVQKKKPISWRHCLGPSCDRDCTDTTHYCMFVKHLNLCSLDRYKQRCCQSCQE 1690          

HSP 3 Score: 60.4622 bits (145), Expect = 1.512e-8
Identity = 36/120 (30.00%), Postives = 55/120 (45.83%), Query Frame = 3
Query:  417 WKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKP-KSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLVPPASWRQCFDH 773
            W+  +WS CS TCG+ G +++  +C  ++GQ V + +CD  +KP      CN  +CP  +    W +  V    C  G   R ++C      G V  +   AC  K    P   + CF H
Sbjct: 1428 WEPGNWSHCSATCGHLGARIQRPQCVMANGQEVSEALCDHLQKPLAGFEPCNIRDCPARWFTSVWSQCSV---SCGEGYHSRQVTCKRTKANGTVQVVSPRACAPKDR--PLGRKPCFGH 1542          

HSP 4 Score: 52.7582 bits (125), Expect = 3.485e-6
Identity = 33/96 (34.38%), Postives = 53/96 (55.21%), Query Frame = 3
Query:  231 EIDIWSKCSTTCGEGVQEKLQACFKKTVY-LIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVV 515
            E + W+ CS +CG G+Q +   C +++++  I  +   KC + PK KV  + CN  DC     W   +WS+C+ TCG  G++ R V C +  G+ V
Sbjct:  423 EHNPWTACSVSCGGGIQRRSFVCVEESMHGEILQVEEWKCMYAPKPKV-MQTCNLFDCPK---WIAMEWSQCTVTCG-RGLRYRVVLCINHRGEHV 513          

HSP 5 Score: 51.9878 bits (123), Expect = 5.237e-6
Identity = 45/164 (27.44%), Postives = 68/164 (41.46%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVYLIE------------NIP------MDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYH-SSGQVVDQEMCDENKKPKSL-RGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCL 674
            WS CSTTCG GVQ +   C     +                +P      ++ C+  P  +    +    D E  Y W++  ++ C+ TC   G Q     C H  + Q V+  +CD   +P ++ + CN   CPP +    W   C   + C  G Q RD+ CL
Sbjct:  573 WSACSTTCGPGVQVREVKCRVLLTFTQTETELPEEECEGPKLPTERPCLLEACDESPASR-ELDIPLPEDSETTYDWEYAGFTPCTATC-VGGHQEAIAVCLHIQTQQTVNDSLCDMVHRPPAMSQACNTEPCPPRWHVGSW-GPCS--ATCGVGIQTRDVYCL 731          
BLAST of ADAMTS-like protein 3 vs. Ensembl Human
Match: ADAMTSL3 (ADAMTS like 3 [Source:HGNC Symbol;Acc:HGNC:14633])

HSP 1 Score: 119.783 bits (299), Expect = 7.940e-27
Identity = 91/305 (29.84%), Postives = 136/305 (44.59%), Query Frame = 3
Query:  231 EIDIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYH--SSGQVVD--QEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLVPPASWRQCF----DHIDPKKCFKKSEFLPEIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWGHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIK 1121
             +  W  CS TCG G+Q +   C           P ++C    +     + CN  DC  G  W   +W +CS TCG  G Q R V C    + G  ++   E+C +  K  S + C R +CPP+    +W K  V    C  G QRR   C  L   G+ I L    C     +P    R C       I  +   K  E  P+I+S +R  +Q R  +++NL +G  +Y+ P T + + CPV+ F  S + W  K        K   R+ +T+ G L I      D G +RC+AG+  +++V+K
Sbjct:  708 HVGSWGPCSATCGVGIQTRDVYCLHPGE---TPAPPEECRD--EKPHALQACNQFDCPPG--WHIEEWQQCSRTCG-GGTQNRRVTCRQLLTDGSFLNLSDELC-QGPKASSHKSCARTDCPPHLAVGDWSKCSV---SCGVGIQRRKQVCQRLAAKGRRIPLSEMMCRDLPGLPLV--RSCQMPECSKIKSEMKTKLGEQGPQILSVQRVYIQTREEKRINLTIGSRAYLLPNTSVIIKCPVRRFQKSLIQW-EKDGRCLQNSK---RLGITKSGSLKIHGLAAPDIGVYRCIAGSAQETVVLK 994          

HSP 2 Score: 61.2326 bits (147), Expect = 7.095e-9
Identity = 84/394 (21.32%), Postives = 151/394 (38.32%), Query Frame = 3
Query:  813 PEIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWGHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGN-----ISDSIV--IKSKSPSD------GYKDWAIRNSISNKDMPNELVQLDMMQENHVRWVIGDWSQCSVSCENTGFQSRMVR---------------CESLQK---------------RFYYQL----------------------SDDECVQRVAPKPFAKRECPR------NFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEKCDSTRKPVYE--CYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSCNPPKCN 1775
            P I+S +R + +      L++ VG I     G  +T+ CPVK     N+ W  +       G     + +   G L++++  ++++G + C+A N     ++ S++  ++ + P        G+K + I  + + +   N+       QE    W  G+WS CS +C + G  +R+ R               C+ LQK               R++  +                        +  VQ V+P+  A ++ P         PC QW       N+C   C+G  +A  +       Q+ S     CD  ++P     C +  C V W    W  C+  CG+ G Q+R + C+   S  P     + +  + P   + C  P C+
Sbjct: 1284 PVILSVERNITKPEH-NHLSVVVGGIVEAALGANVTIRCPVKGVPQPNITWLKRG------GSLSGNVSLLFNGSLLLQNVSLENEGTYVCIATNALGKAVATSVLHLLERRWPESRIVFLQGHKKY-ILQATNTRTNSNDPTGEPPPQEPF--WEPGNWSHCSATCGHLG--ARIQRPQCVMANGQEVSEALCDHLQKPLAGFEPCNIRDCPARWFTSVWSQCSVSCGEGYHSRQVTCKRTKANGTVQVVSPRACAPKDRPLGRKPCFGHPCVQWEPG----NRCPGRCMG--RAVRMQQRHTACQHNSSD-SNCDDRKRPTLRRNCTSGACDVCWHTGPWKPCTAACGR-GFQSRKVDCIHTRSCKPVAKR-HCVQKKKPISWRHCLGPSCD 1656          

HSP 3 Score: 60.4622 bits (145), Expect = 1.485e-8
Identity = 36/120 (30.00%), Postives = 55/120 (45.83%), Query Frame = 3
Query:  417 WKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKP-KSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLVPPASWRQCFDH 773
            W+  +WS CS TCG+ G +++  +C  ++GQ V + +CD  +KP      CN  +CP  +    W +  V    C  G   R ++C      G V  +   AC  K    P   + CF H
Sbjct: 1428 WEPGNWSHCSATCGHLGARIQRPQCVMANGQEVSEALCDHLQKPLAGFEPCNIRDCPARWFTSVWSQCSV---SCGEGYHSRQVTCKRTKANGTVQVVSPRACAPKDR--PLGRKPCFGH 1542          

HSP 4 Score: 52.7582 bits (125), Expect = 3.227e-6
Identity = 33/96 (34.38%), Postives = 53/96 (55.21%), Query Frame = 3
Query:  231 EIDIWSKCSTTCGEGVQEKLQACFKKTVY-LIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVV 515
            E + W+ CS +CG G+Q +   C +++++  I  +   KC + PK KV  + CN  DC     W   +WS+C+ TCG  G++ R V C +  G+ V
Sbjct:  423 EHNPWTACSVSCGGGIQRRSFVCVEESMHGEILQVEEWKCMYAPKPKV-MQTCNLFDCPK---WIAMEWSQCTVTCG-RGLRYRVVLCINHRGEHV 513          

HSP 5 Score: 52.373 bits (124), Expect = 4.687e-6
Identity = 45/164 (27.44%), Postives = 68/164 (41.46%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVYLIE------------NIP------MDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYH-SSGQVVDQEMCDENKKPKSL-RGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCL 674
            WS CSTTCG GVQ +   C     +                +P      ++ C+  P  +    +    D E  Y W++  ++ C+ TC   G Q     C H  + Q V+  +CD   +P ++ + CN   CPP +    W   C   + C  G Q RD+ CL
Sbjct:  573 WSACSTTCGPGVQVREVKCRVLLTFTQTETELPEEECEGPKLPTERPCLLEACDESPASR-ELDIPLPEDSETTYDWEYAGFTPCTATC-VGGHQEAIAVCLHIQTQQTVNDSLCDMVHRPPAMSQACNTEPCPPRWHVGSW-GPCS--ATCGVGIQTRDVYCL 731          
BLAST of ADAMTS-like protein 3 vs. Ensembl Human
Match: ADAMTSL1 (ADAMTS like 1 [Source:HGNC Symbol;Acc:HGNC:14632])

HSP 1 Score: 95.9005 bits (237), Expect = 3.467e-20
Identity = 98/372 (26.34%), Postives = 156/372 (41.94%), Query Frame = 3
Query:  867 LNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWGHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIKSKSPSDGYKDWAI-RNSISNKDMPNELVQ-------LDMMQENHV----------------------RWVIGDWSQCSVSCENTGFQSRMVRCESLQKR-FYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQ-SVGLEKCDSTRKPVY--ECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWE--NSKLPAGNLCYLINLEVPQVLKSCNPPKC-NLKCVDMHPSCKRKKE--YCRMGIYSFSCCKTC 1865
            L   +G    + PG    L CP+K     N+ W H            + I    +  L + +     QGE+ CLA N +  ++ K+      Y  W++ R +  +    N  VQ       L+  + N                        RW++  WS C+ SC   G Q+R V C+ L+       +S+D C Q VA +P   + C +   C +W F +    QC   CIG   A     + C  ++  ++  E+C +  +PV    C++  C V W++S WT C+ TCG  G Q+R + CV    N  +P  +LC       P   + CN   C N++C D    C++ K+   C++  +   CC TC
Sbjct:   99 LTSPLGTQLVLDPGNSALLGCPIKGHPVPNITWFHGGQPIVTATGLTHHILAAGQ-ILQVANLSGGSQGEFSCLAQNEAGVLMQKASLVIQDYW-WSVDRLATCSASCGNRGVQQPRLRCLLNSTEVNPAHCAGKVRPAVQPIACNRRDCPSRWMVTSWSACTRSCGG-GVQTRRVTCQKLKASGISTPVSNDMCTQ-VAKRPVDTQACNQQL-CVEWAFSS--WGQCNGPCIGPHLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLWTLCTATCGNYGFQSRRVECVHARTNKAVPE-HLCSWG--PRPANWQRCNITPCENMECRDTTRYCEKVKQLKLCQLSQFKSRCCGTC 460          

HSP 2 Score: 56.9954 bits (136), Expect = 1.026e-7
Identity = 36/128 (28.12%), Postives = 55/128 (42.97%), Query Frame = 3
Query:  234 IDIWSKCSTTCGEGVQEKLQACFK-KTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTC--GYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEW 608
            +  WS C+ +CG GVQ +   C K K   +   +  D C  + K  V T+ CN   C     W F+ W +C+  C   +  +Q R+V C    G  +  E C    +P S + C    C  ++    W
Sbjct:  252 VTSWSACTRSCGGGVQTRRVTCQKLKASGISTPVSNDMCTQVAKRPVDTQACNQQLCVE---WAFSSWGQCNGPCIGPHLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLW 376          
BLAST of ADAMTS-like protein 3 vs. Ensembl Human
Match: ADAMTSL1 (ADAMTS like 1 [Source:HGNC Symbol;Acc:HGNC:14632])

HSP 1 Score: 98.2117 bits (243), Expect = 4.022e-20
Identity = 89/312 (28.53%), Postives = 130/312 (41.67%), Query Frame = 3
Query:  231 EIDIWSKCSTTCGEGVQEKLQAC-------FKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYH--SSGQVVD--QEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLVPP----ASWRQCFDHIDPKKCFKKSEFLPEIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWGHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIK 1121
            EI  WS CS TCG G+Q +   C         +TV L + +    C   PK   T + CN  +C     W    W  CS TCG  G+Q REV C    + G  ++  +  C  +K P   + C + +CP  +L  +W + C   + C  G Q R   C  +L TG    +    C      PP    +S R C      +     ++  P I + ++  +Q RR  KL+  VG  +Y+ P T + L CP +      + W  K  ++     S   + V   G L I      D G + C AG   +  VIK
Sbjct:  671 EIGKWSPCSLTCGVGLQTRDVFCSHLLSREMNETVILADEL----CRQ-PK-PSTVQACNRFNCPP--AWYPAQWQPCSRTCG-GGVQKREVLCKQRMADGSFLELPETFCSASK-PACQQACKKDDCPSEWLLSDWTE-CS--TSCGEGTQTRSAICRKMLKTGLSTVVNSTLC------PPLPFSSSIRPCMLATCARPGRPSTKHSPHIAAARKVYIQTRRQRKLHFVVGGFAYLLPKTAVVLRCPARRVRKPLITW-EKDGQHLI---SSTHVTVAPFGYLKIHRLKPSDAGVYTCSAGPAREHFVIK 959          

HSP 2 Score: 95.1301 bits (235), Expect = 3.021e-19
Identity = 98/372 (26.34%), Postives = 156/372 (41.94%), Query Frame = 3
Query:  867 LNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWGHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIKSKSPSDGYKDWAI-RNSISNKDMPNELVQ-------LDMMQENHV----------------------RWVIGDWSQCSVSCENTGFQSRMVRCESLQKR-FYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQ-SVGLEKCDSTRKPV--YECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWE--NSKLPAGNLCYLINLEVPQVLKSCNPPKC-NLKCVDMHPSCKRKKE--YCRMGIYSFSCCKTC 1865
            L   +G    + PG    L CP+K     N+ W H            + I    +  L + +     QGE+ CLA N +  ++ K+      Y  W++ R +  +    N  VQ       L+  + N                        RW++  WS C+ SC   G Q+R V C+ L+       +S+D C Q VA +P   + C +   C +W F +    QC   CIG   A     + C  ++  ++  E+C +  +PV    C++  C V W++S WT C+ TCG  G Q+R + CV    N  +P  +LC       P   + CN   C N++C D    C++ K+   C++  +   CC TC
Sbjct: 1398 LTSPLGTQLVLDPGNSALLGCPIKGHPVPNITWFHGGQPIVTATGLTHHILAAGQ-ILQVANLSGGSQGEFSCLAQNEAGVLMQKASLVIQDYW-WSVDRLATCSASCGNRGVQQPRLRCLLNSTEVNPAHCAGKVRPAVQPIACNRRDCPSRWMVTSWSACTRSC-GGGVQTRRVTCQKLKASGISTPVSNDMCTQ-VAKRPVDTQACNQQL-CVEWAFSS--WGQCNGPCIGPHLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLWTLCTATCGNYGFQSRRVECVHARTNKAVPE-HLCSWG--PRPANWQRCNITPCENMECRDTTRYCEKVKQLKLCQLSQFKSRCCGTC 1759          

HSP 3 Score: 82.4185 bits (202), Expect = 2.282e-15
Identity = 57/188 (30.32%), Postives = 91/188 (48.40%), Query Frame = 3
Query:  183 DGQSIGNRPIGKAFLEEIDIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYH------SSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYA 728
            DG   G +   + +  E + ++KCS +CG GVQE + +C  K     E    + C    +     + CN   C     W+   WS CS TCG  G+Q R+V C H      +   ++  E+C +  KP +++ CNR+NCPP +   +W + C +   C  G Q+R++ C   +  G  ++LP   C A
Sbjct:  596 DGLFGGLQDFDELYDWEYEGFTKCSESCGGGVQEAVVSCLNKQTR--EPAEENLCVTSRRPPQLLKSCNLDPCP--ARWEIGKWSPCSLTCGV-GLQTRDVFCSHLLSREMNETVILADELCRQ-PKPSTVQACNRFNCPPAWYPAQW-QPCSRT--CGGGVQKREVLCKQRMADGSFLELPETFCSA 774          

HSP 4 Score: 62.3882 bits (150), Expect = 3.782e-9
Identity = 55/169 (32.54%), Postives = 79/169 (46.75%), Query Frame = 3
Query: 1188 PNELVQLDMMQENHVRWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQ---LSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGL-EKCDSTRKPV--YECYNAECRVEWKISEWTKCSRTCGKSGIQARYLIC 1676
            P +L++   +     RW IG WS CS++C   G Q+R V C  L  R   +   L+D+ C Q   PKP   + C R F CP   +       C+  C G  + R +   + +     + L E   S  KP     C   +C  EW +S+WT+CS +CG+ G Q R  IC
Sbjct:  654 PPQLLKSCNLDPCPARWEIGKWSPCSLTC-GVGLQTRDVFCSHLLSREMNETVILADELCRQ---PKPSTVQACNR-FNCPPAWYP-AQWQPCSRTCGGGVQKREVLCKQRMADGSFLELPETFCSASKPACQQACKKDDCPSEWLLSDWTECSTSCGE-GTQTRSAIC 815          

HSP 5 Score: 59.3066 bits (142), Expect = 3.527e-8
Identity = 53/199 (26.63%), Postives = 90/199 (45.23%), Query Frame = 3
Query:  177 LFDGQSIGNRPIGKAFLEEIDIWSKCSTTCGEGVQEKLQAC-----FKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDC----------------------ENGYVWKFTDWSKCSHTCGYEGIQLREVECYH-SSGQVVDQEMCDENKKPKS-LRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLN 686
            L +G ++   P   +F+ E   WS C+ TCG G Q ++  C     F ++V    ++P+D+CE  PK   + R C  G C                      +  Y W++  ++KCS +CG  G+Q   V C +  + +  ++ +C  +++P   L+ CN   CP  +   +W    +    C  G Q RD+ C  LL+
Sbjct:  514 LEEGAAVSEEP---SFIPEA--WSACTVTCGVGTQVRIVRCQVLLSFSQSV---ADLPIDECEG-PK-PASQRACYAGPCSGEIPEFNPDETDGLFGGLQDFDELYDWEYEGFTKCSESCG-GGVQEAVVSCLNKQTREPAEENLCVTSRRPPQLLKSCNLDPCPARWEIGKWSPCSLT---CGVGLQTRDVFCSHLLS 698          

HSP 6 Score: 58.151 bits (139), Expect = 7.832e-8
Identity = 135/561 (24.06%), Postives = 210/561 (37.43%), Query Frame = 3
Query:  231 EIDIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIP---KIKVTTRVCNYGDC--ENGYV-------------WKFTDWSKCSHTCGYEGIQLREVECYHSS--GQV--VDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSL--LNTGKVIDLPRAACYAKGLVPPASWRQCFDHIDPKKCFKKSEFLPEIISEKRTLVQMRRVEKLNLQVGQISYVFPG-TRLTLNCPVKNFLSSNLIWGHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQD-----------QGEWRCLAGNISDSIVIKSKSPSDGYKDWAIRNSISNKDMPNELVQLDMMQENHVRWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCP-QWNFKNVNLNQCTDHCIGYEKARTI--GDLKCIFQNQSVGLEKCDSTRKP----VYECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSCNPPKCNLKC 1784
            E D +  CS TCG G Q     C+      +  +    C + P   K K   + CN   C   +GY              W+ T W+ CS +CG  GIQ R V C      G V  V++  C    K    + CN ++C P +LA+EW    V    C  G + R + C+    ++TG         C  K    P    +C   I P  C+K  E LP + ++     Q + +E+      + S++    +  T+ C V                         ++R+ R   L+  S  + D             +  C AG  S  I   +   +DG              +   L   D + +    W    +++CS SC   G Q  +V C  L K+      ++ CV    P P   + C  + PCP +W       + C+  C    + R +    L     N++V L   +  R+P    V  C    C   W  ++W  CSRTCG  G+Q R ++C     ++  G+      LE+P+   S + P C   C
Sbjct:  303 ETDFF-PCSATCGGGYQLTSAECYDLRSNRV--VADQYCHYYPENIKPKPKLQECNLDPCPASDGYKQIMPYDLYHPLPRWEATPWTACSSSCG-GGIQSRAVSCVEEDIQGHVTSVEEWKCMYTPKMPIAQPCNIFDC-PKWLAQEWSPCTVT---CGQGLRYRVVLCIDHRGMHTG--------GCSPK--TKPHIKEEC---IVPTPCYKPKEKLP-VEAKLPWFKQAQELEEGAAVSEEPSFIPEAWSACTVTCGV-----------------------GTQVRIVRCQVLLSFSQSVADLPIDECEGPKPASQRACYAGPCSGEIPEFNPDETDG--------------LFGGLQDFDELYD----WEYEGFTKCSESC-GGGVQEAVVSC--LNKQTREPAEENLCVTSRRP-PQLLKSCNLD-PCPARWEIG--KWSPCSLTCGVGLQTRDVFCSHLLSREMNETVILAD-ELCRQPKPSTVQACNRFNCPPAWYPAQWQPCSRTCG-GGVQKREVLC---KQRMADGSF-----LELPETFCSASKPACQQAC 783          

HSP 7 Score: 56.225 bits (134), Expect = 3.097e-7
Identity = 36/128 (28.12%), Postives = 55/128 (42.97%), Query Frame = 3
Query:  234 IDIWSKCSTTCGEGVQEKLQACFK-KTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTC--GYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEW 608
            +  WS C+ +CG GVQ +   C K K   +   +  D C  + K  V T+ CN   C     W F+ W +C+  C   +  +Q R+V C    G  +  E C    +P S + C    C  ++    W
Sbjct: 1551 VTSWSACTRSCGGGVQTRRVTCQKLKASGISTPVSNDMCTQVAKRPVDTQACNQQLCVE---WAFSSWGQCNGPCIGPHLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLW 1675          
BLAST of ADAMTS-like protein 3 vs. Ensembl Human
Match: ADAMTS9 (ADAM metallopeptidase with thrombospondin type 1 motif 9 [Source:HGNC Symbol;Acc:HGNC:13202])

HSP 1 Score: 88.5817 bits (218), Expect = 2.453e-17
Identity = 131/524 (25.00%), Postives = 201/524 (38.36%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVYLI--------ENIPMD--KCE----HIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLVPPASWRQCFDHIDPKKC---------FKKSEFLPEIISEKRTLVQMRRVEKLNLQVGQISYVFPGT-RLTLNCPVKNFLSSNLIWGHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEW----RCLAGNISDSIVIKSKSPSDGYKDWAIRNSISNKDMPNELVQLDMMQENH-VRWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLE-KCDSTRKPVYE--CYNAECRV-EWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLC 1715
            W +CS TCG+G Q +   C   T   +           P D   CE    H P     TR   Y        W+F  W+ CS TCG +G ++R V C   +G V D+  C    +P +   C+   C   + A +W    V    C  G+  R + C++  +   VID  R+ C    +  P + + C     P++          F+  ++ P   S  RT V      +        S    G+ R  + C  +N  ++N       +E        +  R    G     ++     G W    +   G I   +V+  +S  + + D     S    D P +  Q +     H   W  G WS CSVSC   G + R V C     +    L  D C      KP   R+C R   CP+W  K    +QC+  C    + R +G   C      +  E +C+   +P  E  C    C +  W+  EW +C++TCG+ G + R ++CV +N     G  C
Sbjct:  172 WGQCSVTCGQGYQLRAVKCIIGTYMSVVDDNDCNAATRPTDTQDCELPSCHPPPAAPETRRSTYSAPRT--QWRFGSWTPCSATCG-KGTRMRYVSCRDENGSVADESACATLPRPVAKEECSVTPCG-QWKALDWSSCSVT---CGQGRATRQVMCVNYSD--HVID--RSECDQDYI--PETDQDCSMSPCPQRTPDSGLAQHPFQNEDYRPRSASPSRTHVLGGNQWRTGPWGACSSTCAGGSQRRVVVCQDENGYTANDC-----VERI----KPDEQRACESGPCPQWAY-----GNWGECTKLCGGGIRTRLVVCQRSNGERFPDL----SCEILDKPPDREQCNTHACPHDAAWSTGPWSSCSVSC-GRGHKQRNVYC---MAKDGSHLESDYCKHLA--KPHGHRKC-RGGRCPKW--KAGAWSQCSVSCGRGVQQRHVG---CQIGTHKIARETECNPYTRPESERDCQGPRCPLYTWRAEEWQECTKTCGE-GSRYRKVVCVDDNKNEVHGARC 651          

HSP 2 Score: 84.7297 bits (208), Expect = 4.222e-16
Identity = 131/537 (24.39%), Postives = 213/537 (39.66%), Query Frame = 3
Query:  240 IWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSC-----LSLLNTGKVIDLPRAA----CYAKGLVPPASWRQC--FDHIDPKKCFKKSEFLP-EIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWGH-KKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNI--SDSIVIKSKSPSDGYKDWAIRNSISNKDM-PNELVQLDMMQENHVRWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTI----------GDLKCIFQNQSVGLEKCDSTRKPVYECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSCNPPKC 1772
             W++CS +C  G Q +   C      ++++    KC H  + KVT + C+   C     WK  DWS+C  TCG +G + R+V C     ++ D+ MCD   KP S++ C +  C  ++ A  W +  V    C  G Q R + C     +S+++        R      C      PP +  +     +  P+  ++   + P      K T ++       N  V   S        TL  PV     S    G  K +++     +  + R TR+   +  S  + D+ E  C    I  +D     S  P         ++   N+D  P              +W  G W  CS +C   G Q R+V C   Q    Y  +D  CV+R+  KP  +R C  + PCPQW +   N  +CT  C G  + R +           DL C   ++    E+C++   P    ++A     W    W+ CS +CG+ G + R + C+ ++      + C   +L  P   + C   +C
Sbjct:   61 AWTECSKSCDGGTQRRRAICVNTRNDVLDD---SKCTH--QEKVTIQRCSEFPCPQ---WKSGDWSECLVTCG-KGHKHRQVWCQFGEDRLNDR-MCDPETKPTSMQTCQQPEC-ASWQAGPWGQCSVT---CGQGYQLRAVKCIIGTYMSVVDDNDCNAATRPTDTQDCELPSCHPPPAAPETRRSTYSAPRTQWRFGSWTPCSATCGKGTRMRYVSCRDENGSVADESAC-----ATLPRPVAKEECSVTPCGQWKALDWSSCSVTCGQGRATRQVMCVNYSDHVIDRSE--CDQDYIPETDQDCSMSPCPQRTPDSGLAQHPFQNEDYRPRSASPSRTHVLGGNQWRTGPWGACSSTCAG-GSQRRVVVC---QDENGYTAND--CVERI--KPDEQRAC-ESGPCPQWAYG--NWGECTKLCGGGIRTRLVVCQRSNGERFPDLSCEILDKPPDREQCNTHACP----HDA----AWSTGPWSSCSVSCGR-GHKQRNVYCMAKDGSHLESDYCK--HLAKPHGHRKCRGGRC 554          

HSP 3 Score: 58.151 bits (139), Expect = 6.045e-8
Identity = 49/153 (32.03%), Postives = 74/153 (48.37%), Query Frame = 3
Query: 1233 RWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKREC--PRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQS-VGLEKCDSTRKPV--YECYNAECRVEWKISEWTKCSRTCGKSGIQARYLIC 1676
            +W  G WSQCSVSC   G Q R V C+    +   +    EC      +P ++R+C  PR   CP + ++     +CT  C    + R +    C+  N++ V   +CD +++PV    C    C   W   EW++CS TCGK G + R + C
Sbjct:  556 KWKAGAWSQCSVSC-GRGVQQRHVGCQIGTHKIARET---ECNPYT--RPESERDCQGPR---CPLYTWRAEEWQECTKTCGEGSRYRKV---VCVDDNKNEVHGARCDVSKRPVDRESCSLQPCEYVWITGEWSECSVTCGK-GYKQRLVSC 695          

HSP 4 Score: 57.7658 bits (138), Expect = 8.647e-8
Identity = 47/156 (30.13%), Postives = 71/156 (45.51%), Query Frame = 3
Query:  240 IWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENG----YVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGK 695
             WS+CS +CG GVQ++   C          I   K     +    TR  +  DC+      Y W+  +W +C+ TCG EG + R+V C   +   V    CD +K+P     C+   C   ++  EW +  V    C  G ++R +SC S + TGK
Sbjct:  561 AWSQCSVSCGRGVQQRHVGC---------QIGTHKIARETECNPYTRPESERDCQGPRCPLYTWRAEEWQECTKTCG-EGSRYRKVVCVDDNKNEVHGARCDVSKRPVDRESCSLQPCEYVWITGEWSECSVT---CGKGYKQRLVSC-SEIYTGK 702          

HSP 5 Score: 51.2174 bits (121), Expect = 8.904e-6
Identity = 46/154 (29.87%), Postives = 67/154 (43.51%), Query Frame = 3
Query: 1224 NHVRWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEKCDSTRKP--VYECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICV 1679
            N   W    W++CS SC+  G Q R   C + +      L D +C  +   +    + C   FPCPQW  K+ + ++C   C    K R +    C F    +    CD   KP  +  C   EC   W+   W +CS TCG+ G Q R + C+
Sbjct:   53 NTGGWRYSAWTECSKSCDG-GTQRRRAICVNTRNDV---LDDSKCTHQ---EKVTIQRC-SEFPCPQW--KSGDWSECLVTCGKGHKHRQV---WCQFGEDRLNDRMCDPETKPTSMQTCQQPEC-ASWQAGPWGQCSVTCGQ-GYQLRAVKCI 191          
BLAST of ADAMTS-like protein 3 vs. Ensembl Celegans
Match: madd-4 (pep chromosome:WBcel235:I:8931035:8937718:-1 gene:WBGene00009958.1 transcript:F53B6.2b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:madd-4)

HSP 1 Score: 148.673 bits (374), Expect = 6.530e-37
Identity = 155/629 (24.64%), Postives = 247/629 (39.27%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVYLIEN----IPMDKCEHIPKIKV----TTRVC------NYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYH-SSGQVVDQEMCDENKKP-KSLRGCNRYNCPPNFLAKEWKKKCVKISDCS----PGQQRRDLSCLSLLNTGKVIDL-------------PRAACYAKGLVPPASW------------------RQ-------------------CFDHIDPKK---CFKKSEFLPEIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIW--GHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIKSKSPSDGYKDWAI------------------RNSISNKDMPNE-----------LVQLDMMQENH---------------VRWVIGDWSQC-SVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDH-CIGYEKARTIGDLKCIFQN-QSVGLEKCDSTRKPV--YECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSC 1757
            WS CS+TCG GV  +   C    V  I +    +PM +C+   + K+      R C         + E  Y W++ DW++CS +C   G Q   ++C   S+G+ V    CD  ++P +  R CN++ CPP +L         K SDCS     G  RR + C   ++     D              P+       +  PA+W                  RQ                   C  +  P+    C   S   PE++S  R   Q    +KL L +G ++ ++ GT + + CP K F    + W    KKI      K+   I+V+  G L +    ++D G + C    +  ++ +  K     Y+D+                    R  +S +D+  E           L++  +   N                 RW IG WS+C   +C   G+Q+R + C+         + +  C    + +P   R C R   CP+W       ++C+   C+    A+   ++ C F N  SV ++ CD T +P    +C N  C+ EW+ S+W  CS  CG  G+Q R L CVW +S  PAG  C    +  P   ++C
Sbjct:   50 WSTCSSTCGTGVMSRTVECV--AVNPISSAPIKLPMSECQDQEQPKLFESCEVRSCPLQEDSKLSEDEAPYQWRYGDWTQCSASC-LGGKQKAALKCIQVSTGKSVQWSQCDARRRPPEKSRPCNQHPCPPFWLTS-------KYSDCSMSCGSGTARRSVKCAQTVSKTDGADAHIVLRDDRCHFKKPQETETCNVVACPATWVTAQWTECSRSCDSGERRRQVWCEIRDSRGKTQRRPDVECDANTKPQTVEVCSFGSCSRPELLS-NRVFEQNAEQKKLTLGIGGVATLYQGTSIKIKCPAKKFDKKKIYWKKNGKKI------KNDAHIKVSANGNLRVFHARMEDAGVYECFTDRLQGNVTLNFK-----YRDFPASRVDLAPKPQIPSTKNRQRVQVSKEDVLREQASVLHKMNVSLIEALLTAPNDEKAREQLRKYGNELVARWDIGHWSECRQKTCHVAGYQARGISCKVTFHGEIRNVDNSICESLASVRPPETRPCHRE-DCPRWEASQ--WSECSSQRCVSSMLAQKRRNVTCRFTNGTSVDIQHCDITNRPATTMDCPNQNCKAEWRTSDWGSCSSECGTGGVQLRLLSCVWISSGRPAGRNCE--QMRRPHSARAC 651          

HSP 2 Score: 57.3806 bits (137), Expect = 3.635e-8
Identity = 60/212 (28.30%), Postives = 90/212 (42.45%), Query Frame = 3
Query: 1221 ENHVRW-----VIGDWSQCSVSCENTGFQSRMVRCESLQ--KRFYYQLSDDECVQRVAPKPFAK---RECP--------RNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCI--FQNQSVGLEKCDSTRKPVYE---CYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLI-----NLEVPQVLKSCNPPKC 1772
            +NH  W     V G+WS CS +C  TG  SR V C ++        +L   EC  +  PK F     R CP         +    QW +   +  QC+  C+G    +    LKCI     +SV   +CD+ R+P  +   C    C   W  S+++ CS +CG SG   R + C    SK    +   ++     + + PQ  ++CN   C
Sbjct:   35 DNHNDWQAPRLVAGEWSTCSSTC-GTGVMSRTVECVAVNPISSAPIKLPMSECQDQEQPKLFESCEVRSCPLQEDSKLSEDEAPYQWRYG--DWTQCSASCLG---GKQKAALKCIQVSTGKSVQWSQCDARRRPPEKSRPCNQHPCPPFWLTSKYSDCSMSCG-SGTARRSVKCAQTVSKTDGADAHIVLRDDRCHFKKPQETETCNVVAC 239          
BLAST of ADAMTS-like protein 3 vs. Ensembl Celegans
Match: madd-4 (pep chromosome:WBcel235:I:8931035:8942287:-1 gene:WBGene00009958.1 transcript:F53B6.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:madd-4)

HSP 1 Score: 149.058 bits (375), Expect = 1.222e-36
Identity = 154/627 (24.56%), Postives = 244/627 (38.92%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVYLIENI--PMDKCEHIPKIKV----TTRVC------NYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYH-SSGQVVDQEMCDENKKP-KSLRGCNRYNCPPNFLAKEWKKKCVKISDCS----PGQQRRDLSCLSLLNTGKVIDL-------------PRAACYAKGLVPPASW------------------RQ-------------------CFDHIDPKK---CFKKSEFLPEIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIW--GHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIKSKSPSDGYKDWAI------------------RNSISNKDMPNE-----------LVQLDMMQENH---------------VRWVIGDWSQC-SVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDH-CIGYEKARTIGDLKCIFQN-QSVGLEKCDSTRKPV--YECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSC 1757
            WS CS+TCG GV  +   C          I  PM +C+   + K+      R C         + E  Y W++ DW++CS +C   G Q   ++C   S+G+ V    CD  ++P +  R CN++ CPP +L         K SDCS     G  RR + C   ++     D              P+       +  PA+W                  RQ                   C  +  P+    C   S   PE++S  R   Q    +KL L +G ++ ++ GT + + CP K F    + W    KKI      K+   I+V+  G L +    ++D G + C    +  ++ +  K     Y+D+                    R  +S +D+  E           L++  +   N                 RW IG WS+C   +C   G+Q+R + C+         + +  C    + +P   R C R   CP+W       ++C+   C+    A+   ++ C F N  SV ++ CD T +P    +C N  C+ EW+ S+W  CS  CG  G+Q R L CVW +S  PAG  C    +  P   ++C
Sbjct:  384 WSTCSSTCGTGVMSRTVECVAVNPISSAPIKLPMSECQDQEQPKLFESCEVRSCPLQEDSKLSEDEAPYQWRYGDWTQCSASC-LGGKQKAALKCIQVSTGKSVQWSQCDARRRPPEKSRPCNQHPCPPFWLTS-------KYSDCSMSCGSGTARRSVKCAQTVSKTDGADAHIVLRDDRCHFKKPQETETCNVVACPATWVTAQWTECSRSCDSGERRRQVWCEIRDSRGKTQRRPDVECDANTKPQTVEVCSFGSCSRPELLS-NRVFEQNAEQKKLTLGIGGVATLYQGTSIKIKCPAKKFDKKKIYWKKNGKKI------KNDAHIKVSANGNLRVFHARMEDAGVYECFTDRLQGNVTLNFK-----YRDFPASRVDLAPKPQIPSTKNRQRVQVSKEDVLREQASVLHKMNVSLIEALLTAPNDEKAREQLRKYGNELVARWDIGHWSECRQKTCHVAGYQARGISCKVTFHGEIRNVDNSICESLASVRPPETRPCHRE-DCPRWEASQ--WSECSSQRCVSSMLAQKRRNVTCRFTNGTSVDIQHCDITNRPATTMDCPNQNCKAEWRTSDWGSCSSECGTGGVQLRLLSCVWISSGRPAGRNCE--QMRRPHSARAC 985          

HSP 2 Score: 56.9954 bits (136), Expect = 5.526e-8
Identity = 60/212 (28.30%), Postives = 90/212 (42.45%), Query Frame = 3
Query: 1221 ENHVRW-----VIGDWSQCSVSCENTGFQSRMVRCESLQ--KRFYYQLSDDECVQRVAPKPFAK---RECP--------RNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCI--FQNQSVGLEKCDSTRKPVYE---CYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLI-----NLEVPQVLKSCNPPKC 1772
            +NH  W     V G+WS CS +C  TG  SR V C ++        +L   EC  +  PK F     R CP         +    QW +   +  QC+  C+G    +    LKCI     +SV   +CD+ R+P  +   C    C   W  S+++ CS +CG SG   R + C    SK    +   ++     + + PQ  ++CN   C
Sbjct:  369 DNHNDWQAPRLVAGEWSTCSSTC-GTGVMSRTVECVAVNPISSAPIKLPMSECQDQEQPKLFESCEVRSCPLQEDSKLSEDEAPYQWRYG--DWTQCSASCLG---GKQKAALKCIQVSTGKSVQWSQCDARRRPPEKSRPCNQHPCPPFWLTSKYSDCSMSCG-SGTARRSVKCAQTVSKTDGADAHIVLRDDRCHFKKPQETETCNVVAC 573          
BLAST of ADAMTS-like protein 3 vs. Ensembl Celegans
Match: madd-4 (pep chromosome:WBcel235:I:8931035:8942287:-1 gene:WBGene00009958.1 transcript:F53B6.2c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:madd-4)

HSP 1 Score: 149.058 bits (375), Expect = 1.378e-36
Identity = 154/627 (24.56%), Postives = 244/627 (38.92%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVYLIENI--PMDKCEHIPKIKV----TTRVC------NYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYH-SSGQVVDQEMCDENKKP-KSLRGCNRYNCPPNFLAKEWKKKCVKISDCS----PGQQRRDLSCLSLLNTGKVIDL-------------PRAACYAKGLVPPASW------------------RQ-------------------CFDHIDPKK---CFKKSEFLPEIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIW--GHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIKSKSPSDGYKDWAI------------------RNSISNKDMPNE-----------LVQLDMMQENH---------------VRWVIGDWSQC-SVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDH-CIGYEKARTIGDLKCIFQN-QSVGLEKCDSTRKPV--YECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSC 1757
            WS CS+TCG GV  +   C          I  PM +C+   + K+      R C         + E  Y W++ DW++CS +C   G Q   ++C   S+G+ V    CD  ++P +  R CN++ CPP +L         K SDCS     G  RR + C   ++     D              P+       +  PA+W                  RQ                   C  +  P+    C   S   PE++S  R   Q    +KL L +G ++ ++ GT + + CP K F    + W    KKI      K+   I+V+  G L +    ++D G + C    +  ++ +  K     Y+D+                    R  +S +D+  E           L++  +   N                 RW IG WS+C   +C   G+Q+R + C+         + +  C    + +P   R C R   CP+W       ++C+   C+    A+   ++ C F N  SV ++ CD T +P    +C N  C+ EW+ S+W  CS  CG  G+Q R L CVW +S  PAG  C    +  P   ++C
Sbjct:  382 WSTCSSTCGTGVMSRTVECVAVNPISSAPIKLPMSECQDQEQPKLFESCEVRSCPLQEDSKLSEDEAPYQWRYGDWTQCSASC-LGGKQKAALKCIQVSTGKSVQWSQCDARRRPPEKSRPCNQHPCPPFWLTS-------KYSDCSMSCGSGTARRSVKCAQTVSKTDGADAHIVLRDDRCHFKKPQETETCNVVACPATWVTAQWTECSRSCDSGERRRQVWCEIRDSRGKTQRRPDVECDANTKPQTVEVCSFGSCSRPELLS-NRVFEQNAEQKKLTLGIGGVATLYQGTSIKIKCPAKKFDKKKIYWKKNGKKI------KNDAHIKVSANGNLRVFHARMEDAGVYECFTDRLQGNVTLNFK-----YRDFPASRVDLAPKPQIPSTKNRQRVQVSKEDVLREQASVLHKMNVSLIEALLTAPNDEKAREQLRKYGNELVARWDIGHWSECRQKTCHVAGYQARGISCKVTFHGEIRNVDNSICESLASVRPPETRPCHRE-DCPRWEASQ--WSECSSQRCVSSMLAQKRRNVTCRFTNGTSVDIQHCDITNRPATTMDCPNQNCKAEWRTSDWGSCSSECGTGGVQLRLLSCVWISSGRPAGRNCE--QMRRPHSARAC 983          

HSP 2 Score: 56.9954 bits (136), Expect = 5.523e-8
Identity = 60/212 (28.30%), Postives = 90/212 (42.45%), Query Frame = 3
Query: 1221 ENHVRW-----VIGDWSQCSVSCENTGFQSRMVRCESLQ--KRFYYQLSDDECVQRVAPKPFAK---RECP--------RNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCI--FQNQSVGLEKCDSTRKPVYE---CYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLI-----NLEVPQVLKSCNPPKC 1772
            +NH  W     V G+WS CS +C  TG  SR V C ++        +L   EC  +  PK F     R CP         +    QW +   +  QC+  C+G    +    LKCI     +SV   +CD+ R+P  +   C    C   W  S+++ CS +CG SG   R + C    SK    +   ++     + + PQ  ++CN   C
Sbjct:  367 DNHNDWQAPRLVAGEWSTCSSTC-GTGVMSRTVECVAVNPISSAPIKLPMSECQDQEQPKLFESCEVRSCPLQEDSKLSEDEAPYQWRYG--DWTQCSASCLG---GKQKAALKCIQVSTGKSVQWSQCDARRRPPEKSRPCNQHPCPPFWLTSKYSDCSMSCG-SGTARRSVKCAQTVSKTDGADAHIVLRDDRCHFKKPQETETCNVVAC 571          
BLAST of ADAMTS-like protein 3 vs. Ensembl Celegans
Match: gon-1 (A disintegrin and metalloproteinase with thrombospondin motifs gon-1 [Source:UniProtKB/Swiss-Prot;Acc:Q19791])

HSP 1 Score: 80.8777 bits (198), Expect = 3.166e-15
Identity = 136/551 (24.68%), Postives = 216/551 (39.20%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSS-GQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKI-----------SDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLVPPASWRQCFDHIDPKKCFKKSEFLPEIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWGHKKIEYFYKGKSKN-RIRVTRKGKLIIKSFLIQDQGEW-RCLAGNISDSIVIKSKSPSDGYKDWAIRNSISNKDMPNELVQLDMMQE------NHVRWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPC------------------------------------PQWNFKNVNLNQCTDHCIGYEKARTIGDLKCI--FQNQSVGLEKCDSTRKPVYE--CYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLC 1715
            WS CS +CG G +E+   C    +Y  +++    C    K+  T++ C+   C +   WK + WS CS TCG  GIQ R V C   S G +VD+  CD N +P+  + C +  C    + ++ +     I           + C  G QRR L C        V DLP    Y   L    S R C   +     +K +E+     +    + Q R V  ++ + G  + +       ++C V+   +S                ++N R+    KG+  I S++I   G+W +C            S S   G++  ++  + S+ D   +    D   E       +  W I  W+ CSVSC   G Q R + CE +      +  D EC +    KP  +R+C    PC                                    P  +++    + C+  C    K R +   +C+    N +V   +CD T+KPV E  C    C   WK + W+ CS TCG+ GI+ R + C      L + + C
Sbjct: 1234 WSACSVSCGIGHRERTTEC----IYREQSVDASFCGDT-KMPETSQTCHLLPCTS---WKPSHWSPCSVTCG-SGIQTRSVSCTRGSEGTIVDEYFCDRNTRPRLKKTCEKDTCDGPRVLQKLQADVPPIRWATGPWTACSATCGNGTQRRLLKCRD-----HVRDLPDE--YCNHLDKEVSTRNC--RLRDCSYWKMAEWEECPATCGTHVQQSRNVTCVSAEDGGRTIL-----KDVDCDVQKRPTS----------------ARNCRLEPCPKGEEHIGSWII---GDWSKC------------SASCGGGWRRRSVSCTSSSCDETRKPKMFDKCNEELCPPLTNNSWQISPWTHCSVSC-GGGVQRRKIWCEDVLSG--RKQDDIECSE---IKPREQRDCEMP-PCRSHYHNKTSSASMTSLSSSNSNTTSSASASSLPILPPVVSWQTSAWSACSAKCGRGTKRRVV---ECVNPSLNVTVASTECDQTKKPVEEVRCRTKHC-PRWKTTTWSSCSVTCGR-GIRRREVQCYRGRKNLVSDSEC 1718          

HSP 2 Score: 76.2554 bits (186), Expect = 7.880e-14
Identity = 47/156 (30.13%), Postives = 71/156 (45.51%), Query Frame = 3
Query:  240 IWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDL 707
             WS CS TCG G++ +   C++    L+ +      E  PK K+ +    +      Y W  T WSKC   C     Q R V C  +SG+     MC+  + P S+R C+  NCP  ++  +W + C K   C  G Q R++ C   +N    I +
Sbjct: 1686 TWSSCSVTCGRGIRRREVQCYRGRKNLVSD-----SECNPKTKLNSVANCFPVACPAYRWNVTPWSKCKDECARGQKQTRRVHCISTSGKRAAPRMCELARAPTSIRECDTSNCPYEWVPGDW-QTCSK--SCGEGVQTREVRCRRKINFNSTIPI 1833          

HSP 3 Score: 72.0182 bits (175), Expect = 1.582e-12
Identity = 47/142 (33.10%), Postives = 75/142 (52.82%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKT--------VYLIEN---IPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISD 635
            W  CS +CGEGVQ +   C +K         ++++E+   +P +KCE  PK    ++ C    C++ + W F  W +CS  CG +GI+ R V+C  + G+ V++  C   KKP+  + C   NC P+   +E K + VK  D
Sbjct: 1803 WQTCSKSCGEGVQTREVRCRRKINFNSTIPIIFMLEDEPAVPKEKCELFPKPN-ESQTCELNPCDSEFKWSFGPWGECSKNCG-QGIRRRRVKCVANDGRRVERVKC-TTKKPRRTQYCFERNCLPS-TCQELKSQNVKAKD 1940          

HSP 4 Score: 65.0846 bits (157), Expect = 2.160e-10
Identity = 52/151 (34.44%), Postives = 74/151 (49.01%), Query Frame = 3
Query: 1233 RWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEKCDSTRKP--VYECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICV 1679
            ++ +G+WSQCSVSCE+ G+ SR V C S          D       + +P + + C     CP W  +N + + C+  C    + RT    +CI++ QSV    C  T+ P     C+   C   WK S W+ CS TCG SGIQ R + C 
Sbjct: 1171 KYKLGEWSQCSVSCED-GWSSRRVSCVSGNGTEV----DMSLCGTASDRPASHQTCNLG-TCPFW--RNTDWSACSVSCGIGHRERTT---ECIYREQSVDASFCGDTKMPETSQTCHLLPC-TSWKPSHWSPCSVTCG-SGIQTRSVSCT 1308          

HSP 5 Score: 59.3066 bits (142), Expect = 1.135e-8
Identity = 55/179 (30.73%), Postives = 77/179 (43.02%), Query Frame = 3
Query:  231 EIDIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQ-QRRDLSCLSLLNTGKVIDLPRAACYAKGLVPPASWRQC 764
            +   WS CS  CG G + ++  C   ++ +   +   +C+   K     R C    C     WK T WS CS TCG  GI+ REV+CY     +V    C+   K  S+  C    CP          KC    +C+ GQ Q R + C+S   +GK    PR    A+    P S R+C
Sbjct: 1626 QTSAWSACSAKCGRGTKRRVVECVNPSLNVT--VASTECDQTKKPVEEVR-CRTKHCPR---WKTTTWSSCSVTCG-RGIRRREVQCYRGRKNLVSDSECNPKTKLNSVANCFPVACPAYRWNVTPWSKCK--DECARGQKQTRRVHCIS--TSGKRA-APRMCELARA---PTSIREC 1789          

HSP 6 Score: 55.8398 bits (133), Expect = 1.316e-7
Identity = 43/149 (28.86%), Postives = 66/149 (44.30%), Query Frame = 3
Query:  246 SKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHI--PKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLN 686
            S CS  CG G + +  +C K    +  +      EH+     K +     Y DC +G  W + +W+ CS TCG  G   R+  C   S + VD+ +C   +K  + R CNR  C P ++   W  +C +   C  G + R   CL   +
Sbjct:  953 SSCSAKCGSGQKRQRVSCVK----MEGDRQTPASEHLCDRNSKPSDIASCYIDC-SGRKWNYGEWTSCSETCGSNGKMHRKSYCVDDSNRRVDESLCGREQKEATERECNRIPC-PRWVYGHW-SECSR--SCDGGVKMRHAQCLDAAD 1092          

HSP 7 Score: 55.4546 bits (132), Expect = 1.960e-7
Identity = 43/149 (28.86%), Postives = 68/149 (45.64%), Query Frame = 3
Query:  231 EIDIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCD-ENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCL 674
            +  +WS CS  CG+GVQ +   C  +   +   +P  +C  + KI   T+ C+   C     +K  +WS+CS +C  +G   R V C   +G  VD  +C   + +P S + CN   C P +   +W    V    C  G + R   C+
Sbjct: 1118 QFGVWSDCSAKCGDGVQYRDANCTDRHRSV---LPEHRCLKMEKI--ITKPCHRESCPK---YKLGEWSQCSVSC-EDGWSSRRVSCVSGNGTEVDMSLCGTASDRPASHQTCNLGTC-PFWRNTDWSACSVS---CGIGHRERTTECI 1253          

HSP 8 Score: 55.4546 bits (132), Expect = 1.960e-7
Identity = 49/165 (29.70%), Postives = 74/165 (44.85%), Query Frame = 3
Query: 1233 RWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFP--CPQWNFKNVNLNQCTDHCI-GYEKARTIGDLKCI-FQNQSVGLEKCDSTRKP--VYECYNAECRVEWKISEWTKCSRTCGKSGIQARYLIC---VWENSKLP 1700
            RW    WS CSV+C   G + R V+C   +K     +SD EC  +      A       FP  CP + +     ++C D C  G ++ R +    CI    +      C+  R P  + EC  + C  EW   +W  CS++CG+ G+Q R + C   +  NS +P
Sbjct: 1681 RWKTTTWSSCSVTC-GRGIRRREVQCYRGRKNL---VSDSECNPKTKLNSVAN-----CFPVACPAYRWNVTPWSKCKDECARGQKQTRRV---HCISTSGKRAAPRMCELARAPTSIRECDTSNCPYEWVPGDWQTCSKSCGE-GVQTREVRCRRKINFNSTIP 1832          
BLAST of ADAMTS-like protein 3 vs. Ensembl Celegans
Match: gon-1 (A disintegrin and metalloproteinase with thrombospondin motifs gon-1 [Source:UniProtKB/Swiss-Prot;Acc:Q19791])

HSP 1 Score: 80.4925 bits (197), Expect = 3.988e-15
Identity = 136/551 (24.68%), Postives = 216/551 (39.20%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSS-GQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKI-----------SDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLVPPASWRQCFDHIDPKKCFKKSEFLPEIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWGHKKIEYFYKGKSKN-RIRVTRKGKLIIKSFLIQDQGEW-RCLAGNISDSIVIKSKSPSDGYKDWAIRNSISNKDMPNELVQLDMMQE------NHVRWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPC------------------------------------PQWNFKNVNLNQCTDHCIGYEKARTIGDLKCI--FQNQSVGLEKCDSTRKPVYE--CYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLC 1715
            WS CS +CG G +E+   C    +Y  +++    C    K+  T++ C+   C +   WK + WS CS TCG  GIQ R V C   S G +VD+  CD N +P+  + C +  C    + ++ +     I           + C  G QRR L C        V DLP    Y   L    S R C   +     +K +E+     +    + Q R V  ++ + G  + +       ++C V+   +S                ++N R+    KG+  I S++I   G+W +C            S S   G++  ++  + S+ D   +    D   E       +  W I  W+ CSVSC   G Q R + CE +      +  D EC +    KP  +R+C    PC                                    P  +++    + C+  C    K R +   +C+    N +V   +CD T+KPV E  C    C   WK + W+ CS TCG+ GI+ R + C      L + + C
Sbjct: 1249 WSACSVSCGIGHRERTTEC----IYREQSVDASFCGDT-KMPETSQTCHLLPCTS---WKPSHWSPCSVTCG-SGIQTRSVSCTRGSEGTIVDEYFCDRNTRPRLKKTCEKDTCDGPRVLQKLQADVPPIRWATGPWTACSATCGNGTQRRLLKCRD-----HVRDLPDE--YCNHLDKEVSTRNC--RLRDCSYWKMAEWEECPATCGTHVQQSRNVTCVSAEDGGRTIL-----KDVDCDVQKRPTS----------------ARNCRLEPCPKGEEHIGSWII---GDWSKC------------SASCGGGWRRRSVSCTSSSCDETRKPKMFDKCNEELCPPLTNNSWQISPWTHCSVSC-GGGVQRRKIWCEDVLSG--RKQDDIECSE---IKPREQRDCEMP-PCRSHYHNKTSSASMTSLSSSNSNTTSSASASSLPILPPVVSWQTSAWSACSAKCGRGTKRRVV---ECVNPSLNVTVASTECDQTKKPVEEVRCRTKHC-PRWKTTTWSSCSVTCGR-GIRRREVQCYRGRKNLVSDSEC 1733          

HSP 2 Score: 76.2554 bits (186), Expect = 8.736e-14
Identity = 47/156 (30.13%), Postives = 71/156 (45.51%), Query Frame = 3
Query:  240 IWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDL 707
             WS CS TCG G++ +   C++    L+ +      E  PK K+ +    +      Y W  T WSKC   C     Q R V C  +SG+     MC+  + P S+R C+  NCP  ++  +W + C K   C  G Q R++ C   +N    I +
Sbjct: 1701 TWSSCSVTCGRGIRRREVQCYRGRKNLVSD-----SECNPKTKLNSVANCFPVACPAYRWNVTPWSKCKDECARGQKQTRRVHCISTSGKRAAPRMCELARAPTSIRECDTSNCPYEWVPGDW-QTCSK--SCGEGVQTREVRCRRKINFNSTIPI 1848          

HSP 3 Score: 72.0182 bits (175), Expect = 1.667e-12
Identity = 47/142 (33.10%), Postives = 75/142 (52.82%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKT--------VYLIEN---IPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISD 635
            W  CS +CGEGVQ +   C +K         ++++E+   +P +KCE  PK    ++ C    C++ + W F  W +CS  CG +GI+ R V+C  + G+ V++  C   KKP+  + C   NC P+   +E K + VK  D
Sbjct: 1818 WQTCSKSCGEGVQTREVRCRRKINFNSTIPIIFMLEDEPAVPKEKCELFPKPN-ESQTCELNPCDSEFKWSFGPWGECSKNCG-QGIRRRRVKCVANDGRRVERVKC-TTKKPRRTQYCFERNCLPS-TCQELKSQNVKAKD 1955          

HSP 4 Score: 65.0846 bits (157), Expect = 2.256e-10
Identity = 52/151 (34.44%), Postives = 74/151 (49.01%), Query Frame = 3
Query: 1233 RWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEKCDSTRKP--VYECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICV 1679
            ++ +G+WSQCSVSCE+ G+ SR V C S          D       + +P + + C     CP W  +N + + C+  C    + RT    +CI++ QSV    C  T+ P     C+   C   WK S W+ CS TCG SGIQ R + C 
Sbjct: 1186 KYKLGEWSQCSVSCED-GWSSRRVSCVSGNGTEV----DMSLCGTASDRPASHQTCNLG-TCPFW--RNTDWSACSVSCGIGHRERTT---ECIYREQSVDASFCGDTKMPETSQTCHLLPC-TSWKPSHWSPCSVTCG-SGIQTRSVSCT 1323          

HSP 5 Score: 59.3066 bits (142), Expect = 1.258e-8
Identity = 55/179 (30.73%), Postives = 77/179 (43.02%), Query Frame = 3
Query:  231 EIDIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQ-QRRDLSCLSLLNTGKVIDLPRAACYAKGLVPPASWRQC 764
            +   WS CS  CG G + ++  C   ++ +   +   +C+   K     R C    C     WK T WS CS TCG  GI+ REV+CY     +V    C+   K  S+  C    CP          KC    +C+ GQ Q R + C+S   +GK    PR    A+    P S R+C
Sbjct: 1641 QTSAWSACSAKCGRGTKRRVVECVNPSLNVT--VASTECDQTKKPVEEVR-CRTKHCPR---WKTTTWSSCSVTCG-RGIRRREVQCYRGRKNLVSDSECNPKTKLNSVANCFPVACPAYRWNVTPWSKCK--DECARGQKQTRRVHCIS--TSGKRA-APRMCELARA---PTSIREC 1804          

HSP 6 Score: 55.8398 bits (133), Expect = 1.446e-7
Identity = 43/149 (28.86%), Postives = 66/149 (44.30%), Query Frame = 3
Query:  246 SKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHI--PKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLN 686
            S CS  CG G + +  +C K    +  +      EH+     K +     Y DC +G  W + +W+ CS TCG  G   R+  C   S + VD+ +C   +K  + R CNR  C P ++   W  +C +   C  G + R   CL   +
Sbjct:  968 SSCSAKCGSGQKRQRVSCVK----MEGDRQTPASEHLCDRNSKPSDIASCYIDC-SGRKWNYGEWTSCSETCGSNGKMHRKSYCVDDSNRRVDESLCGREQKEATERECNRIPC-PRWVYGHW-SECSR--SCDGGVKMRHAQCLDAAD 1107          

HSP 7 Score: 55.4546 bits (132), Expect = 2.047e-7
Identity = 43/149 (28.86%), Postives = 68/149 (45.64%), Query Frame = 3
Query:  231 EIDIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCD-ENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCL 674
            +  +WS CS  CG+GVQ +   C  +   +   +P  +C  + KI   T+ C+   C     +K  +WS+CS +C  +G   R V C   +G  VD  +C   + +P S + CN   C P +   +W    V    C  G + R   C+
Sbjct: 1133 QFGVWSDCSAKCGDGVQYRDANCTDRHRSV---LPEHRCLKMEKI--ITKPCHRESCPK---YKLGEWSQCSVSC-EDGWSSRRVSCVSGNGTEVDMSLCGTASDRPASHQTCNLGTC-PFWRNTDWSACSVS---CGIGHRERTTECI 1268          

HSP 8 Score: 55.0694 bits (131), Expect = 2.136e-7
Identity = 49/165 (29.70%), Postives = 74/165 (44.85%), Query Frame = 3
Query: 1233 RWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFP--CPQWNFKNVNLNQCTDHCI-GYEKARTIGDLKCI-FQNQSVGLEKCDSTRKP--VYECYNAECRVEWKISEWTKCSRTCGKSGIQARYLIC---VWENSKLP 1700
            RW    WS CSV+C   G + R V+C   +K     +SD EC  +      A       FP  CP + +     ++C D C  G ++ R +    CI    +      C+  R P  + EC  + C  EW   +W  CS++CG+ G+Q R + C   +  NS +P
Sbjct: 1696 RWKTTTWSSCSVTC-GRGIRRREVQCYRGRKNL---VSDSECNPKTKLNSVAN-----CFPVACPAYRWNVTPWSKCKDECARGQKQTRRV---HCISTSGKRAAPRMCELARAPTSIRECDTSNCPYEWVPGDWQTCSKSCGE-GVQTREVRCRRKINFNSTIP 1847          
BLAST of ADAMTS-like protein 3 vs. Ensembl Fly
Match: nolo (gene:FBgn0051619 transcript:FBtr0339132)

HSP 1 Score: 107.457 bits (267), Expect = 1.913e-23
Identity = 81/284 (28.52%), Postives = 122/284 (42.96%), Query Frame = 3
Query: 1089 AGNISDSIVIKSKSPSDGYKDWAIRNSISNKDMPNELVQLDMMQENHVRWVIGDWSQCSVSC--ENTGFQSRMVRCESLQKRFYYQLSDD---------ECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEKCDSTRKPVY--ECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSCNPPKCNLK--------CVDMHPSCK--RKKEYCRMGIYSFSCCKTCQE 1871
            +G  +D   +    P   ++  A  ++ +   +PN+            RW++G+WSQCS  C    +G Q R V C+   K      + D         EC       P   + C  N  CPQW+  +    Q   HC G   A    ++ C + N + G   CD   +P    ECYN  C   W++  W++C+  CG+ GI+ R L CVW  S+ PAGN+C   +   P V+K C  P C  +        C D    C+  R    CR+  Y   CC +C++
Sbjct: 1068 SGPEADVPHVPPHMPHARWETGAAASTTAVPSLPNDGFVY--------RWMLGEWSQCSQECGAAGSGLQRRTVSCQRAAKATSSGSTSDTENNVVDNSECFAHGLELPEFFQSC-GNEACPQWSKGDWTPCQ-RSHCHGRNTAMQRREVTCRYPNGTEG-SICDEYERPAMRQECYNERCEGVWRVEPWSECNAPCGRKGIKYRILQCVWYGSRRPAGNVCK--HQPRPAVMKVCKSPACQAQLSSSPAQLCRDSSRYCRNARAMGLCRLHRYKLKCCGSCEQ 1338          

HSP 2 Score: 95.5153 bits (236), Expect = 1.037e-19
Identity = 102/395 (25.82%), Postives = 167/395 (42.28%), Query Frame = 3
Query:  183 DGQSIGNRPIGKAFLEEIDIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYH------SSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLVPPASWRQCFDHIDPKKCFKKSEFLPEIISEKRTLVQMR-RVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWG--HKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIKSKSPSDGYKDWAIRNS----ISNKDMPNELVQLDMMQEN--HVRWVIGDWSQCSVSCENTGFQSRMVRCESLQ 1322
            D   +G    GK ++     ++ CS +C  GV+E +  C ++    + +  +   E  P+ +V  R CN   C     W ++D++ CS +CG  GI+ REV+C H       +  VV   MC +   P   + CN  +CP  +   EW K C     C  G + R + C  ++     I+ P + C +     PA  + C    + K C    +  P I     T +Q   +  K+ L+VG    VF GT++ + CPVK +  + + W   HK ++   K       +V++KG L I     +D G + C AG  S  I I+ K+      +   +      +  K     L   DM   +       +G  S  + S +  G + R  + E LQ
Sbjct:  607 DSIKVGVSEPGKTYVWREQGYTSCSASCLGGVEELIINCVREDNGRVVSPFLCSPETKPEARV--RTCNDRPCPP--RWNYSDYTPCSKSCGI-GIKTREVQCIHEVTRGGDNTMVVPNSMCPQ-PPPADRQYCNVLDCPVRWEVGEWSK-CSHT--CGYGFKDRKVECKQIMAQEHKIERPESMCPS---AKPADKKPC----NVKPC-PPEDPKPVIQINNSTHIQHDPKKTKITLKVGGAGLVFFGTQVKIKCPVKRYNRTKIKWSKDHKPLQRSRK------YKVSKKGALRILDITFRDAGVYSCHAGLSSAEISIEVKAKPGQQIEELEQQETERLVREKSGTEALTSADMKSADGTGTSTAVGPNSHVNGSAQQHGSRRRQQQSERLQ 978          
BLAST of ADAMTS-like protein 3 vs. Ensembl Fly
Match: nolo (gene:FBgn0051619 transcript:FBtr0301000)

HSP 1 Score: 107.457 bits (267), Expect = 2.116e-23
Identity = 75/236 (31.78%), Postives = 106/236 (44.92%), Query Frame = 3
Query: 1233 RWVIGDWSQCSVSC--ENTGFQSRMVRCESLQKRFYYQLSDD---------ECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEKCDSTRKPVY--ECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSCNPPKCNLK--------CVDMHPSCK--RKKEYCRMGIYSFSCCKTCQE 1871
            RW++G+WSQCS  C    +G Q R V C+   K      + D         EC       P   + C  N  CPQW+  +    Q   HC G   A    ++ C + N + G   CD   +P    ECYN  C   W++  W++C+  CG+ GI+ R L CVW  S+ PAGN+C   +   P V+K C  P C  +        C D    C+  R    CR+  Y   CC +C++
Sbjct: 1150 RWMLGEWSQCSQECGAAGSGLQRRTVSCQRAAKATSSGSTSDTENNVVDNSECFAHGLELPEFFQSC-GNEACPQWSKGDWTPCQ-RSHCHGRNTAMQRREVTCRYPNGTEG-SICDEYERPAMRQECYNERCEGVWRVEPWSECNAPCGRKGIKYRILQCVWYGSRRPAGNVCK--HQPRPAVMKVCKSPACQAQLSSSPAQLCRDSSRYCRNARAMGLCRLHRYKLKCCGSCEQ 1380          

HSP 2 Score: 95.5153 bits (236), Expect = 1.059e-19
Identity = 102/395 (25.82%), Postives = 168/395 (42.53%), Query Frame = 3
Query:  183 DGQSIGNRPIGKAFLEEIDIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYH------SSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLVPPASWRQCFDHIDPKKCFKKSEFLPEIISEKRTLVQMR-RVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWG--HKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIKSKSPSDGYKDWAIRNS----ISNKDMPNELVQLDMMQEN--HVRWVIGDWSQCSVSCENTGFQSRMVRCESLQ 1322
            D   +G    GK ++     ++ CS +C  GV+E +  C ++    + +  +   E  P+ +V  R CN   C     W ++D++ CS +CG  GI+ REV+C H       +  VV   MC +   P   + CN  +CP  +   EW K C     C  G + R + C  ++     I+ P + C +     PA  + C    + K C  + +  P I     T +Q   +  K+ L+VG    VF GT++ + CPVK +  + + W   HK ++   K       +V++KG L I     +D G + C AG  S  I I+ K+      +   +      +  K     L   DM   +       +G  S  + S +  G + R  + E LQ
Sbjct:  614 DSIKVGVSEPGKTYVWREQGYTSCSASCLGGVEELIINCVREDNGRVVSPFLCSPETKPEARV--RTCNDRPCPP--RWNYSDYTPCSKSCGI-GIKTREVQCIHEVTRGGDNTMVVPNSMCPQ-PPPADRQYCNVLDCPVRWEVGEWSK-CSHT--CGYGFKDRKVECKQIMAQEHKIERPESMCPS---AKPADKKPC----NVKPCPPE-DPKPVIQINNSTHIQHDPKKTKITLKVGGAGLVFFGTQVKIKCPVKRYNRTKIKWSKDHKPLQRSRK------YKVSKKGALRILDITFRDAGVYSCHAGLSSAEISIEVKAKPGQQIEELEQQETERLVREKSGTEALTSADMKSADGTGTSTAVGPNSHVNGSAQQHGSRRRQQQSERLQ 985          

HSP 3 Score: 56.6102 bits (135), Expect = 1.033e-7
Identity = 37/111 (33.33%), Postives = 58/111 (52.25%), Query Frame = 3
Query:  237 DIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCN 569
            D WS CS  CG G +E++  C +++  +   +    C   PK   T   C   +C +   W+  DW+ CS +CG +GIQ+R VEC  + G +  +  CD   KP S++ C+
Sbjct:  318 DDWSTCSRLCGHGYRERMVVCAEESNGIKTRVADIMC-RTPK-PPTQETCIIEECPH---WEVEDWTGCSVSCG-QGIQMRGVECKSTDGSLSAK--CDPLTKPGSMQQCS 420          
BLAST of ADAMTS-like protein 3 vs. Ensembl Fly
Match: nolo (gene:FBgn0051619 transcript:FBtr0307497)

HSP 1 Score: 107.457 bits (267), Expect = 2.311e-23
Identity = 75/236 (31.78%), Postives = 106/236 (44.92%), Query Frame = 3
Query: 1233 RWVIGDWSQCSVSC--ENTGFQSRMVRCESLQKRFYYQLSDD---------ECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEKCDSTRKPVY--ECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSCNPPKCNLK--------CVDMHPSCK--RKKEYCRMGIYSFSCCKTCQE 1871
            RW++G+WSQCS  C    +G Q R V C+   K      + D         EC       P   + C  N  CPQW+  +    Q   HC G   A    ++ C + N + G   CD   +P    ECYN  C   W++  W++C+  CG+ GI+ R L CVW  S+ PAGN+C   +   P V+K C  P C  +        C D    C+  R    CR+  Y   CC +C++
Sbjct: 1156 RWMLGEWSQCSQECGAAGSGLQRRTVSCQRAAKATSSGSTSDTENNVVDNSECFAHGLELPEFFQSC-GNEACPQWSKGDWTPCQ-RSHCHGRNTAMQRREVTCRYPNGTEG-SICDEYERPAMRQECYNERCEGVWRVEPWSECNAPCGRKGIKYRILQCVWYGSRRPAGNVCK--HQPRPAVMKVCKSPACQAQLSSSPAQLCRDSSRYCRNARAMGLCRLHRYKLKCCGSCEQ 1386          

HSP 2 Score: 95.1301 bits (235), Expect = 1.217e-19
Identity = 90/325 (27.69%), Postives = 146/325 (44.92%), Query Frame = 3
Query:  183 DGQSIGNRPIGKAFLEEIDIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYH------SSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLVPPASWRQCFDHIDPKKCFKKSEFLPEIISEKRTLVQMR-RVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWG--HKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIKSKS 1130
            D   +G    GK ++     ++ CS +C  GV+E +  C ++    + +  +   E  P+ +V  R CN   C     W ++D++ CS +CG  GI+ REV+C H       +  VV   MC +   P   + CN  +CP  +   EW K C     C  G + R + C  ++     I+ P + C +     PA  + C    + K C    +  P I     T +Q   +  K+ L+VG    VF GT++ + CPVK +  + + W   HK ++   K       +V++KG L I     +D G + C AG  S  I I+ K+
Sbjct:  614 DSIKVGVSEPGKTYVWREQGYTSCSASCLGGVEELIINCVREDNGRVVSPFLCSPETKPEARV--RTCNDRPCPP--RWNYSDYTPCSKSCGI-GIKTREVQCIHEVTRGGDNTMVVPNSMCPQ-PPPADRQYCNVLDCPVRWEVGEWSK-CSHT--CGYGFKDRKVECKQIMAQEHKIERPESMCPS---AKPADKKPC----NVKPC-PPEDPKPVIQINNSTHIQHDPKKTKITLKVGGAGLVFFGTQVKIKCPVKRYNRTKIKWSKDHKPLQRSRK------YKVSKKGALRILDITFRDAGVYSCHAGLSSAEISIEVKA 915          

HSP 3 Score: 56.6102 bits (135), Expect = 1.025e-7
Identity = 37/111 (33.33%), Postives = 58/111 (52.25%), Query Frame = 3
Query:  237 DIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCN 569
            D WS CS  CG G +E++  C +++  +   +    C   PK   T   C   +C +   W+  DW+ CS +CG +GIQ+R VEC  + G +  +  CD   KP S++ C+
Sbjct:  318 DDWSTCSRLCGHGYRERMVVCAEESNGIKTRVADIMC-RTPK-PPTQETCIIEECPH---WEVEDWTGCSVSCG-QGIQMRGVECKSTDGSLSAK--CDPLTKPGSMQQCS 420          
BLAST of ADAMTS-like protein 3 vs. Ensembl Fly
Match: nolo (gene:FBgn0051619 transcript:FBtr0110959)

HSP 1 Score: 107.457 bits (267), Expect = 2.311e-23
Identity = 75/236 (31.78%), Postives = 106/236 (44.92%), Query Frame = 3
Query: 1233 RWVIGDWSQCSVSC--ENTGFQSRMVRCESLQKRFYYQLSDD---------ECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEKCDSTRKPVY--ECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSCNPPKCNLK--------CVDMHPSCK--RKKEYCRMGIYSFSCCKTCQE 1871
            RW++G+WSQCS  C    +G Q R V C+   K      + D         EC       P   + C  N  CPQW+  +    Q   HC G   A    ++ C + N + G   CD   +P    ECYN  C   W++  W++C+  CG+ GI+ R L CVW  S+ PAGN+C   +   P V+K C  P C  +        C D    C+  R    CR+  Y   CC +C++
Sbjct: 1156 RWMLGEWSQCSQECGAAGSGLQRRTVSCQRAAKATSSGSTSDTENNVVDNSECFAHGLELPEFFQSC-GNEACPQWSKGDWTPCQ-RSHCHGRNTAMQRREVTCRYPNGTEG-SICDEYERPAMRQECYNERCEGVWRVEPWSECNAPCGRKGIKYRILQCVWYGSRRPAGNVCK--HQPRPAVMKVCKSPACQAQLSSSPAQLCRDSSRYCRNARAMGLCRLHRYKLKCCGSCEQ 1386          

HSP 2 Score: 95.1301 bits (235), Expect = 1.217e-19
Identity = 90/325 (27.69%), Postives = 146/325 (44.92%), Query Frame = 3
Query:  183 DGQSIGNRPIGKAFLEEIDIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYH------SSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLVPPASWRQCFDHIDPKKCFKKSEFLPEIISEKRTLVQMR-RVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWG--HKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIKSKS 1130
            D   +G    GK ++     ++ CS +C  GV+E +  C ++    + +  +   E  P+ +V  R CN   C     W ++D++ CS +CG  GI+ REV+C H       +  VV   MC +   P   + CN  +CP  +   EW K C     C  G + R + C  ++     I+ P + C +     PA  + C    + K C    +  P I     T +Q   +  K+ L+VG    VF GT++ + CPVK +  + + W   HK ++   K       +V++KG L I     +D G + C AG  S  I I+ K+
Sbjct:  614 DSIKVGVSEPGKTYVWREQGYTSCSASCLGGVEELIINCVREDNGRVVSPFLCSPETKPEARV--RTCNDRPCPP--RWNYSDYTPCSKSCGI-GIKTREVQCIHEVTRGGDNTMVVPNSMCPQ-PPPADRQYCNVLDCPVRWEVGEWSK-CSHT--CGYGFKDRKVECKQIMAQEHKIERPESMCPS---AKPADKKPC----NVKPC-PPEDPKPVIQINNSTHIQHDPKKTKITLKVGGAGLVFFGTQVKIKCPVKRYNRTKIKWSKDHKPLQRSRK------YKVSKKGALRILDITFRDAGVYSCHAGLSSAEISIEVKA 915          

HSP 3 Score: 56.6102 bits (135), Expect = 1.025e-7
Identity = 37/111 (33.33%), Postives = 58/111 (52.25%), Query Frame = 3
Query:  237 DIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCN 569
            D WS CS  CG G +E++  C +++  +   +    C   PK   T   C   +C +   W+  DW+ CS +CG +GIQ+R VEC  + G +  +  CD   KP S++ C+
Sbjct:  318 DDWSTCSRLCGHGYRERMVVCAEESNGIKTRVADIMC-RTPK-PPTQETCIIEECPH---WEVEDWTGCSVSCG-QGIQMRGVECKSTDGSLSAK--CDPLTKPGSMQQCS 420          
BLAST of ADAMTS-like protein 3 vs. Ensembl Fly
Match: nolo (gene:FBgn0051619 transcript:FBtr0085901)

HSP 1 Score: 107.071 bits (266), Expect = 2.547e-23
Identity = 75/236 (31.78%), Postives = 106/236 (44.92%), Query Frame = 3
Query: 1233 RWVIGDWSQCSVSC--ENTGFQSRMVRCESLQKRFYYQLSDD---------ECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEKCDSTRKPVY--ECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSCNPPKCNLK--------CVDMHPSCK--RKKEYCRMGIYSFSCCKTCQE 1871
            RW++G+WSQCS  C    +G Q R V C+   K      + D         EC       P   + C  N  CPQW+  +    Q   HC G   A    ++ C + N + G   CD   +P    ECYN  C   W++  W++C+  CG+ GI+ R L CVW  S+ PAGN+C   +   P V+K C  P C  +        C D    C+  R    CR+  Y   CC +C++
Sbjct: 1115 RWMLGEWSQCSQECGAAGSGLQRRTVSCQRAAKATSSGSTSDTENNVVDNSECFAHGLELPEFFQSC-GNEACPQWSKGDWTPCQ-RSHCHGRNTAMQRREVTCRYPNGTEG-SICDEYERPAMRQECYNERCEGVWRVEPWSECNAPCGRKGIKYRILQCVWYGSRRPAGNVCK--HQPRPAVMKVCKSPACQAQLSSSPAQLCRDSSRYCRNARAMGLCRLHRYKLKCCGSCEQ 1345          

HSP 2 Score: 95.1301 bits (235), Expect = 1.332e-19
Identity = 102/395 (25.82%), Postives = 167/395 (42.28%), Query Frame = 3
Query:  183 DGQSIGNRPIGKAFLEEIDIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYH------SSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLVPPASWRQCFDHIDPKKCFKKSEFLPEIISEKRTLVQMR-RVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWG--HKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIKSKSPSDGYKDWAIRNS----ISNKDMPNELVQLDMMQEN--HVRWVIGDWSQCSVSCENTGFQSRMVRCESLQ 1322
            D   +G    GK ++     ++ CS +C  GV+E +  C ++    + +  +   E  P+ +V  R CN   C     W ++D++ CS +CG  GI+ REV+C H       +  VV   MC +   P   + CN  +CP  +   EW K C     C  G + R + C  ++     I+ P + C +     PA  + C    + K C    +  P I     T +Q   +  K+ L+VG    VF GT++ + CPVK +  + + W   HK ++   K       +V++KG L I     +D G + C AG  S  I I+ K+      +   +      +  K     L   DM   +       +G  S  + S +  G + R  + E LQ
Sbjct:  614 DSIKVGVSEPGKTYVWREQGYTSCSASCLGGVEELIINCVREDNGRVVSPFLCSPETKPEARV--RTCNDRPCPP--RWNYSDYTPCSKSCGI-GIKTREVQCIHEVTRGGDNTMVVPNSMCPQ-PPPADRQYCNVLDCPVRWEVGEWSK-CSHT--CGYGFKDRKVECKQIMAQEHKIERPESMCPS---AKPADKKPC----NVKPC-PPEDPKPVIQINNSTHIQHDPKKTKITLKVGGAGLVFFGTQVKIKCPVKRYNRTKIKWSKDHKPLQRSRK------YKVSKKGALRILDITFRDAGVYSCHAGLSSAEISIEVKAKPGQQIEELEQQETERLVREKSGTEALTSADMKSADGTGTSTAVGPNSHVNGSAQQHGSRRRQQQSERLQ 985          

HSP 3 Score: 56.225 bits (134), Expect = 1.282e-7
Identity = 37/111 (33.33%), Postives = 58/111 (52.25%), Query Frame = 3
Query:  237 DIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCN 569
            D WS CS  CG G +E++  C +++  +   +    C   PK   T   C   +C +   W+  DW+ CS +CG +GIQ+R VEC  + G +  +  CD   KP S++ C+
Sbjct:  318 DDWSTCSRLCGHGYRERMVVCAEESNGIKTRVADIMC-RTPK-PPTQETCIIEECPH---WEVEDWTGCSVSCG-QGIQMRGVECKSTDGSLSAK--CDPLTKPGSMQQCS 420          
BLAST of ADAMTS-like protein 3 vs. Ensembl Zebrafish
Match: adamtsl3 (ADAMTS-like 3 [Source:ZFIN;Acc:ZDB-GENE-121030-8])

HSP 1 Score: 113.235 bits (282), Expect = 4.947e-25
Identity = 87/303 (28.71%), Postives = 140/303 (46.20%), Query Frame = 3
Query:  231 EIDIWSKCSTTCGEGVQEKLQACFKKTV-YLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDEN---KKPKSLRGCNRYNCP-PNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLVPPASWRQCFDHIDPKKCFKKSE-FLPEIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWGHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIK 1121
            E+ +W+ CS +CG G+Q +  +C +       E++    C  + K     + CN   C     W+  +W +CSH+CG  G Q R+V C         + + DE+    KP   R C   +C  P     EW K  V    C  G QRR+  C     +G+++ L R +C    L  P   R C   + P    K S+   P++I  KR  +Q R  ++L+  +G  +Y+ P T + + CPV++F  + + W     E      S  R+ +T+ G L I +   +D G +RC A   SD+ ++K
Sbjct:  709 EVSVWNLCSVSCGVGLQTRSVSCVRSVAGNRTESLSSKDC--VEKRPNELQACNQVACPPS--WEAEEWQQCSHSCG-RGSQWRKVYCKQRLATGSYRRLRDEDCSGPKPDVHRICTNADCLLPRLEGGEWSKCSVT---CGKGVQRREPVCRRQTASGQLVTLDRTSC--SDLPLPPLIRSC--RMSPCNKHKHSKKRCPQVIGLKRIYIQNRPEKRLSFTIGGRAYLLPKTTVIIKCPVRHFPKAQIRWEKDGDEL----TSSKRLSITKSGALRIYNLEAEDIGVYRCWANQDSDTFILK 995          

HSP 2 Score: 74.7146 bits (182), Expect = 4.205e-13
Identity = 68/226 (30.09%), Postives = 103/226 (45.58%), Query Frame = 3
Query: 1236 WVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQ-LSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKC-IFQNQSVGLEKCDSTRKP--VYECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSK--LPAGNLCYLINLEVPQVLKSCNPPKCNLKCVDMH---PSCKRKKEYCRMGIYSFSCCKTCQEYFKST 1886
            WV   WS+CS SC   GF+ R V C+ ++     + L   EC    +P+P  ++EC     C +W   +    +C   C+G   A     + C +F N +   + CD   +P  V  C +  C V WK+  W  C+  CG SG Q+R + CV   +K  LP  +  +      P   + CN   C  +C D     P+ KR K  C + +Y   CC+TC +   +T
Sbjct: 1548 WVSTVWSRCSSSC-GRGFRERRVSCQQVEASGSVKVLPSSEC--EGSPRPEDRQECSSQA-CVEW--ISGPWGKCAGRCLGPAMATQTRTVSCRLFSNSTS--KTCDPKERPSAVRNCSSEMCDVHWKVFPWRTCTVACG-SGFQSRRVECVHRQNKKTLPDQHCAW---QRRPVTWQHCNITSCGSECKDRTHYCPAVKRLK-LCSVDLYRQRCCQTCLQDTAAT 1760          

HSP 3 Score: 67.0106 bits (162), Expect = 9.376e-11
Identity = 36/105 (34.29%), Postives = 56/105 (53.33%), Query Frame = 3
Query:  411 YVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKS-LRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAAC 722
            + W+  DWS CS +CG  G Q+++++C  S G+      C    KP S  R CN  +CPP++++  W  +C   S C  G + R +SC  +  +G V  LP + C
Sbjct: 1487 FEWRLGDWSTCSSSCGNRGTQMKKIKCVSSEGRESSHAACHYLPKPSSQTRPCNLLHCPPSWVSTVW-SRCS--SSCGRGFRERRVSCQQVEASGSVKVLPSSEC 1588          

HSP 4 Score: 59.3066 bits (142), Expect = 2.224e-8
Identity = 60/211 (28.44%), Postives = 89/211 (42.18%), Query Frame = 3
Query:  231 EIDIWSKCSTTCGEGVQEKLQACFKKTVY-LIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGC--------NRYNCP-----------------------PNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLN-TGKVIDLPRAACYAKGLVPPASWRQC 764
            E + W+ CS +CG G QE+   C ++ V+  I  +   KC H P+  ++ + CN  DC     W   +WS+C+ TCG  G++ R V C   +GQ      C+ + KP     C         R N P                       P F+ + W    V    C  G QRR + C  LL+ T   ++LP   C+ +    P+S R C
Sbjct:  423 EQNPWTSCSVSCGGGSQERSIVCVEEDVHGQIVQVEDWKCTHSPR-PISKQNCNTFDCPQ---WMAMEWSQCTVTCG-PGLRYRVVLCVDYNGQHAGG--CNPHLKPHIKEDCLVPIACHKPRENQPVEAKLPWLKQAQELEETKVALEDPTFVPEPWSSCSV---SCGLGIQRRQVKCKVLLSFTQAEVELPDEECHEE---KPSSQRSC 620          

HSP 5 Score: 58.151 bits (139), Expect = 4.499e-8
Identity = 47/183 (25.68%), Postives = 76/183 (41.53%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDC------------------ENGYVWKFTDWSKCSHTCGYEGIQLREVECYHS-SGQVVDQEMCDENKKPKS-LRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAK 731
            WS CS +CG G+Q +   C     +    + +   E   +   + R C+ G C                  ++GY W++  ++ CS +C   G Q+  V C ++   ++VD  +C+ +K P S LR CN   CP  +    W    V    C  G Q R +SC+  +   +   L    C  K
Sbjct:  573 WSSCSVSCGLGIQRRQVKCKVLLSFTQAEVELPDEECHEEKPSSQRSCDSGPCLAAPDSSRWPLRTPEGPNQHGYAWEYIGFTACSASCAV-GKQMAVVRCVNTLKKEIVDDLLCNGSKAPVSLLRICNPQPCPSRWEVSVWNLCSV---SCGVGLQTRSVSCVRSVAGNRTESLSSKDCVEK 751          

HSP 6 Score: 56.225 bits (134), Expect = 1.856e-7
Identity = 59/206 (28.64%), Postives = 93/206 (45.15%), Query Frame = 3
Query: 1188 PNELVQLDMMQENHVRWVIGDWSQCSVSCENTGFQSRMVRC-ESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGL--EKCDSTRKPVYE-CYNAECRV-EWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYL-----INLEVPQVLKSCNPPKCN 1775
            P  L+++   Q    RW +  W+ CSVSC   G Q+R V C  S+       LS  +CV++   +P   + C +    P W  +     QC+  C    + R +   + +       L  E C   +  V+  C NA+C +   +  EW+KCS TCGK G+Q R  +C     +  +G L  L      +L +P +++SC    CN
Sbjct:  692 PVSLLRICNPQPCPSRWEVSVWNLCSVSC-GVGLQTRSVSCVRSVAGNRTESLSSKDCVEK---RPNELQACNQVACPPSWEAE--EWQQCSHSCGRGSQWRKVYCKQRLATGSYRRLRDEDCSGPKPDVHRICTNADCLLPRLEGGEWSKCSVTCGK-GVQRREPVC---RRQTASGQLVTLDRTSCSDLPLPPLIRSCRMSPCN 887          

HSP 7 Score: 51.9878 bits (123), Expect = 3.406e-6
Identity = 70/287 (24.39%), Postives = 113/287 (39.37%), Query Frame = 3
Query:  813 PEIISEKRTLVQMRRVEKLNL-QVGQISYVFPGTRLTLNCPVKNFLSSNLIWGHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIKSKSPSDGYKDWAIRNSISNKDMPNELVQLDMMQENHVRWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHC--------IGYEKARTIGDLKCIFQNQSVGLEKCDSTRKPV--YECYNAECRVEWKISEWTKCSRTC 1640
            P++ S K    QM R   L   QVG  +YV PG  L + CPV        + GH++     + + +NR      G L            +R L G     I   + S S  Y+        +  +   +L     +      W +GDWS CS SC N G Q + ++C S + R   + S   C     PKP ++        CP  ++ +   ++C+  C        +  ++    G +K +  ++      C+ + +P    EC +  C VEW    W KC+  C
Sbjct: 1380 PDLQSSK----QMNRKRVLMASQVGTSAYVRPGDTLRIGCPV--------VPGHRRP---IRWRFENRTLAAAAGGL------------YRLLVGGRVLEINTHTGSFSGRYQ------CQTQTNNQQQLTAWIHLLSQEFEWRLGDWSTCSSSCGNRGTQMKKIKCVSSEGR---ESSHAAC--HYLPKPSSQTRPCNLLHCPP-SWVSTVWSRCSSSCGRGFRERRVSCQQVEASGSVKVLPSSE------CEGSPRPEDRQECSSQAC-VEWISGPWGKCAGRC 1620          

HSP 8 Score: 51.6026 bits (122), Expect = 4.623e-6
Identity = 50/209 (23.92%), Postives = 89/209 (42.58%), Query Frame = 3
Query:  240 IWSKCSTTCGEGVQEKLQACFK-KTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGI--QLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLVPPASWRQCFDHIDPKKCFKKSEFLPEIISEKRTLVQMRR 857
            +WS+CS++CG G +E+  +C + +    ++ +P  +CE  P+ +   + C+   C     W    W KC+  C    +  Q R V C   S      + CD  ++P ++R C+   C  ++    W+   V    C  G Q R + C+   N      LP   C  +    P +W+ C       +C  ++ + P +   K   V + R
Sbjct: 1552 VWSRCSSSCGRGFRERRVSCQQVEASGSVKVLPSSECEGSPRPE-DRQECSSQAC---VEWISGPWGKCAGRCLGPAMATQTRTVSCRLFSNST--SKTCDPKERPSAVRNCSSEMCDVHWKVFPWRTCTVA---CGSGFQSRRVECVHRQNKKT---LPDQHCAWQRR--PVTWQHCNITSCGSECKDRTHYCPAVKRLKLCSVDLYR 1746          
BLAST of ADAMTS-like protein 3 vs. Ensembl Zebrafish
Match: ADAMTS7 (ADAM metallopeptidase with thrombospondin type 1 motif 7 [Source:NCBI gene;Acc:560364])

HSP 1 Score: 72.0182 bits (175), Expect = 2.864e-12
Identity = 58/174 (33.33%), Postives = 86/174 (49.43%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSG----QVVDQEMCDENKKPKSLRGCN-RYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRA------ACYAK 731
            W++CS TCG G+Q ++  C +KT  ++E    D     P  K T+  CN G C    +W   DW KCS +CG  G++ R V C  S G    + +    C    KP+S+  CN + +CP ++    W +  V    C+ G + RD++C    NTG   D P+A       CYA+
Sbjct:  834 WTECSATCGTGMQRQIVHCVEKTSGIVEEHYCDASMR-PDDKQTS--CNKGLCP--AIWWAGDWQKCSSSCGEMGLRKRTVLCIRSLGLDEQRALQPAECQHLPKPESIIPCNTQVSCPADWTTGSWSECSVS---CATGLRIRDVTC--RWNTGSDCD-PKAKPNSTMPCYAQ 996          

HSP 2 Score: 52.373 bits (124), Expect = 2.307e-6
Identity = 41/135 (30.37%), Postives = 61/135 (45.19%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDK--------CEHIPK----IKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWK 611
            W KCS++CGE          K+TV  I ++ +D+        C+H+PK    I   T+V    D      W    WS+CS +C   G+++R+V C  ++G       CD   KP S   C   +CP N    +W 
Sbjct:  892 WQKCSSSCGE------MGLRKRTVLCIRSLGLDEQRALQPAECQHLPKPESIIPCNTQVSCPAD------WTTGSWSECSVSCA-TGLRIRDVTCRWNTGS-----DCDPKAKPNSTMPCYAQDCPINTDISDWS 1008          
BLAST of ADAMTS-like protein 3 vs. Ensembl Zebrafish
Match: adamts2 (ADAM metallopeptidase with thrombospondin type 1 motif, 2 [Source:ZFIN;Acc:ZDB-GENE-070816-3])

HSP 1 Score: 68.5514 bits (166), Expect = 2.487e-11
Identity = 45/147 (30.61%), Postives = 71/147 (48.30%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYH----SSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSC 671
            WS CS  CG G Q     C +K+   + +  +  C +IPK +  +R CN  +C    +W   +W +CS +CG  G Q R V C       S + ++ + C+++ +P+  R CNR  CP ++    W +  V    C  G Q R + C
Sbjct:  844 WSHCSKPCGGGKQYTRFGCRRKSDGKMVHRTL--CANIPKPRAISRACNQKECSEP-IWVTGEWEECSKSCGKTGSQTRPVRCVRPELDGSYKAINAKYCNDD-RPEGRRPCNRQLCPAHWRTGPWSQCSVS---CGNGTQERQVMC 983          
BLAST of ADAMTS-like protein 3 vs. Ensembl Zebrafish
Match: adamts2 (ADAM metallopeptidase with thrombospondin type 1 motif, 2 [Source:ZFIN;Acc:ZDB-GENE-070816-3])

HSP 1 Score: 68.5514 bits (166), Expect = 2.488e-11
Identity = 46/153 (30.07%), Postives = 73/153 (47.71%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYH----SSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNT 689
            WS CS  CG G Q     C +K+   + +  +  C +IPK +  +R CN  +C    +W   +W +CS +CG  G Q R V C       S + ++ + C+++ +P+  R CNR  CP ++    W +  V    C  G Q R + C +  N 
Sbjct:  809 WSHCSKPCGGGKQYTRFGCRRKSDGKMVHRTL--CANIPKPRAISRACNQKECSEP-IWVTGEWEECSKSCGKTGSQTRPVRCVRPELDGSYKAINAKYCNDD-RPEGRRPCNRQLCPAHWRTGPWSQCSVS---CGNGTQERQVMCSTPDNA 954          
BLAST of ADAMTS-like protein 3 vs. Ensembl Zebrafish
Match: LO018340.1 (ADAMTS-like 4 [Source:NCBI gene;Acc:100333903])

HSP 1 Score: 68.1662 bits (165), Expect = 3.614e-11
Identity = 44/154 (28.57%), Postives = 74/154 (48.05%), Query Frame = 3
Query:  231 EIDIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVT----TRVCNYGDCENGYVWKF-TDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLS 677
            ++  WS+CS +CG GVQ++   C +        +   +C  + +   T     RVC++        W+  T+WS CS  CG  G + R V C  + G  V+   C++  +P+    C+   C  N+   +W   C   ++C PG QRR++ C+S
Sbjct:  754 DMGAWSECSVSCGWGVQQRQIQCRQSFGNRSTMVHPQRCAGLSRPNATQPCHPRVCSH--------WEISTNWSTCSVDCGM-GKRTRNVRCVSNHGNTVNDRECNDRLRPQHSEDCHMGPCVTNWYFTDWTHTCS--AECGPGVQRREVVCVS 896          

HSP 2 Score: 55.4546 bits (132), Expect = 2.637e-7
Identity = 42/151 (27.81%), Postives = 59/151 (39.07%), Query Frame = 3
Query:  234 IDIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQ---VVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLS 677
             D    CS  CG GVQ +   C         +  +   E +       + CN G C   Y+W    W  C+  CG  G Q R+V C   SG    V     C   +KP  ++ C    C P +   +W   C +   C  G Q R++ CL+
Sbjct:  873 TDWTHTCSAECGPGVQRREVVCVSAGGRREGDGGL---ECVGDKPADMKACNGGPCTATYLWYTGPWGYCNAVCG-NGTQRRDVICVRKSGSEFTVSSSSDCSHLEKPSPVQPCELQPCTPQWFTTDW-STCSR--SCGEGLQTREVRCLT 1016          

HSP 3 Score: 54.6842 bits (130), Expect = 5.035e-7
Identity = 41/164 (25.00%), Postives = 75/164 (45.73%), Query Frame = 3
Query:  222 FLEEIDIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQ---VVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVID 704
            F+      ++C+ TCG+G Q +   C  +  +  + +   +C+   K       CN   C     W    WS+CS +CG+ G+Q R+++C  S G    +V  + C    +P + + C+   C    ++  W    V   DC  G++ R++ C+S  N G  ++
Sbjct:  692 FVWRRGALTECTATCGKGSQYREIVCVNR--HTEQEVHERRCDSATKPTPEEEPCNVHPCPP--FWDMGAWSECSVSCGW-GVQQRQIQCRQSFGNRSTMVHPQRCAGLSRPNATQPCHPRVCSHWEISTNWSTCSV---DCGMGKRTRNVRCVS--NHGNTVN 845          

HSP 4 Score: 52.373 bits (124), Expect = 2.271e-6
Identity = 47/180 (26.11%), Postives = 79/180 (43.89%), Query Frame = 3
Query: 1236 WVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKREC-PRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIF-QNQSVGLEKCDSTRKPVY--ECYNAECRVEWKISEWTK-CSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSCN 1760
            W +G WS+CSVSC   G Q R ++C          +    C      +P A + C PR   C  W   + N + C+  C   ++ R +   +C+     +V   +C+   +P +  +C+   C   W  ++WT  CS  CG  G+Q R ++CV    +         +  + P  +K+CN
Sbjct:  753 WDMGAWSECSVSC-GWGVQQRQIQCRQSFGNRSTMVHPQRCAGLS--RPNATQPCHPRV--CSHWEI-STNWSTCSVDCGMGKRTRNV---RCVSNHGNTVNDRECNDRLRPQHSEDCHMGPCVTNWYFTDWTHTCSAECGP-GVQRREVVCVSAGGRREGDGGLECVG-DKPADMKACN 921          
BLAST of ADAMTS-like protein 3 vs. Ensembl Xenopus
Match: vash1 (vasohibin 1 [Source:Xenbase;Acc:XB-GENE-956494])

HSP 1 Score: 131.339 bits (329), Expect = 1.465e-30
Identity = 93/297 (31.31%), Postives = 140/297 (47.14%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYH----SSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLVPPASWRQCFDHIDPKKCFKKSEFLPEIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWGHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIK 1121
            WS+CS TCG G+Q +   C   +V    N    +C    +     + CN  DC     W   DW +CS TCG  G+Q+R V C       S   +  E+C + +KP S + C + +CPP     EW K   K   CS G QRR + CL +   G +I +  + C+  GL  PA  R C          + S   PEI+S  R  +Q R+ +++N  +G  +Y+ P T + + CPV+    S + W        Y  K    + VT+ G L I +   QD G ++C+A +  ++ V+K
Sbjct:  630 WSRCSATCGVGIQTRDVYC--SSVSESGNNSEQECG--AEKPSAIQPCNQIDCPPA--WHTEDWQQCSRTCG-GGVQIRRVTCKQLLADGSFLKLGDELC-QMQKPGSHKPCGKADCPPQLTTGEWSKCSAK---CSVGIQRRKMICLKITAKGHLIPINDSHCH--GLPSPALVRSCHMAKQHNPNRETSPESPEILSIHRVYIQTRQEKRINFTIGSRAYLLPKTSVVIKCPVRGIQKSLIKWEKDDQPLKYSKK----LGVTKSGSLKIHNLEAQDIGVYKCIANSAHETFVLK 909          

HSP 2 Score: 58.151 bits (139), Expect = 5.996e-8
Identity = 50/163 (30.67%), Postives = 71/163 (43.56%), Query Frame = 3
Query: 1230 VRWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEKCDSTRKPVYECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVW-ENSKLPAGNLC 1715
             RW  G WS CS SC  TGFQ R V C+  +     ++      Q  A +P  ++ C  +  C  W  +     QC + CIG         + C   N +  L +  S RK    C +  C V W+   W  C+  CG +G Q+R + C+  +NSK  A   C
Sbjct: 1390 ARWFPGAWSDCSTSC-GTGFQQRQVICQQTKLDGSIKVLPSGSCQ-YADRPVTQKPCSSD-ACVDWIPQ--PWGQCLNQCIGQGMGLQHRQVLCQHHNGTT-LPEASSARK---TCPSEMCDVYWRTGPWRPCTAACG-NGFQSRKVDCMHKKNSKAVADQYC 1542          

HSP 3 Score: 56.9954 bits (136), Expect = 1.378e-7
Identity = 57/185 (30.81%), Postives = 88/185 (47.57%), Query Frame = 3
Query: 1233 RWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQS---VGLEKCDSTRKPVYE-CYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSK--LPAGNLCYLINLEVPQVLKSCNPPK 1769
            RW  G WS+CS +C   G Q+R V C S+ +      S+ EC    A KP A + C +    P W+ +  +  QC+  C G  + R +   K +  + S   +G E C   +   ++ C  A+C  +    EW+KCS  C   GIQ R +IC+   +K  L   N  +   L  P +++SC+  K
Sbjct:  624 RWNTGSWSRCSATC-GVGIQTRDVYCSSVSESG--NNSEQEC---GAEKPSAIQPCNQIDCPPAWHTE--DWQQCSRTCGGGVQIRRV-TCKQLLADGSFLKLGDELCQMQKPGSHKPCGKADCPPQLTTGEWSKCSAKC-SVGIQRRKMICLKITAKGHLIPINDSHCHGLPSPALVRSCHMAK 798          

HSP 4 Score: 51.6026 bits (122), Expect = 6.444e-6
Identity = 32/94 (34.04%), Postives = 50/94 (53.19%), Query Frame = 3
Query:  231 EIDIWSKCSTTCGEGVQEKLQACFKKTVY-LIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQ 509
            E + W+ CS +CG G+Q +   C ++T++  I  +   KC + PK  +  + CN  DC     W   +WS+C+ TCG  G++ R V C    GQ
Sbjct:  341 EHNPWTACSVSCGGGIQRRSIVCVEETMHGEILQVEEWKCMYAPKPTI-MQTCNLFDCPK---WMAMEWSQCTVTCG-RGLRYRVVLCNDHRGQ 429          
BLAST of ADAMTS-like protein 3 vs. Ensembl Xenopus
Match: vash1 (vasohibin 1 [Source:Xenbase;Acc:XB-GENE-956494])

HSP 1 Score: 130.954 bits (328), Expect = 2.088e-30
Identity = 94/298 (31.54%), Postives = 142/298 (47.65%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYH----SSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLVPPASWRQCFDHIDPKKCFKKSE-FLPEIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWGHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIK 1121
            WS+CS TCG G+Q +   C   +V    N    +C    +     + CN  DC     W   DW +CS TCG  G+Q+R V C       S   +  E+C + +KP S + C + +CPP     EW K   K   CS G QRR + CL +   G +I +  + C+  GL  PA  R C   +   K  K  +   PEI+S  R  +Q R+ +++N  +G  +Y+ P T + + CPV+    S + W        Y  K    + VT+ G L I +   QD G ++C+A +  ++ V+K
Sbjct:  691 WSRCSATCGVGIQTRDVYC--SSVSESGNNSEQECG--AEKPSAIQPCNQIDCPP--AWHTEDWQQCSRTCG-GGVQIRRVTCKQLLADGSFLKLGDELC-QMQKPGSHKPCGKADCPPQLTTGEWSKCSAK---CSVGIQRRKMICLKITAKGHLIPINDSHCH--GLPSPALVRSCHMGVCQSKTSKLGDPESPEILSIHRVYIQTRQEKRINFTIGSRAYLLPKTSVVIKCPVRGIQKSLIKWEKDDQPLKYSKK----LGVTKSGSLKIHNLEAQDIGVYKCIANSAHETFVLK 971          

HSP 2 Score: 72.4034 bits (176), Expect = 2.974e-12
Identity = 96/404 (23.76%), Postives = 146/404 (36.14%), Query Frame = 3
Query:  813 PEIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWGHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIKS------------KSPSDG------YKDWAIRNSISNKDMPNELVQLDMMQENH--------------------------VRWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLE-KCDSTRKPVYE-----CYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVW-ENSKLPAGNLCYLINLEVPQVLKSCNPPKCNLKCVDMHPSCKRKK--EYCRMGIYSFSCCKTC 1865
            P I S ++ +  +     + L VG       G  + + CPVK F    L W  K  EY       N   +   G L++ +    ++G + C+A N     V  S             SP         Y DW   +S    +      Q  +  + H                           RW  G WS CS SC  TGFQ R V C+  +     ++      Q  A +P  ++ C  +  C  W  +     QC + CIG         + C   N +   E  CD  ++ ++      C +  C V W+   W  C+  CG +G Q+R + C+  +NSK  A   C  +    P   + C    C  KC D    C   K  + C + +Y   CC++C
Sbjct: 1256 PAIQSSEKNITYLEDGSIIAL-VGGTVMARRGVNVMVQCPVKGFPQPKLTWLKK--EYALA----NNSFLLSNGSLLLTNVSDGNEGTYFCIATNALGKTVAMSVLRLSEFKTRAMNSPRGKAGYQLEYGDWTQCSSTCGNNGTQSSTQHCVNVKGHRVNDSWCEHLHPLVIRSQACNRKDCPARWFPGAWSDCSTSC-GTGFQQRQVICQQTKLDGSIKVLPSGSCQ-YADRPVTQKPCSSD-ACVDWIPQP--WGQCLNQCIGQGMGLQHRQVLCQHHNGTTLPEASCDRKKRYLFHGTRKTCPSEMCDVYWRTGPWRPCTAACG-NGFQSRKVDCMHKKNSKAVADQYC--VWKRRPTTWQHCKATSCG-KCKDTTHYCTFVKHLKLCHIDLYKQRCCESC 1643          

HSP 3 Score: 57.7658 bits (138), Expect = 7.713e-8
Identity = 45/139 (32.37%), Postives = 61/139 (43.88%), Query Frame = 3
Query:  375 TRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLR--GCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAAC-YAKGLVP--PASWRQCFDHI 776
            TR  N    + GY  ++ DW++CS TCG  G Q     C +  G  V+   C E+  P  +R   CNR +CP  +    W   C   + C  G Q+R + C      G +  LP  +C YA   V   P S   C D I
Sbjct: 1361 TRAMNSPRGKAGYQLEYGDWTQCSSTCGNNGTQSSTQHCVNVKGHRVNDSWC-EHLHPLVIRSQACNRKDCPARWFPGAW-SDCS--TSCGTGFQQRQVICQQTKLDGSIKVLPSGSCQYADRPVTQKPCSSDACVDWI 1495          

HSP 4 Score: 57.7658 bits (138), Expect = 7.779e-8
Identity = 58/189 (30.69%), Postives = 89/189 (47.09%), Query Frame = 3
Query: 1233 RWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQS---VGLEKCDSTRKPVYE-CYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSK--LPAGNLCYLINLEVPQVLKSCNPPKCNLK 1781
            RW  G WS+CS +C   G Q+R V C S+ +      S+ EC    A KP A + C +    P W+ +  +  QC+  C G  + R +   K +  + S   +G E C   +   ++ C  A+C  +    EW+KCS  C   GIQ R +IC+   +K  L   N  +   L  P +++SC+   C  K
Sbjct:  685 RWNTGSWSRCSATC-GVGIQTRDVYCSSVSESG--NNSEQEC---GAEKPSAIQPCNQIDCPPAWHTE--DWQQCSRTCGGGVQIRRV-TCKQLLADGSFLKLGDELCQMQKPGSHKPCGKADCPPQLTTGEWSKCSAKC-SVGIQRRKMICLKITAKGHLIPINDSHCHGLPSPALVRSCHMGVCQSK 863          

HSP 5 Score: 57.3806 bits (137), Expect = 1.199e-7
Identity = 49/179 (27.37%), Postives = 79/179 (44.13%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFK-KTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYE--GIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVK--ISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLVPPASWRQC 764
            WS CST+CG G Q++   C + K    I+ +P   C++  +  VT + C+   C +   W    W +C + C  +  G+Q R+V C H +G  + +  CD  +K + L    R  CP       W+    +   + C  G Q R + C+   N+  V D      Y      P +W+ C
Sbjct: 1439 WSDCSTSCGTGFQQRQVICQQTKLDGSIKVLPSGSCQYADR-PVTQKPCSSDACVD---WIPQPWGQCLNQCIGQGMGLQHRQVLCQHHNGTTLPEASCD--RKKRYLFHGTRKTCPSEMCDVYWRTGPWRPCTAACGNGFQSRKVDCMHKKNSKAVADQ-----YCVWKRRPTTWQHC 1606          

HSP 6 Score: 55.4546 bits (132), Expect = 4.038e-7
Identity = 51/180 (28.33%), Postives = 80/180 (44.44%), Query Frame = 3
Query:  201 NRPIGKAFLE-EIDIWSKCSTTCGE-GVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHS----SGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAAC 722
            N P GKA  + E   W++CS+TCG  G Q   Q C     + + +     CEH+  + + ++ CN  DC     W    WS CS +CG  G Q R+V C  +    S +V+    C    +P + + C+   C  +++ + W +   +      G Q R + C     T     LP A+C
Sbjct: 1365 NSPRGKAGYQLEYGDWTQCSSTCGNNGTQSSTQHCVNVKGHRVND---SWCEHLHPLVIRSQACNRKDCP--ARWFPGAWSDCSTSCG-TGFQQRQVICQQTKLDGSIKVLPSGSCQYADRPVTQKPCSSDAC-VDWIPQPWGQCLNQCIGQGMGLQHRQVLCQHHNGT----TLPEASC 1533          

HSP 7 Score: 51.6026 bits (122), Expect = 7.353e-6
Identity = 32/94 (34.04%), Postives = 50/94 (53.19%), Query Frame = 3
Query:  231 EIDIWSKCSTTCGEGVQEKLQACFKKTVY-LIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQ 509
            E + W+ CS +CG G+Q +   C ++T++  I  +   KC + PK  +  + CN  DC     W   +WS+C+ TCG  G++ R V C    GQ
Sbjct:  402 EHNPWTACSVSCGGGIQRRSIVCVEETMHGEILQVEEWKCMYAPKPTI-MQTCNLFDCPK---WMAMEWSQCTVTCG-RGLRYRVVLCNDHRGQ 490          
BLAST of ADAMTS-like protein 3 vs. Ensembl Xenopus
Match: ADAMTSL1 (ADAMTS like 1 [Source:NCBI gene;Acc:100494603])

HSP 1 Score: 125.176 bits (313), Expect = 1.317e-28
Identity = 124/566 (21.91%), Postives = 218/566 (38.52%), Query Frame = 3
Query:  198 GNRPIGKAFLEEIDIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYH------SSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLVPPA----------------SWRQC---------FDHIDPKKCFKKSEFL--------------------------------PEIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWGHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIKSKSPSDGYKDWAIRN---SISNKDMPNELVQLDMMQENHVRWVIGDWS-QCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCP---QWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEKCDSTRKPVYE---CYNAECRVEWKISEWTKCSRTCGKSGIQARYLIC 1676
            G + I + +  E + +++CS +CG G+QE +  C  K   +   +    C    +     + CN   C     W+  +WS CS TCG  G+Q R+V C H      +   V+  + C +  KP  ++ CNR++CPP + + EWK+ C +   C  G   R++ C   L+ G +++LP   C +    PP+                 W QC           +   +K  K  +++                                P+I   ++  +Q RR +KL   VG  +Y+ P T L L CPV+ F    +IW            S   + V   G + I +    D G + C+AG   +  +IK    ++     + R     ++ K   NE       Q+N   +       Q  ++  ++ + S +    +L+K  Y           +     +       F C    ++ +  V    C+  C    +      L+C+   + V +  C    +P  +   C   +C   W ++ W+ CS++CG  G Q R + C
Sbjct:  612 GLKDIEELYDWEYEGFTECSESCGGGLQEAIVVCLNKQTRV--TVGESLCVASRRPPPLLKSCNMEACPP--RWEIGNWSTCSLTCGV-GLQTRDVFCSHLISRETNETVVLGDDFCRQ-PKPTLVQACNRFDCPPAWYSSEWKQ-CSQT--CGGGIHTREVLCKQRLSDGSILELPETFCSSSK--PPSQDLCENEDCPGEWHITDWSQCSVTCGEGTQIQNAVCRKKLKTGQYIVGNSSMCPSINLLVRPCSLATCTRSKHGHKQSPQITGLRKLYIQTRRQKKLQFVVGGYAYLLPKTSLVLRCPVRRFRKPQIIWEKDGKHLI----SSEHVTVAPHGYIKIHNLRPSDTGIYTCMAGPSQEHFIIKLIGDNNKIISHSSRTREEEVAKKGRKNEAYHRTEKQQNASLFNRSKTEKQGQITDPSSVYDSIVSHLLALKKFLYTITISKWSYHEILHSCVSPIMICVAFVCTASREYQWSAVGFTPCSASC--GNRGIQHPQLRCVLDKEEVNISYCLEKPRPSIKPTACNRRDCPARWMVTSWSSCSQSCG-GGFQTRRVTC 1159          

HSP 2 Score: 73.9442 bits (180), Expect = 9.175e-13
Identity = 64/224 (28.57%), Postives = 97/224 (43.30%), Query Frame = 3
Query: 1230 VRWVIGDWSQCSVSCENTGFQSRMVRCESLQKR-FYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQS-VGLEKCDSTRKPVYECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVL-----KSCNPPKCNLK---CVDMHPSCKRKKE--YCRMGIYSFSCCKTC 1865
             RW++  WS CS SC   GFQ+R V C+ L        +++D C    + +P   + C R   C +W        QC   CIG   A     + C  ++ + V  E+C +       C+   C V W++S WT C+ TCG  G Q+R + CV   +           N  VP  L     +  N  +CN+    C D    C++ K+   C++  +   CC TC
Sbjct: 1134 ARWMVTSWSSCSQSC-GGGFQTRRVTCQKLTSMGLPVAVANDACTV-FSKRPVDSQSCSRQL-CVEWT--TSPWGQCHGPCIGPRMALQHRQVYCKTRDGTIVSPEQCQN-------CWADICSVHWRVSAWTLCTATCGNYGFQSRRVECVHHRT-----------NKSVPDHLCSWRSRPINWQRCNITPFDCRDTTRYCEKVKQLKLCQLAQFRSRCCGTC 1334          

HSP 3 Score: 70.8626 bits (172), Expect = 7.653e-12
Identity = 68/208 (32.69%), Postives = 99/208 (47.60%), Query Frame = 3
Query: 1188 PNELVQLDMMQENHVRWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQ---LSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEK--CDSTRKPVYE-CYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAG-------NLCYLINLEV-PQVLKSCNPPK 1769
            P  L++   M+    RW IG+WS CS++C   G Q+R V C  L  R   +   L DD C Q   PKP   + C R F CP   + +    QC+  C G    R +   + +     + L +  C S++ P  + C N +C  EW I++W++CS TCG+ G Q +  +C     KL  G       ++C  INL V P  L +C   K
Sbjct:  665 PPPLLKSCNMEACPPRWEIGNWSTCSLTC-GVGLQTRDVFCSHLISRETNETVVLGDDFCRQ---PKPTLVQACNR-FDCPPAWYSS-EWKQCSQTCGGGIHTREVLCKQRLSDGSILELPETFCSSSKPPSQDLCENEDCPGEWHITDWSQCSVTCGE-GTQIQNAVC---RKKLKTGQYIVGNSSMCPSINLLVRPCSLATCTRSK 862          

HSP 4 Score: 57.7658 bits (138), Expect = 8.087e-8
Identity = 54/208 (25.96%), Postives = 87/208 (41.83%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVY-LIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKE---------WKKKCVKISD---------------------CSPGQQRRDLSCLSLLNTGKVI-DLPRAACYAKGLVPPASWRQCFD 770
            W+ CS++CG G+Q +  +C ++ ++  I ++   KC + PK+ +  + CN  DC     W   +WS C+ TCG+ G++ R V C    G  +    C    KP     C  +   P + AKE         W K+  ++ +                     C  G Q R + C  LL   + I DLP   C       PA+ + C+ 
Sbjct:  396 WTACSSSCGGGIQSRTVSCVEEDIHGQISSVEEWKCMYTPKMPI-VQPCNIFDCPK---WLAQEWSPCTVTCGH-GLRYRVVLCIDHRG--IHTGGCSSKTKPHIKEECTVHI--PCYKAKEKLPVEAKLPWYKQAQELEEVTAVSEEPSFIPEPWSPCSVSCGVGIQHRTVKCQVLLTFAQTIADLPLEECEG---TKPATQQTCYS 591          
BLAST of ADAMTS-like protein 3 vs. Ensembl Xenopus
Match: ADAMTSL1 (ADAMTS like 1 [Source:NCBI gene;Acc:100494603])

HSP 1 Score: 109.383 bits (272), Expect = 1.134e-23
Identity = 91/371 (24.53%), Postives = 150/371 (40.43%), Query Frame = 3
Query:  198 GNRPIGKAFLEEIDIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYH------SSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLVPPA----------------SWRQC---------FDHIDPKKCFKKSEFL--------------------------------PEIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWGHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIK 1121
            G + I + +  E + +++CS +CG G+QE +  C  K   +   +    C    +     + CN   C     W+  +WS CS TCG  G+Q R+V C H      +   V+  + C +  KP  ++ CNR++CPP + + EWK+ C +   C  G   R++ C   L+ G +++LP   C +    PP+                 W QC           +   +K  K  +++                                P+I   ++  +Q RR +KL   VG  +Y+ P T L L CPV+ F    +IW            S   + V   G + I +    D G + C+AG   +  +IK
Sbjct:  582 GLKDIEELYDWEYEGFTECSESCGGGLQEAIVVCLNKQTRV--TVGESLCVASRRPPPLLKSCNMEACPPR--WEIGNWSTCSLTCGV-GLQTRDVFCSHLISRETNETVVLGDDFCRQ-PKPTLVQACNRFDCPPAWYSSEWKQ-CSQT--CGGGIHTREVLCKQRLSDGSILELPETFCSSSK--PPSQDLCENEDCPGEWHITDWSQCSVTCGEGTQIQNAVCRKKLKTGQYIVGNSSMCPSINLLVRPCSLATCTRSKHGHKQSPQITGLRKLYIQTRRQKKLQFVVGGYAYLLPKTSLVLRCPVRRFRKPQIIWEKDGKHLI----SSEHVTVAPHGYIKIHNLRPSDTGIYTCMAGPSQEHFIIK 937          

HSP 2 Score: 87.0409 bits (214), Expect = 7.503e-17
Identity = 96/372 (25.81%), Postives = 153/372 (41.13%), Query Frame = 3
Query:  870 NLQVGQISYVFPGTRLTLN-CPVKNFLSSNLIWGHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQD-QGEWRCLAGNISDSIVIK---SKSPSDGYKDWAIRNSISNKDMPNELVQ-------LDMMQEN----------------------HVRWVIGDWSQCSVSCENTGFQSRMVRCESLQKR-FYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEKCDSTRKPVYECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWE--NSKLPAGNLCYLINLEVPQVLKSCNPPKC-NLKCVDMHPSCKRKKE--YCRMGIYSFSCCKTC 1865
            N++VG I  +     + L  CP+K  +  N+ W H+          + R  +   G+++  + + +D QGE+RC+  N S+S++ +   S   S  Y+  A+  +  +    N  +Q       LD  + N                        RW++  WS CS SC   GFQ+R V C+ L        +++D C    + +P   + C R   C +W        QC   CIG   A     + C              TR     C+   C V W++S WT C+ TCG  G Q+R + CV    N  +P  +LC   +   P   + CN   C N+ C D    C++ K+   C++  +   CC TC
Sbjct: 1244 NIKVGNIYDLHLSLFICLTGCPLKGHIMPNISWIHESQPL--GTNVRLRHELLENGQILRLTNISKDHQGEYRCIIKNPSESVIQRAFLSIQASREYQWSAVGFTPCSASCGNRGIQHPQLRCVLDKEEVNISYCLEKPRPSIKPTACNRRDCPARWMVTSWSSCSQSC-GGGFQTRRVTCQKLTSMGLPVAVANDACTV-FSKRPVDSQSCSRQL-CVEWT--TSPWGQCHGPCIGPRMALQHRQVYC-------------KTRDGTINCWADICSVHWRVSAWTLCTATCGNYGFQSRRVECVHHRTNKSVP-DHLCSWRSR--PINWQRCNITPCENIDCRDTTRYCEKVKQLKLCQLAQFRSRCCGTC 1592          

HSP 3 Score: 70.4774 bits (171), Expect = 1.067e-11
Identity = 68/208 (32.69%), Postives = 99/208 (47.60%), Query Frame = 3
Query: 1188 PNELVQLDMMQENHVRWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQ---LSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEK--CDSTRKPVYE-CYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAG-------NLCYLINLEV-PQVLKSCNPPK 1769
            P  L++   M+    RW IG+WS CS++C   G Q+R V C  L  R   +   L DD C Q   PKP   + C R F CP   + +    QC+  C G    R +   + +     + L +  C S++ P  + C N +C  EW I++W++CS TCG+ G Q +  +C     KL  G       ++C  INL V P  L +C   K
Sbjct:  635 PPPLLKSCNMEACPPRWEIGNWSTCSLTC-GVGLQTRDVFCSHLISRETNETVVLGDDFCRQ---PKPTLVQACNR-FDCPPAWYSS-EWKQCSQTCGGGIHTREVLCKQRLSDGSILELPETFCSSSKPPSQDLCENEDCPGEWHITDWSQCSVTCGE-GTQIQNAVC---RKKLKTGQYIVGNSSMCPSINLLVRPCSLATCTRSK 832          

HSP 4 Score: 57.7658 bits (138), Expect = 7.674e-8
Identity = 54/207 (26.09%), Postives = 87/207 (42.03%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVY-LIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKE---------WKKKCVKISD---------------------CSPGQQRRDLSCLSLLNTGKVI-DLPRAACYAKGLVPPASWRQCF 767
            W+ CS++CG G+Q +  +C ++ ++  I ++   KC + PK+ +  + CN  DC     W   +WS C+ TCG+ G++ R V C    G  +    C    KP     C  +   P + AKE         W K+  ++ +                     C  G Q R + C  LL   + I DLP   C       PA+ + C+
Sbjct:  366 WTACSSSCGGGIQSRTVSCVEEDIHGQISSVEEWKCMYTPKMPI-VQPCNIFDCPK---WLAQEWSPCTVTCGH-GLRYRVVLCIDHRG--IHTGGCSSKTKPHIKEECTVHI--PCYKAKEKLPVEAKLPWYKQAQELEEVTAVSEEPSFIPEPWSPCSVSCGVGIQHRTVKCQVLLTFAQTIADLPLEECEG---TKPATQQTCY 560          
BLAST of ADAMTS-like protein 3 vs. Ensembl Xenopus
Match: ADAMTSL1 (ADAMTS like 1 [Source:NCBI gene;Acc:100494603])

HSP 1 Score: 109.383 bits (272), Expect = 1.184e-23
Identity = 91/371 (24.53%), Postives = 150/371 (40.43%), Query Frame = 3
Query:  198 GNRPIGKAFLEEIDIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYH------SSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLVPPA----------------SWRQC---------FDHIDPKKCFKKSEFL--------------------------------PEIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWGHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIK 1121
            G + I + +  E + +++CS +CG G+QE +  C  K   +   +    C    +     + CN   C     W+  +WS CS TCG  G+Q R+V C H      +   V+  + C +  KP  ++ CNR++CPP + + EWK+ C +   C  G   R++ C   L+ G +++LP   C +    PP+                 W QC           +   +K  K  +++                                P+I   ++  +Q RR +KL   VG  +Y+ P T L L CPV+ F    +IW            S   + V   G + I +    D G + C+AG   +  +IK
Sbjct:  590 GLKDIEELYDWEYEGFTECSESCGGGLQEAIVVCLNKQTRV--TVGESLCVASRRPPPLLKSCNMEACPPR--WEIGNWSTCSLTCGV-GLQTRDVFCSHLISRETNETVVLGDDFCRQ-PKPTLVQACNRFDCPPAWYSSEWKQ-CSQT--CGGGIHTREVLCKQRLSDGSILELPETFCSSSK--PPSQDLCENEDCPGEWHITDWSQCSVTCGEGTQIQNAVCRKKLKTGQYIVGNSSMCPSINLLVRPCSLATCTRSKHGHKQSPQITGLRKLYIQTRRQKKLQFVVGGYAYLLPKTSLVLRCPVRRFRKPQIIWEKDGKHLI----SSEHVTVAPHGYIKIHNLRPSDTGIYTCMAGPSQEHFIIK 945          

HSP 2 Score: 91.2781 bits (225), Expect = 3.888e-18
Identity = 94/362 (25.97%), Postives = 155/362 (42.82%), Query Frame = 3
Query:  906 GTRLTLNCPVKNFLSSNLIWGHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQD-QGEWRCLAGNISDSIVIK---SKSPSDGYKDWAIRNSISNKDMPNELVQ-------LDMMQEN----------------------HVRWVIGDWSQCSVSCENTGFQSRMVRCESLQKR-FYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQS-VGLEKCDSTRKPV--YECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWE--NSKLPAGNLCYLINLEVPQVLKSCNPPKC-NLKCVDMHPSCKRKKE--YCRMGIYSFSCCKTC 1865
            G    + CP+K  +  N+ W H+          + R  +   G+++  + + +D QGE+RC+  N S+S++ +   S   S  Y+  A+  +  +    N  +Q       LD  + N                        RW++  WS CS SC   GFQ+R V C+ L        +++D C    + +P   + C R   C +W        QC   CIG   A     + C  ++ + V  E+C +  +P+    C+   C V W++S WT C+ TCG  G Q+R + CV    N  +P  +LC   +   P   + CN   C N+ C D    C++ K+   C++  +   CC TC
Sbjct: 1395 GGSALIGCPLKGHIMPNISWIHESQPL--GTNVRLRHELLENGQILRLTNISKDHQGEYRCIIKNPSESVIQRAFLSIQASREYQWSAVGFTPCSASCGNRGIQHPQLRCVLDKEEVNISYCLEKPRPSIKPTACNRRDCPARWMVTSWSSCSQSC-GGGFQTRRVTCQKLTSMGLPVAVANDACTV-FSKRPVDSQSCSRQL-CVEWT--TSPWGQCHGPCIGPRMALQHRQVYCKTRDGTIVSPEQCQALPRPLNTQNCWADICSVHWRVSAWTLCTATCGNYGFQSRRVECVHHRTNKSVP-DHLCSWRSR--PINWQRCNITPCENIDCRDTTRYCEKVKQLKLCQLAQFRSRCCGTC 1746          

HSP 3 Score: 70.8626 bits (172), Expect = 8.427e-12
Identity = 68/208 (32.69%), Postives = 99/208 (47.60%), Query Frame = 3
Query: 1188 PNELVQLDMMQENHVRWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQ---LSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEK--CDSTRKPVYE-CYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAG-------NLCYLINLEV-PQVLKSCNPPK 1769
            P  L++   M+    RW IG+WS CS++C   G Q+R V C  L  R   +   L DD C Q   PKP   + C R F CP   + +    QC+  C G    R +   + +     + L +  C S++ P  + C N +C  EW I++W++CS TCG+ G Q +  +C     KL  G       ++C  INL V P  L +C   K
Sbjct:  643 PPPLLKSCNMEACPPRWEIGNWSTCSLTC-GVGLQTRDVFCSHLISRETNETVVLGDDFCRQ---PKPTLVQACNR-FDCPPAWYSS-EWKQCSQTCGGGIHTREVLCKQRLSDGSILELPETFCSSSKPPSQDLCENEDCPGEWHITDWSQCSVTCGE-GTQIQNAVC---RKKLKTGQYIVGNSSMCPSINLLVRPCSLATCTRSK 840          

HSP 4 Score: 58.151 bits (139), Expect = 5.985e-8
Identity = 54/207 (26.09%), Postives = 87/207 (42.03%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVY-LIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKE---------WKKKCVKISD---------------------CSPGQQRRDLSCLSLLNTGKVI-DLPRAACYAKGLVPPASWRQCF 767
            W+ CS++CG G+Q +  +C ++ ++  I ++   KC + PK+ +  + CN  DC     W   +WS C+ TCG+ G++ R V C    G  +    C    KP     C  +   P + AKE         W K+  ++ +                     C  G Q R + C  LL   + I DLP   C       PA+ + C+
Sbjct:  374 WTACSSSCGGGIQSRTVSCVEEDIHGQISSVEEWKCMYTPKMPI-VQPCNIFDCPK---WLAQEWSPCTVTCGH-GLRYRVVLCIDHRG--IHTGGCSSKTKPHIKEECTVHI--PCYKAKEKLPVEAKLPWYKQAQELEEVTAVSEEPSFIPEPWSPCSVSCGVGIQHRTVKCQVLLTFAQTIADLPLEECEG---TKPATQQTCY 568          
BLAST of ADAMTS-like protein 3 vs. Ensembl Mouse
Match: Adamtsl3 (ADAMTS-like 3 [Source:MGI Symbol;Acc:MGI:3028499])

HSP 1 Score: 113.235 bits (282), Expect = 5.232e-25
Identity = 91/303 (30.03%), Postives = 132/303 (43.56%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYH--SSGQVVD--QEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACY---AKGLVPPASWRQCFDHIDPKKCFKKSEFLPEIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIW---GHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIK 1121
            W  CS TCG G+Q +   C     +          E  P      R CN  DC     W   +W +CS TCG  G Q R V C    + G  ++   E+C +  K  S + C R +CPP   A +W K  V    C  G QRR   C  L   G+ + +    C       LV P     C       K  K  E  P+I+  +R  +Q R  +++NL VG  +Y+   T + + CPV+ F  S + W   GH         K+  ++ +T+ G L I S    D G +RC+AG+  +++V+K
Sbjct:  725 WGACSATCGVGIQTRDVYCLHPEEFPAPPEECR--EEKPH---ALRACNQFDCPPS--WHIEEWQQCSRTCG-GGTQNRRVTCRQLLTDGSFLNLSDELC-QGPKASSHKSCARTDCPPQLAAGDWSKCSVT---CGVGFQRRKQVCQKLTAKGRRVSVAETLCRDLPGLPLVRPCQMPICSKAKLGTKT-KLGERGPQILGVRRVYIQTREEKRINLTVGSRAYLLLNTSVIIKCPVRRFQKSLIQWEKDGHCL-------KNSKQLGITKSGSLKIHSLAAPDIGVYRCIAGSAQETVVLK 1007          

HSP 2 Score: 81.2629 bits (199), Expect = 4.211e-15
Identity = 64/225 (28.44%), Postives = 92/225 (40.89%), Query Frame = 3
Query: 1230 VRWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNF------PCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEKCDSTRKPVY--ECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENS-KLPAGNLCYLINLEVPQVLKSCNPPKCNLKCVDMHPSCKRKKE--YCRMGIYSFSCCKTCQE 1871
             RW    WS+CS SC   GF SR V C+        Q   +  VQ V+P+  A ++ P         PC Q      N  QC   C+G+          C   + S     C+  R+P +   C    C   W++  W  C+  CG+ G Q+R + C+   S K+ A   C  +    P   + C  P C+  C D    C   K    C + +Y   CC++CQE
Sbjct: 1499 ARWFTSMWSECSASC-GEGFHSRQVTCK--------QTKANGTVQVVSPRACAPKDRPLGRKPCSIRPCVQQAIDPGN--QCPGRCMGHATRMQHHHTACSHNSSS---SDCEDGRRPAFGRNCTLGPCEACWRVGPWKPCTAVCGR-GFQSRKVDCIHTGSCKIVADRYCVQVK---PAAWRHCLGPSCDRNCTDTTHYCMFVKHLNLCSLAVYRQRCCQSCQE 1705          

HSP 3 Score: 56.6102 bits (135), Expect = 1.408e-7
Identity = 39/129 (30.23%), Postives = 58/129 (44.96%), Query Frame = 3
Query:  411 YVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKP-KSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLV---PPASWRQCFDH-IDP 782
            + W+  +W+ CS TCG  G +L+   C  +SGQ V + +C  ++KP    + CN  +CP  +    W  +C   + C  G   R ++C      G V  +   AC  K       P S R C    IDP
Sbjct: 1440 HFWEPGNWTHCSATCGPLGFRLQRPRCVMASGQEVSEALCGPHRKPLAGFQSCNIRDCPARWFTSMW-SECS--ASCGEGFHSRQVTCKQTKANGTVQVVSPRACAPKDRPLGRKPCSIRPCVQQAIDP 1565          

HSP 4 Score: 55.8398 bits (133), Expect = 2.730e-7
Identity = 46/164 (28.05%), Postives = 68/164 (41.46%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQAC-----FKKTVYLIENI-------PMDK------CEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHS-SGQVVDQEMCDENKKPKSL-RGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCL 674
            WS CSTTCG G+Q +   C     F +T   +          P D+      C+  P  +         D E  Y W++  ++ C+ TC   G Q     C H+ + Q V+  +CD   +P  + + CN   CPP +    W       + C  G Q RD+ CL
Sbjct:  585 WSACSTTCGPGIQVREVRCRVLLTFTQTEAELPEEECEGPKPPTDRPCLRQACDQSPVSRELGGRLQEKDSEMTYDWEYAGFTPCTATC-LGGHQEAIAVCLHTQTHQTVNDSLCDTVHRPPPMSQACNMEPCPPRWHMGSWG---ACSATCGVGIQTRDVYCL 744          

HSP 5 Score: 53.5286 bits (127), Expect = 1.416e-6
Identity = 33/96 (34.38%), Postives = 52/96 (54.17%), Query Frame = 3
Query:  231 EIDIWSKCSTTCGEGVQEKLQACFKKTVYL-IENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVV 515
            E + W+ CS +CG G+Q +   C +++++  I  +   KC + PK  V  + CN  DC     W   +WS+C+ TCG  G++ R V C +  GQ V
Sbjct:  435 EHNPWTACSVSCGGGIQRRSFVCVEESMHAEILQVEEWKCMYAPKPTV-MQACNLFDCPK---WVAMEWSQCTVTCG-RGLRYRVVLCINHRGQHV 525          
BLAST of ADAMTS-like protein 3 vs. Ensembl Mouse
Match: Adamtsl1 (ADAMTS-like 1 [Source:MGI Symbol;Acc:MGI:1924989])

HSP 1 Score: 106.301 bits (264), Expect = 7.850e-23
Identity = 92/310 (29.68%), Postives = 129/310 (41.61%), Query Frame = 3
Query:  231 EIDIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPM--DKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYH--SSGQVVD--QEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLVPP----ASWRQCFDHIDPKKCFKKSEFLPEIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIW---GHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIK 1121
            EI  WS CS TCG G+Q +   C       +  + +  D+  H PK   T + CN  +C     W    W  CS TCG  GIQ R+V C    + G  ++  +  C  +K P S +GC + +CP  +L  EW +  V    C  G Q R   C  +L TG    +    C      PP    +S R C      +     ++  P I + +   +Q RR  KL+  VG  +Y+ P T + L CP + F    + W   G   I       S   + V   G L I      D G + C AG   +  VIK
Sbjct:  654 EIGKWSPCSLTCGVGLQTRDVVCSHLLSREMNEVVVLADELCHHPK-PSTVQACNRFNCPP--AWYPAQWQLCSRTCG-GGIQKRDVLCKQRMADGSFLELPETFCSASK-PTSHQGCKKDDCPSEWLLSEWSECSVS---CGEGTQTRSAICQRVLKTGVSTVVNSTLC------PPLPFSSSIRPCMLATCARPGRPSTKHSPHIAAARNIYIQTRRQRKLHFVVGGFAYLLPKTTVVLRCPTRRFRKPLITWEKDGQHSI-------SSAHVTVAPFGYLKIHRLKPSDAGIYTCSAGPAREQFVIK 942          

HSP 2 Score: 89.3521 bits (220), Expect = 1.174e-17
Identity = 94/369 (25.47%), Postives = 156/369 (42.28%), Query Frame = 3
Query:  879 VGQISYVFPGTRLTLNCPVKNFLSSNLIWGHKKIEYFYKGKSKNRIRVTRKGKLI-IKSFLIQDQGEWRCLAGNISDSIVIKSKSPSDGYKDWAI------RNSISNKDMPNE----LVQLDMMQENH--------------------VRWVIGDWSQCSVSCENTGFQSRMVRCESLQKR-FYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQ-SVGLEKCDSTRKPV--YECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVW--ENSKLPAGNLCYLINLEVPQVLKSCNPPKC-NLKCVDMHPSCK--RKKEYCRMGIYSFSCCKTC 1865
            +G    + PG    L CP+K   + N+ W              + I     G+++ + +     QGE+ CLA N + +++ K+      Y  W++        S  N+ +       L+    +   H                     RW++  WS C+ SC   G Q+R V C+ L+       +S+D C Q +A +P   + C +   C +W F +    QC   CIG   A     + C  ++  ++  E+C +  +PV    C++  C V W++S WT C+ TCG  G Q+R + CV    N  +P  +LC       P   + CN   C N +C D    C+  R+ + C++G +   CC TC
Sbjct: 1393 LGTQLVLDPGNSALLGCPIKGHPTPNITWFQNGQPIATAPGLTHHI--WGAGQILRVANLSGGPQGEFSCLAQNEAGTLLQKASLVIQDYW-WSVDRLATCSASCGNRGIHQPRLRCLLNTTEVDPEHCTGKPRPAVQPVACNRRDCPSRWMVTSWSACTRSC-GGGVQTRRVTCQKLKASGISTPVSNDMCSQ-LAKRPVDTQACNQQL-CVEWAFSS--WGQCNGPCIGPRLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLWTLCTATCGNYGFQSRRVECVHVRTNKAVPE-HLCSWG--PRPANWQRCNVTPCENTECRDTTRYCEKVRQLKLCQLGQFRSRCCGTC 1750          

HSP 3 Score: 85.8853 bits (211), Expect = 1.664e-16
Identity = 58/188 (30.85%), Postives = 93/188 (49.47%), Query Frame = 3
Query:  183 DGQSIGNRPIGKAFLEEIDIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQ------VVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYA 728
            DG   G + + + +  E + ++KCS +CG GVQE + +C  K    + +   + C    +     + CN   C     W+   WS CS TCG  G+Q R+V C H   +      V+  E+C  + KP +++ CNR+NCPP +   +W + C +   C  G Q+RD+ C   +  G  ++LP   C A
Sbjct:  579 DGLLGGLQDLDELYDWEYEGFTKCSESCGGGVQEAVVSCLNKQTRELAD--ENLCVTSRRPPQLLKSCNLDPCP--ARWEIGKWSPCSLTCGV-GLQTRDVVCSHLLSREMNEVVVLADELC-HHPKPSTVQACNRFNCPPAWYPAQW-QLCSRT--CGGGIQKRDVLCKQRMADGSFLELPETFCSA 757          

HSP 4 Score: 63.1586 bits (152), Expect = 1.293e-9
Identity = 59/214 (27.57%), Postives = 98/214 (45.79%), Query Frame = 3
Query:  177 LFDGQSIGNRPIGKAFLEEIDIWSKCSTTCGEGVQEKLQAC-----FKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDC---------ENG-------------YVWKFTDWSKCSHTCGYEGIQLREVECYH-SSGQVVDQEMCDENKKPKS-LRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLN--TGKVIDLPRAACY 725
            L +G ++   P   +F+ E   WS C+ TCG G Q ++  C     F ++V    ++P D+CE  PK   + R C  G C         +NG             Y W++  ++KCS +CG  G+Q   V C +  + ++ D+ +C  +++P   L+ CN   CP  +   +W    +    C  G Q RD+ C  LL+    +V+ L    C+
Sbjct:  497 LEEGAAVSEEP---SFIPEA--WSACTVTCGVGTQVRIIRCQVLLPFSQSV---ADLPADECEG-PK-PASQRACYAGPCNGETPEFNPDNGDGLLGGLQDLDELYDWEYEGFTKCSESCG-GGVQEAVVSCLNKQTRELADENLCVTSRRPPQLLKSCNLDPCPARWEIGKWSPCSLT---CGVGLQTRDVVCSHLLSREMNEVVVLADELCH 696          

HSP 5 Score: 62.7734 bits (151), Expect = 1.927e-9
Identity = 135/528 (25.57%), Postives = 208/528 (39.39%), Query Frame = 3
Query:  252 CSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIP---KIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSS--GQV--VDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSL--LNTGKVIDLPRAACYAKGLVPPASWRQCFDHIDPKKCFKKSEFLPEIISEKRTLVQMRRVEKLNLQVGQISYVFPG-TRLTLNCPVKNFLSSNLIWGHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIKSKSPSDGYKDWAIRNSISNKDMPNELVQLDMMQENHVRWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDE-CVQRVAPKPFAKRECPRNFPCP-QWNFKNVNLNQCTDHC-IGYEKARTI-GDLKCIFQNQSVGL--EKCDSTR-KPVYECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSCNPPKCNLKC 1784
            CS TCG G Q     C+      +  +    C + P   K K   + CN   C     W+ T W+ CS +CG  GIQ R V C      G V  V++  C    K   ++ CN ++C P +LA+EW    V    C  G + R + C+    ++TG         C AK    P    +C   I P  C+K  E LP I ++     Q + +E+      + S++    +  T+ C V                         ++R+ R   L+  S  + D     C  G    S       P +G  +    N  +   +   L  LD + +    W    +++CS SC   G Q  +V C + Q R   +L+D+  CV    P P   + C  + PCP +W       + C+  C +G +    +   L     N+ V L  E C   +   V  C    C   W  ++W  CSRTCG  GIQ R ++C     ++  G+      LE+P+   S + P  +  C
Sbjct:  309 CSATCGGGYQLTSAECYDLRSNRV--VADQYCHYYPENVKPKPKLQECNLDPCP--ARWEATPWTACSSSCG-GGIQSRAVSCVEEDIQGHVTSVEEWKCMYTPKMPVVQPCNIFDC-PKWLAQEWSPCTVT---CGQGLRYRVVLCIDHRGMHTG--------GCSAK--TKPHIKEEC---IIPTPCYKPREKLP-IEAKLPWFKQAQELEEGAAVSEEPSFIPEAWSACTVTCGV-----------------------GTQVRIIRCQVLLPFSQSVADLPADEC-EGPKPASQRACYAGPCNG--ETPEFNPDNGDGLLGGLQDLDELYD----WEYEGFTKCSESC-GGGVQEAVVSCLNKQTR---ELADENLCVTSRRP-PQLLKSCNLD-PCPARWEIG--KWSPCSLTCGVGLQTRDVVCSHLLSREMNEVVVLADELCHHPKPSTVQACNRFNCPPAWYPAQWQLCSRTCG-GGIQKRDVLC---KQRMADGSF-----LELPETFCSASKPTSHQGC 766          

HSP 6 Score: 61.2326 bits (147), Expect = 6.116e-9
Identity = 55/189 (29.10%), Postives = 86/189 (45.50%), Query Frame = 3
Query: 1146 KDWAIRNSISNKDMPNELVQLDMMQENHVRWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQ---LSDDECVQRVAPKPFAKRECPRNFPCP------QWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEK--CDSTRKPVYE-CYNAECRVEWKISEWTKCSRTCGKSGIQARYLIC 1676
            ++ A  N       P +L++   +     RW IG WS CS++C   G Q+R V C  L  R   +   L+D+ C     PKP   + C R F CP      QW         C+  C G  + R +   + +     + L +  C +++   ++ C   +C  EW +SEW++CS +CG+ G Q R  IC
Sbjct:  623 RELADENLCVTSRRPPQLLKSCNLDPCPARWEIGKWSPCSLTC-GVGLQTRDVVCSHLLSREMNEVVVLADELCHH---PKPSTVQACNR-FNCPPAWYPAQWQL-------CSRTCGGGIQKRDVLCKQRMADGSFLELPETFCSASKPTSHQGCKKDDCPSEWLLSEWSECSVSCGE-GTQTRSAIC 798          

HSP 7 Score: 55.4546 bits (132), Expect = 3.275e-7
Identity = 57/212 (26.89%), Postives = 84/212 (39.62%), Query Frame = 3
Query:  231 EIDIWSKCSTTCGEGVQEKLQACFKKTVY-LIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGC--------NRYNCP-----------------------PNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLN-TGKVIDLPRAACYAKGLVPPASWRQCF 767
            E   W+ CS++CG G+Q +  +C ++ +   + ++   KC + PK+ V  + CN  DC     W   +WS C+ TCG +G++ R V C    G  +    C    KP     C         R   P                       P+F+ + W    V    C  G Q R + C  LL  +  V DLP   C       PAS R C+
Sbjct:  364 EATPWTACSSSCGGGIQSRAVSCVEEDIQGHVTSVEEWKCMYTPKMPV-VQPCNIFDCPK---WLAQEWSPCTVTCG-QGLRYRVVLCIDHRG--MHTGGCSAKTKPHIKEECIIPTPCYKPREKLPIEAKLPWFKQAQELEEGAAVSEEPSFIPEAWSACTVT---CGVGTQVRIIRCQVLLPFSQSVADLPADECEGPK---PASQRACY 562          

HSP 8 Score: 54.6842 bits (130), Expect = 6.294e-7
Identity = 36/128 (28.12%), Postives = 54/128 (42.19%), Query Frame = 3
Query:  234 IDIWSKCSTTCGEGVQEKLQACFK-KTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTC--GYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEW 608
            +  WS C+ +CG GVQ +   C K K   +   +  D C  + K  V T+ CN   C     W F+ W +C+  C      +Q R+V C    G  +  E C    +P S + C    C  ++    W
Sbjct: 1542 VTSWSACTRSCGGGVQTRRVTCQKLKASGISTPVSNDMCSQLAKRPVDTQACNQQLCVE---WAFSSWGQCNGPCIGPRLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLW 1666          
BLAST of ADAMTS-like protein 3 vs. Ensembl Mouse
Match: Adamtsl1 (ADAMTS-like 1 [Source:MGI Symbol;Acc:MGI:1924989])

HSP 1 Score: 100.908 bits (250), Expect = 3.447e-21
Identity = 97/360 (26.94%), Postives = 142/360 (39.44%), Query Frame = 3
Query:  183 DGQSIGNRPIGKAFLEEIDIWSKCSTTCGEGVQEKLQACFKKTV----------------YLIENIPMDKCE--------------------HIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYH--SSGQVVD--QEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLVPP----ASWRQCFDHIDPKKCFKKSEFLPEIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIW---GHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIK 1121
            DG   G + + + +  E + ++KCS +CG GVQE + +C  K                   L+++  +D C                     H PK   T + CN  +C     W    W  CS TCG  GIQ R+V C    + G  ++  +  C  +K P S +GC + +CP  +L  EW +  V    C  G Q R   C  +L TG    +    C      PP    +S R C      +     ++  P I + +   +Q RR  KL+  VG  +Y+ P T + L CP + F    + W   G   I       S   + V   G L I      D G + C AG   +  VIK
Sbjct:  596 DGLLGGLQDLDELYDWEYEGFTKCSESCGGGVQEAVVSCLNKQTRELADENLCVTSRRPPQLLKSCNLDPCPASHLLSREMNEVVVLADELCHHPK-PSTVQACNRFNCPP--AWYPAQWQLCSRTCG-GGIQKRDVLCKQRMADGSFLELPETFCSASK-PTSHQGCKKDDCPSEWLLSEWSECSVS---CGEGTQTRSAICQRVLKTGVSTVVNSTLC------PPLPFSSSIRPCMLATCARPGRPSTKHSPHIAAARNIYIQTRRQRKLHFVVGGFAYLLPKTTVVLRCPTRRFRKPLITWEKDGQHSI-------SSAHVTVAPFGYLKIHRLKPSDAGIYTCSAGPAREQFVIK 934          

HSP 2 Score: 89.3521 bits (220), Expect = 1.344e-17
Identity = 94/369 (25.47%), Postives = 156/369 (42.28%), Query Frame = 3
Query:  879 VGQISYVFPGTRLTLNCPVKNFLSSNLIWGHKKIEYFYKGKSKNRIRVTRKGKLI-IKSFLIQDQGEWRCLAGNISDSIVIKSKSPSDGYKDWAI------RNSISNKDMPNE----LVQLDMMQENH--------------------VRWVIGDWSQCSVSCENTGFQSRMVRCESLQKR-FYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQ-SVGLEKCDSTRKPV--YECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVW--ENSKLPAGNLCYLINLEVPQVLKSCNPPKC-NLKCVDMHPSCK--RKKEYCRMGIYSFSCCKTC 1865
            +G    + PG    L CP+K   + N+ W              + I     G+++ + +     QGE+ CLA N + +++ K+      Y  W++        S  N+ +       L+    +   H                     RW++  WS C+ SC   G Q+R V C+ L+       +S+D C Q +A +P   + C +   C +W F +    QC   CIG   A     + C  ++  ++  E+C +  +PV    C++  C V W++S WT C+ TCG  G Q+R + CV    N  +P  +LC       P   + CN   C N +C D    C+  R+ + C++G +   CC TC
Sbjct: 1385 LGTQLVLDPGNSALLGCPIKGHPTPNITWFQNGQPIATAPGLTHHI--WGAGQILRVANLSGGPQGEFSCLAQNEAGTLLQKASLVIQDYW-WSVDRLATCSASCGNRGIHQPRLRCLLNTTEVDPEHCTGKPRPAVQPVACNRRDCPSRWMVTSWSACTRSC-GGGVQTRRVTCQKLKASGISTPVSNDMCSQ-LAKRPVDTQACNQQL-CVEWAFSS--WGQCNGPCIGPRLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLWTLCTATCGNYGFQSRRVECVHVRTNKAVPE-HLCSWG--PRPANWQRCNVTPCENTECRDTTRYCEKVRQLKLCQLGQFRSRCCGTC 1742          

HSP 3 Score: 70.0922 bits (170), Expect = 1.018e-11
Identity = 65/250 (26.00%), Postives = 106/250 (42.40%), Query Frame = 3
Query:  177 LFDGQSIGNRPIGKAFLEEIDIWSKCSTTCGEGVQEKLQAC-----FKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDC---------ENG-------------YVWKFTDWSKCSHTCGYEGIQLREVECYH-SSGQVVDQEMC-----------------------------------DE---NKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYA 728
            L +G ++   P   +F+ E   WS C+ TCG G Q ++  C     F ++V    ++P D+CE  PK   + R C  G C         +NG             Y W++  ++KCS +CG  G+Q   V C +  + ++ D+ +C                                   DE   + KP +++ CNR+NCPP +   +W + C +   C  G Q+RD+ C   +  G  ++LP   C A
Sbjct:  514 LEEGAAVSEEP---SFIPEA--WSACTVTCGVGTQVRIIRCQVLLPFSQSV---ADLPADECEG-PK-PASQRACYAGPCNGETPEFNPDNGDGLLGGLQDLDELYDWEYEGFTKCSESCG-GGVQEAVVSCLNKQTRELADENLCVTSRRPPQLLKSCNLDPCPASHLLSREMNEVVVLADELCHHPKPSTVQACNRFNCPPAWYPAQW-QLCSRT--CGGGIQKRDVLCKQRMADGSFLELPETFCSA 749          

HSP 4 Score: 61.6178 bits (148), Expect = 4.502e-9
Identity = 133/544 (24.45%), Postives = 205/544 (37.68%), Query Frame = 3
Query:  231 EIDIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIP---KIKVTTRVCNYGDC--ENGY-------------VWKFTDWSKCSHTCGYEGIQLREVECYHSS--GQV--VDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSL--LNTGKVIDLPRAACYAKGLVPPASWRQCFDHIDPKKCFKKSEFLPEIISEKRTLVQMRRVEKLNLQVGQISYVFPG-TRLTLNCPVKNFLSSNLIWGHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIKSKSPSDGYKDWAIRNSISNKDMPNELVQLDMMQENHVRWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDE-CVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEKCDSTRKPVYECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSCNPPKCNLKC 1784
            E D +  CS TCG G Q     C+      +  +    C + P   K K   + CN   C   +GY              W+ T W+ CS +CG  GIQ R V C      G V  V++  C    K   ++ CN ++C P +LA+EW    V    C  G + R + C+    ++TG         C AK    P    +C   I P  C+K  E LP I ++     Q + +E+      + S++    +  T+ C V                         ++R+ R   L+  S  + D     C  G    S       P +G  +    N  +   +   L  LD + +    W    +++CS SC   G Q  +V C + Q R   +L+D+  CV    P P   + C  + PCP  +  +  +N+             + D  C     S            V  C    C   W  ++W  CSRTCG  GIQ R ++C     ++  G+      LE+P+   S + P  +  C
Sbjct:  303 ETDFF-PCSATCGGGYQLTSAECYDLRSNRV--VADQYCHYYPENVKPKPKLQECNLDPCPASDGYKQIMPYDLYHPLPRWEATPWTACSSSCG-GGIQSRAVSCVEEDIQGHVTSVEEWKCMYTPKMPVVQPCNIFDC-PKWLAQEWSPCTVT---CGQGLRYRVVLCIDHRGMHTG--------GCSAK--TKPHIKEEC---IIPTPCYKPREKLP-IEAKLPWFKQAQELEEGAAVSEEPSFIPEAWSACTVTCGV-----------------------GTQVRIIRCQVLLPFSQSVADLPADEC-EGPKPASQRACYAGPCNG--ETPEFNPDNGDGLLGGLQDLDELYD----WEYEGFTKCSESC-GGGVQEAVVSCLNKQTR---ELADENLCVTSRRP-PQLLKSCNLD-PCPASHLLSREMNEVV----------VLADELCHHPKPST-----------VQACNRFNCPPAWYPAQWQLCSRTCG-GGIQKRDVLC---KQRMADGSF-----LELPETFCSASKPTSHQGC 758          

HSP 5 Score: 54.299 bits (129), Expect = 6.847e-7
Identity = 36/128 (28.12%), Postives = 54/128 (42.19%), Query Frame = 3
Query:  234 IDIWSKCSTTCGEGVQEKLQACFK-KTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTC--GYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEW 608
            +  WS C+ +CG GVQ +   C K K   +   +  D C  + K  V T+ CN   C     W F+ W +C+  C      +Q R+V C    G  +  E C    +P S + C    C  ++    W
Sbjct: 1534 VTSWSACTRSCGGGVQTRRVTCQKLKASGISTPVSNDMCSQLAKRPVDTQACNQQLCVE---WAFSSWGQCNGPCIGPRLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLW 1658          
BLAST of ADAMTS-like protein 3 vs. Ensembl Mouse
Match: Adamts9 (a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 9 [Source:MGI Symbol;Acc:MGI:1916320])

HSP 1 Score: 83.9593 bits (206), Expect = 5.490e-16
Identity = 125/517 (24.18%), Postives = 205/517 (39.65%), Query Frame = 3
Query:  240 IWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLVPPASWRQCFDHIDPKKCFKKSEFLPEI-------ISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWGH-KKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIKSKSPSDGYKDWAIRNSISNKDMPNELVQLDMMQENHV----RWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTI----------GDLKCIFQNQSVGLEKCDSTRKPVYECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVW-ENSKLPAGNLCYL 1721
             W++CS +C  G Q +   C      ++++    KC H  + KV  + CN   C +   WK  DWS+C  TCG +G + R+V C     ++ D+ MCD   KP+ ++ C +  C   + A  W +  V    C  G Q R + C+       V D    A              C   I   +  + ++ +P              T  +  R+  ++ +    S        TL  PV     S    G  K +++     +  + + TR+   +  S  + D+ E  C    I ++    S SP   +    + +   N+D      + D     HV    +W  G W  CS +C   G Q R+V C   Q    Y  +D  CV+R+  KP  +R C  + PCPQW +   +  +CT  C G  + R +           DL C   ++    E+C++   P            W    W+ CS +CG+ G + R + C+  + S L + N  +L
Sbjct:  424 AWTECSRSCDGGTQRRRAICVNTRNDVLDD---SKCTH--QEKVVVQSCNEFSCPH---WKTGDWSECLVTCG-KGHKHRQVWCQFGEDRLSDR-MCDPEAKPEPMQTCQQPECAA-WQAGPWGQCSVT---CGQGYQLRAVKCIMGTYMSVVDDNDCNAATRPTDTQDCELASCHPSILALEPRRNAQSIPRTQWRFGSWTPCSATCGKGTRMRYVSCRDEDGSVADESACATLPKPVAKEECSVTPCGQWKALDWSSCSVTCGQGKATRQVVCVNYSDHVIDRSE--CDPDYIPETDQDCSMSPCPQWT--GLAHPFQNEDF---RPRSDSPSRTHVLGGNQWRTGPWGACSSTCAG-GSQRRVVVC---QDENGYTAND--CVERI--KPDEQRAC-ESGPCPQWAYG--SWGECTKLCGGGMRTRLVVCQRANGDRFPDLSCEVLDKPTDREQCNTHACPQ--------DAAWSTGPWSSCSVSCGR-GHKHRNVYCLAKDGSHLESDNCKHL 899          

HSP 2 Score: 75.8702 bits (185), Expect = 1.892e-13
Identity = 122/509 (23.97%), Postives = 193/509 (37.92%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYV---------------WKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAAC---YAKGLVPPASWRQCFDHIDPKKCFKKSEFLPEIISEKRTLVQMRRVEKLNLQVGQISYVFPGT-RLTLNCPVKNFLSSNLIWGHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEW----RCLAGNISDSIVIKSKSPSDGYKDWAIRNSISNKDMPNELVQLDMMQ-ENHVRWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEKCDSTRKPVYE--CYNAECRV-EWKISEWTKCSRTCGKSGIQARYLICVWEN 1688
            W +CS TCG+G Q +   C   T   +  +  + C    +    T+ C    C    +               W+F  W+ CS TCG +G ++R V C    G V D+  C    KP +   C+   C   + A +W    V    C  G+  R + C++  +   VID  R+ C   Y        S   C         F+  +F P   S  RT V      +        S    G+ R  + C  +N  ++N       +E        +  R    G     ++     G W    +   G +   +V+  ++  D + D     S    D P +  Q +         W  G WS CSVSC   G + R V C  L K   + L  D C  +  PKP   R C          +K    +QC+  C    + R +G    I  +++    +C S  +P  E  C  + C +  W+  +W +C++TCG+ G + R ++CV E+
Sbjct:  535 WGQCSVTCGQGYQLRAVKCIMGTYMSV--VDDNDCNAATR-PTDTQDCELASCHPSILALEPRRNAQSIPRTQWRFGSWTPCSATCG-KGTRMRYVSCRDEDGSVADESACATLPKPVAKEECSVTPCG-QWKALDWSSCSVT---CGQGKATRQVVCVNYSD--HVID--RSECDPDYIPETDQDCSMSPCPQWTGLAHPFQNEDFRPRSDSPSRTHVLGGNQWRTGPWGACSSTCAGGSQRRVVVCQDENGYTANDC-----VERI----KPDEQRACESGPCPQWAY-----GSWGECTKLCGGGMRTRLVVCQRANGDRFPDL----SCEVLDKPTDREQCNTHACPQDAAWSTGPWSSCSVSC-GRGHKHRNVYC--LAKDGSH-LESDNC--KHLPKPHGHRRCRGGR---CPRWKAGAWSQCSVSCGQGVQQRHVGCQ--IGTHKAARESECSSYSRPESERVCQASPCPLYTWRAEQWQQCTKTCGE-GSRYRQVVCVAED 1001          

HSP 3 Score: 64.3142 bits (155), Expect = 6.713e-10
Identity = 62/210 (29.52%), Postives = 89/210 (42.38%), Query Frame = 3
Query: 1146 KDWAIRNSISNKDMPNELVQLDMMQENHVRWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQS-VGLEKCDSTRKPV--YECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSCNPP 1766
            KD +   S + K +P              RW  G WSQCSVSC   G Q R V C   Q   +    + EC      +P ++R C +  PCP + ++     QCT  C    + R +    C+ ++QS V    CDS ++P     C    C   W   EW++CS TCGK G + R + C    S++  G   Y  + +         PP
Sbjct:  886 KDGSHLESDNCKHLPKPHGHRRCRGGRCPRWKAGAWSQCSVSC-GQGVQQRHVGC---QIGTHKAARESECSSYS--RPESERVC-QASPCPLYTWRAEQWQQCTKTCGEGSRYRQV---VCVAEDQSEVHSTHCDSDQRPPDRESCSLQPCEYVWITGEWSECSVTCGK-GYRQRLVSC----SEIYTGKENYEYSYQTTVNCPGAQPP 1080          

HSP 4 Score: 62.3882 bits (150), Expect = 2.153e-9
Identity = 53/188 (28.19%), Postives = 82/188 (43.62%), Query Frame = 3
Query:  240 IWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGK---------VIDLPRA------ACYAKGLVPPASWR 758
             WS+CS +CG+GVQ++   C   T          +C    + + + RVC    C   Y W+   W +C+ TCG EG + R+V C       V    CD +++P     C+   C   ++  EW +  V    C  G ++R +SC S + TGK          ++ P A       CY +     A+WR
Sbjct:  920 AWSQCSVSCGQGVQQRHVGCQIGTHKAARE---SECSSYSRPE-SERVCQASPCPL-YTWRAEQWQQCTKTCG-EGSRYRQVVCVAEDQSEVHSTHCDSDQRPPDRESCSLQPCEYVWITGEWSECSVT---CGKGYRQRLVSC-SEIYTGKENYEYSYQTTVNCPGAQPPSVHPCYLRDCPVSATWR 1097          

HSP 5 Score: 53.9138 bits (128), Expect = 1.005e-6
Identity = 54/198 (27.27%), Postives = 77/198 (38.89%), Query Frame = 3
Query: 1233 RWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQN--QSVGLEKCDSTRKPV--YECYNAEC-----------------RVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSCNP 1763
             W  GDWS+C V+C   G + R V C+  + R    LSD  C     P+P    + P    C  W        QC+  C    + R +   KCI       V    C++  +P    +C  A C                 R +W+   WT CS TCGK G + RY+ C  E+  +   + C  +   V +   S  P
Sbjct:  474 HWKTGDWSECLVTC-GKGHKHRQVWCQFGEDR----LSDRMCDPEAKPEPMQTCQQPE---CAAWQAGP--WGQCSVTCGQGYQLRAV---KCIMGTYMSVVDDNDCNAATRPTDTQDCELASCHPSILALEPRRNAQSIPRTQWRFGSWTPCSATCGK-GTRMRYVSCRDEDGSVADESACATLPKPVAKEECSVTP 657          
BLAST of ADAMTS-like protein 3 vs. Ensembl Mouse
Match: Adamts9 (a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 9 [Source:MGI Symbol;Acc:MGI:1916320])

HSP 1 Score: 73.559 bits (179), Expect = 9.048e-13
Identity = 121/510 (23.73%), Postives = 188/510 (36.86%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYV---------------WKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAAC---YAKGLVPPASWRQCFDHIDPKKCFKKSEFLPEIISEKRTLVQMRRVEKLNLQVGQISYVFPGT-RLTLNCPVKNFLSSNLIWGHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEW----RCLAGNISDSIVIKSKSPSDGYKDWAIRNSISNKDMPNELVQLDMMQ-ENHVRWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLE-KCDSTRKPVYE--CYNAECRV-EWKISEWTKCSRTCGKSGIQARYLICVWEN 1688
            W +CS TCG+G Q +   C   T   +  +  + C    +    T+ C    C    +               W+F  W+ CS TCG +G ++R V C    G V D+  C    KP +   C+   C   + A +W    V    C  G+  R + C++   +  VID  R+ C   Y        S   C         F+  +F P   S  RT V      +        S    G+ R  + C  +N  ++N      K          +  R    G     ++     G W    +   G +   +V+  ++  D + D     S    D P +  Q +         W  G WS CSVSC   G + R V C +        L  D C  +  PKP   R C          +K    +QC+  C    + R +G   C         E +C S  +P  E  C  + C +  W+  +W +C++TCG+ G + R ++CV E+
Sbjct: 1116 WGQCSVTCGQGYQLRAVKCIMGTYMSV--VDDNDCNAATR-PTDTQDCELASCHPSILALEPRRNAQSIPRTQWRFGSWTPCSATCG-KGTRMRYVSCRDEDGSVADESACATLPKPVAKEECSVTPCG-QWKALDWSSCSVT---CGQGKATRQVVCVNY--SDHVID--RSECDPDYIPETDQDCSMSPCPQWTGLAHPFQNEDFRPRSDSPSRTHVLGGNQWRTGPWGACSSTCAGGSQRRVVVCQDENGYTANDCVERIK---------PDEQRACESGPCPQWAY-----GSWGECTKLCGGGMRTRLVVCQRANGDRFPDL----SCEVLDKPTDREQCNTHACPQDAAWSTGPWSSCSVSC-GRGHKHRNVYCLAKDGS---HLESDNC--KHLPKPHGHRRCRGGR---CPRWKAGAWSQCSVSCGQGVQQRHVG---CQIGTHKAARESECSSYSRPESERVCQASPCPLYTWRAEQWQQCTKTCGE-GSRYRQVVCVAED 1582          

HSP 2 Score: 64.3142 bits (155), Expect = 7.247e-10
Identity = 57/180 (31.67%), Postives = 80/180 (44.44%), Query Frame = 3
Query: 1146 KDWAIRNSISNKDMPNELVQLDMMQENHVRWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQS-VGLEKCDSTRKPV--YECYNAECRVEWKISEWTKCSRTCGKSGIQARYLIC 1676
            KD +   S + K +P              RW  G WSQCSVSC   G Q R V C   Q   +    + EC      +P ++R C +  PCP + ++     QCT  C    + R +    C+ ++QS V    CDS ++P     C    C   W   EW++CS TCGK G + R + C
Sbjct: 1467 KDGSHLESDNCKHLPKPHGHRRCRGGRCPRWKAGAWSQCSVSC-GQGVQQRHVGC---QIGTHKAARESECSSYS--RPESERVC-QASPCPLYTWRAEQWQQCTKTCGEGSRYRQV---VCVAEDQSEVHSTHCDSDQRPPDRESCSLQPCEYVWITGEWSECSVTCGK-GYRQRLVSC 1635          

HSP 3 Score: 62.7734 bits (151), Expect = 1.752e-9
Identity = 53/187 (28.34%), Postives = 82/187 (43.85%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGK---------VIDLPRA------ACYAKGLVPPASWR 758
            WS+CS +CG+GVQ++   C   T          +C    + + + RVC    C   Y W+   W +C+ TCG EG + R+V C       V    CD +++P     C+   C   ++  EW +  V    C  G ++R +SC S + TGK          ++ P A       CY +     A+WR
Sbjct: 1502 WSQCSVSCGQGVQQRHVGCQIGTHKAARE---SECSSYSRPE-SERVCQASPCPL-YTWRAEQWQQCTKTCG-EGSRYRQVVCVAEDQSEVHSTHCDSDQRPPDRESCSLQPCEYVWITGEWSECSVT---CGKGYRQRLVSC-SEIYTGKENYEYSYQTTVNCPGAQPPSVHPCYLRDCPVSATWR 1678          

HSP 4 Score: 56.6102 bits (135), Expect = 1.316e-7
Identity = 44/144 (30.56%), Postives = 70/144 (48.61%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCL 674
            W++CS +C  G Q +   C      ++++    KC H  + KV  + CN   C +   WK  DWS+C  TCG +G + R+V C     ++ D+ MCD   KP+ ++ C +  C   + A  W +  V    C  G Q R + C+
Sbjct: 1006 WTECSRSCDGGTQRRRAICVNTRNDVLDD---SKCTH--QEKVVVQSCNEFSCPH---WKTGDWSECLVTCG-KGHKHRQVWCQFGEDRLSDR-MCDPEAKPEPMQTCQQPECAA-WQAGPWGQCSVT---CGQGYQLRAVKCI 1135          

HSP 5 Score: 54.299 bits (129), Expect = 7.056e-7
Identity = 50/174 (28.74%), Postives = 77/174 (44.25%), Query Frame = 3
Query: 1233 RWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTI----------GDLKCIFQNQSVGLEKCDSTRKPVYECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVW-ENSKLPAGNLCYL 1721
            +W  G W  CS +C   G Q R+V C   Q    Y  +D  CV+R+  KP  +R C  + PCPQW + +    +CT  C G  + R +           DL C   ++    E+C++   P            W    W+ CS +CG+ G + R + C+  + S L + N  +L
Sbjct: 1327 QWRTGPWGACSSTCAG-GSQRRVVVC---QDENGYTAND--CVERI--KPDEQRAC-ESGPCPQWAYGS--WGECTKLCGGGMRTRLVVCQRANGDRFPDLSCEVLDKPTDREQCNTHACPQ--------DAAWSTGPWSSCSVSCGR-GHKHRNVYCLAKDGSHLESDNCKHL 1480          

HSP 6 Score: 54.299 bits (129), Expect = 7.812e-7
Identity = 55/202 (27.23%), Postives = 79/202 (39.11%), Query Frame = 3
Query: 1233 RWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQN--QSVGLEKCDSTRKPV--YECYNAEC-----------------RVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSCNPPKCN 1775
             W  GDWS+C V+C   G + R V C+  + R    LSD  C     P+P    + P    C  W  +     QC+  C    + R +   KCI       V    C++  +P    +C  A C                 R +W+   WT CS TCGK G + RY+ C  E+  +   + C    L  P   + C+   C 
Sbjct: 1055 HWKTGDWSECLVTC-GKGHKHRQVWCQFGEDR----LSDRMCDPEAKPEPMQTCQQPE---CAAW--QAGPWGQCSVTCGQGYQLRAV---KCIMGTYMSVVDDNDCNAATRPTDTQDCELASCHPSILALEPRRNAQSIPRTQWRFGSWTPCSATCGK-GTRMRYVSCRDEDGSVADESAC--ATLPKPVAKEECSVTPCG 1240          

HSP 7 Score: 52.373 bits (124), Expect = 2.694e-6
Identity = 50/168 (29.76%), Postives = 75/168 (44.64%), Query Frame = 3
Query: 1236 WVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKREC-------------PR----NFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEK-CDSTRKPVY--ECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICV 1679
            W  G W QCSV+C   G+Q R V+C  +   +   + D++C    A +P   ++C             PR    + P  QW F +     C+  C    + R +    C  ++ SV  E  C +  KPV   EC    C  +WK  +W+ CS TCG+ G   R ++CV
Sbjct: 1111 WQAGPWGQCSVTC-GQGYQLRAVKC--IMGTYMSVVDDNDC--NAATRPTDTQDCELASCHPSILALEPRRNAQSIPRTQWRFGS--WTPCSATCGKGTRMRYV---SCRDEDGSVADESACATLPKPVAKEECSVTPCG-QWKALDWSSCSVTCGQ-GKATRQVVCV 1266          
BLAST of ADAMTS-like protein 3 vs. UniProt/SwissProt
Match: sp|P90884|MADD4_CAEEL (Protein madd-4 OS=Caenorhabditis elegans OX=6239 GN=madd-4 PE=1 SV=5)

HSP 1 Score: 149.058 bits (375), Expect = 1.554e-35
Identity = 154/627 (24.56%), Postives = 244/627 (38.92%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVYLIENI--PMDKCEHIPKIKV----TTRVC------NYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYH-SSGQVVDQEMCDENKKP-KSLRGCNRYNCPPNFLAKEWKKKCVKISDCS----PGQQRRDLSCLSLLNTGKVIDL-------------PRAACYAKGLVPPASW------------------RQ-------------------CFDHIDPKK---CFKKSEFLPEIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIW--GHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIKSKSPSDGYKDWAI------------------RNSISNKDMPNE-----------LVQLDMMQENH---------------VRWVIGDWSQC-SVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDH-CIGYEKARTIGDLKCIFQN-QSVGLEKCDSTRKPV--YECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSC 1757
            WS CS+TCG GV  +   C          I  PM +C+   + K+      R C         + E  Y W++ DW++CS +C   G Q   ++C   S+G+ V    CD  ++P +  R CN++ CPP +L         K SDCS     G  RR + C   ++     D              P+       +  PA+W                  RQ                   C  +  P+    C   S   PE++S  R   Q    +KL L +G ++ ++ GT + + CP K F    + W    KKI      K+   I+V+  G L +    ++D G + C    +  ++ +  K     Y+D+                    R  +S +D+  E           L++  +   N                 RW IG WS+C   +C   G+Q+R + C+         + +  C    + +P   R C R   CP+W       ++C+   C+    A+   ++ C F N  SV ++ CD T +P    +C N  C+ EW+ S+W  CS  CG  G+Q R L CVW +S  PAG  C    +  P   ++C
Sbjct:  384 WSTCSSTCGTGVMSRTVECVAVNPISSAPIKLPMSECQDQEQPKLFESCEVRSCPLQEDSKLSEDEAPYQWRYGDWTQCSASC-LGGKQKAALKCIQVSTGKSVQWSQCDARRRPPEKSRPCNQHPCPPFWLTS-------KYSDCSMSCGSGTARRSVKCAQTVSKTDGADAHIVLRDDRCHFKKPQETETCNVVACPATWVTAQWTECSRSCDSGERRRQVWCEIRDSRGKTQRRPDVECDANTKPQTVEVCSFGSCSRPELLS-NRVFEQNAEQKKLTLGIGGVATLYQGTSIKIKCPAKKFDKKKIYWKKNGKKI------KNDAHIKVSANGNLRVFHARMEDAGVYECFTDRLQGNVTLNFK-----YRDFPASRVDLAPKPQIPSTKNRQRVQVSKEDVLREQASVLHKMNVSLIEALLTAPNDEKAREQLRKYGNELVARWDIGHWSECRQKTCHVAGYQARGISCKVTFHGEIRNVDNSICESLASVRPPETRPCHRE-DCPRWEASQ--WSECSSQRCVSSMLAQKRRNVTCRFTNGTSVDIQHCDITNRPATTMDCPNQNCKAEWRTSDWGSCSSECGTGGVQLRLLSCVWISSGRPAGRNCE--QMRRPHSARAC 985          

HSP 2 Score: 56.9954 bits (136), Expect = 7.029e-7
Identity = 60/212 (28.30%), Postives = 90/212 (42.45%), Query Frame = 3
Query: 1221 ENHVRW-----VIGDWSQCSVSCENTGFQSRMVRCESLQ--KRFYYQLSDDECVQRVAPKPFAK---RECP--------RNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCI--FQNQSVGLEKCDSTRKPVYE---CYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLI-----NLEVPQVLKSCNPPKC 1772
            +NH  W     V G+WS CS +C  TG  SR V C ++        +L   EC  +  PK F     R CP         +    QW +   +  QC+  C+G    +    LKCI     +SV   +CD+ R+P  +   C    C   W  S+++ CS +CG SG   R + C    SK    +   ++     + + PQ  ++CN   C
Sbjct:  369 DNHNDWQAPRLVAGEWSTCSSTC-GTGVMSRTVECVAVNPISSAPIKLPMSECQDQEQPKLFESCEVRSCPLQEDSKLSEDEAPYQWRYG--DWTQCSASCLG---GKQKAALKCIQVSTGKSVQWSQCDARRRPPEKSRPCNQHPCPPFWLTSKYSDCSMSCG-SGTARRSVKCAQTVSKTDGADAHIVLRDDRCHFKKPQETETCNVVAC 573          
BLAST of ADAMTS-like protein 3 vs. UniProt/SwissProt
Match: sp|P82987|ATL3_HUMAN (ADAMTS-like protein 3 OS=Homo sapiens OX=9606 GN=ADAMTSL3 PE=1 SV=4)

HSP 1 Score: 119.783 bits (299), Expect = 3.660e-26
Identity = 91/304 (29.93%), Postives = 136/304 (44.74%), Query Frame = 3
Query:  231 EIDIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYH--SSGQVVD--QEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACY---AKGLVPPASWRQCFDHIDPKKCFKKSEFLPEIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWGHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIK 1121
             +  W  CS TCG G+Q +   C           P ++C    +     + CN  DC  G  W   +W +CS TCG  G Q R V C    + G  ++   E+C +  K  S + C R +CPP+    +W K  V    C  G QRR   C  L   G+ I L    C       LV      +C   I  +   K  E  P+I+S +R  +Q R  +++NL +G  +Y+ P T + + CPV+ F  S + W  K        K   R+ +T+ G L I      D G +RC+AG+  +++V+K
Sbjct:  708 HVGSWGPCSATCGVGIQTRDVYCLHPGE---TPAPPEECRD--EKPHALQACNQFDCPPG--WHIEEWQQCSRTCG-GGTQNRRVTCRQLLTDGSFLNLSDELC-QGPKASSHKSCARTDCPPHLAVGDWSKCSV---SCGVGIQRRKQVCQRLAAKGRRIPLSEMMCRDLPGLPLVRSCQMPEC-SKIKSEMKTKLGEQGPQILSVQRVYIQTREEKRINLTIGSRAYLLPNTSVIIKCPVRRFQKSLIQW-EKDGRCLQNSK---RLGITKSGSLKIHGLAAPDIGVYRCIAGSAQETVVLK 994          

HSP 2 Score: 75.485 bits (184), Expect = 1.489e-12
Identity = 95/428 (22.20%), Postives = 165/428 (38.55%), Query Frame = 3
Query:  813 PEIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWGHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGN-----ISDSIV--IKSKSPSD------GYKDWAIRNSISNKDMPNELVQLDMMQENHVRWVIGDWSQCSVSCENTGFQSRMVR---------------CESLQK---------------RFYYQL----------------------SDDECVQRVAPKPFAKRECPR------NFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEKCDSTRKPVYE--CYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSCNPPKCNLKCVDMHPSCKRKKE--YCRMGIYSFSCCKTCQE 1871
            P I+S +R + +      L++ VG I     G  +T+ CPVK     N+ W  +       G     + +   G L++++  ++++G + C+A N     ++ S++  ++ + P        G+K + I  + + +   N+       QE    W  G+WS CS +C + G  +R+ R               C+ LQK               R++  +                        +  VQ V+P+  A ++ P         PC QW       N+C   C+G  +A  +       Q+ S     CD  ++P     C +  C V W    W  C+  CG+ G Q+R + C+   S  P     + +  + P   + C  P C+  C D    C   K    C +  Y   CC++CQE
Sbjct: 1284 PVILSVERNITKPEH-NHLSVVVGGIVEAALGANVTIRCPVKGVPQPNITWLKRG------GSLSGNVSLLFNGSLLLQNVSLENEGTYVCIATNALGKAVATSVLHLLERRWPESRIVFLQGHKKY-ILQATNTRTNSNDPTGEPPPQEPF--WEPGNWSHCSATCGHLG--ARIQRPQCVMANGQEVSEALCDHLQKPLAGFEPCNIRDCPARWFTSVWSQCSVSCGEGYHSRQVTCKRTKANGTVQVVSPRACAPKDRPLGRKPCFGHPCVQWEPG----NRCPGRCMG--RAVRMQQRHTACQHNSSD-SNCDDRKRPTLRRNCTSGACDVCWHTGPWKPCTAACGR-GFQSRKVDCIHTRSCKPVAKR-HCVQKKKPISWRHCLGPSCDRDCTDTTHYCMFVKHLNLCSLDRYKQRCCQSCQE 1690          

HSP 3 Score: 60.4622 bits (145), Expect = 7.261e-8
Identity = 36/120 (30.00%), Postives = 55/120 (45.83%), Query Frame = 3
Query:  417 WKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKP-KSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLVPPASWRQCFDH 773
            W+  +WS CS TCG+ G +++  +C  ++GQ V + +CD  +KP      CN  +CP  +    W +  V    C  G   R ++C      G V  +   AC  K    P   + CF H
Sbjct: 1428 WEPGNWSHCSATCGHLGARIQRPQCVMANGQEVSEALCDHLQKPLAGFEPCNIRDCPARWFTSVWSQCSV---SCGEGYHSRQVTCKRTKANGTVQVVSPRACAPKDR--PLGRKPCFGH 1542          
BLAST of ADAMTS-like protein 3 vs. UniProt/SwissProt
Match: sp|Q8BLI0|ATL1_MOUSE (ADAMTS-like protein 1 OS=Mus musculus OX=10090 GN=Adamtsl1 PE=2 SV=2)

HSP 1 Score: 100.908 bits (250), Expect = 2.411e-20
Identity = 97/360 (26.94%), Postives = 142/360 (39.44%), Query Frame = 3
Query:  183 DGQSIGNRPIGKAFLEEIDIWSKCSTTCGEGVQEKLQACFKKTV----------------YLIENIPMDKCE--------------------HIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYH--SSGQVVD--QEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLVPP----ASWRQCFDHIDPKKCFKKSEFLPEIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIW---GHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIK 1121
            DG   G + + + +  E + ++KCS +CG GVQE + +C  K                   L+++  +D C                     H PK   T + CN  +C     W    W  CS TCG  GIQ R+V C    + G  ++  +  C  +K P S +GC + +CP  +L  EW +  V    C  G Q R   C  +L TG    +    C      PP    +S R C      +     ++  P I + +   +Q RR  KL+  VG  +Y+ P T + L CP + F    + W   G   I       S   + V   G L I      D G + C AG   +  VIK
Sbjct:  596 DGLLGGLQDLDELYDWEYEGFTKCSESCGGGVQEAVVSCLNKQTRELADENLCVTSRRPPQLLKSCNLDPCPASHLLSREMNEVVVLADELCHHPK-PSTVQACNRFNCPP--AWYPAQWQLCSRTCG-GGIQKRDVLCKQRMADGSFLELPETFCSASK-PTSHQGCKKDDCPSEWLLSEWSECSVS---CGEGTQTRSAICQRVLKTGVSTVVNSTLC------PPLPFSSSIRPCMLATCARPGRPSTKHSPHIAAARNIYIQTRRQRKLHFVVGGFAYLLPKTTVVLRCPTRRFRKPLITWEKDGQHSI-------SSAHVTVAPFGYLKIHRLKPSDAGIYTCSAGPAREQFVIK 934          

HSP 2 Score: 89.3521 bits (220), Expect = 9.399e-17
Identity = 94/369 (25.47%), Postives = 156/369 (42.28%), Query Frame = 3
Query:  879 VGQISYVFPGTRLTLNCPVKNFLSSNLIWGHKKIEYFYKGKSKNRIRVTRKGKLI-IKSFLIQDQGEWRCLAGNISDSIVIKSKSPSDGYKDWAI------RNSISNKDMPNE----LVQLDMMQENH--------------------VRWVIGDWSQCSVSCENTGFQSRMVRCESLQKR-FYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQ-SVGLEKCDSTRKPV--YECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVW--ENSKLPAGNLCYLINLEVPQVLKSCNPPKC-NLKCVDMHPSCK--RKKEYCRMGIYSFSCCKTC 1865
            +G    + PG    L CP+K   + N+ W              + I     G+++ + +     QGE+ CLA N + +++ K+      Y  W++        S  N+ +       L+    +   H                     RW++  WS C+ SC   G Q+R V C+ L+       +S+D C Q +A +P   + C +   C +W F +    QC   CIG   A     + C  ++  ++  E+C +  +PV    C++  C V W++S WT C+ TCG  G Q+R + CV    N  +P  +LC       P   + CN   C N +C D    C+  R+ + C++G +   CC TC
Sbjct: 1385 LGTQLVLDPGNSALLGCPIKGHPTPNITWFQNGQPIATAPGLTHHI--WGAGQILRVANLSGGPQGEFSCLAQNEAGTLLQKASLVIQDYW-WSVDRLATCSASCGNRGIHQPRLRCLLNTTEVDPEHCTGKPRPAVQPVACNRRDCPSRWMVTSWSACTRSC-GGGVQTRRVTCQKLKASGISTPVSNDMCSQ-LAKRPVDTQACNQQL-CVEWAFSS--WGQCNGPCIGPRLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLWTLCTATCGNYGFQSRRVECVHVRTNKAVPE-HLCSWG--PRPANWQRCNVTPCENTECRDTTRYCEKVRQLKLCQLGQFRSRCCGTC 1742          

HSP 3 Score: 70.0922 bits (170), Expect = 7.122e-11
Identity = 65/250 (26.00%), Postives = 106/250 (42.40%), Query Frame = 3
Query:  177 LFDGQSIGNRPIGKAFLEEIDIWSKCSTTCGEGVQEKLQAC-----FKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDC---------ENG-------------YVWKFTDWSKCSHTCGYEGIQLREVECYH-SSGQVVDQEMC-----------------------------------DE---NKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYA 728
            L +G ++   P   +F+ E   WS C+ TCG G Q ++  C     F ++V    ++P D+CE  PK   + R C  G C         +NG             Y W++  ++KCS +CG  G+Q   V C +  + ++ D+ +C                                   DE   + KP +++ CNR+NCPP +   +W + C +   C  G Q+RD+ C   +  G  ++LP   C A
Sbjct:  514 LEEGAAVSEEP---SFIPEA--WSACTVTCGVGTQVRIIRCQVLLPFSQSV---ADLPADECEG-PK-PASQRACYAGPCNGETPEFNPDNGDGLLGGLQDLDELYDWEYEGFTKCSESCG-GGVQEAVVSCLNKQTRELADENLCVTSRRPPQLLKSCNLDPCPASHLLSREMNEVVVLADELCHHPKPSTVQACNRFNCPPAWYPAQW-QLCSRT--CGGGIQKRDVLCKQRMADGSFLELPETFCSA 749          

HSP 4 Score: 61.6178 bits (148), Expect = 3.149e-8
Identity = 133/544 (24.45%), Postives = 205/544 (37.68%), Query Frame = 3
Query:  231 EIDIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIP---KIKVTTRVCNYGDC--ENGY-------------VWKFTDWSKCSHTCGYEGIQLREVECYHSS--GQV--VDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSL--LNTGKVIDLPRAACYAKGLVPPASWRQCFDHIDPKKCFKKSEFLPEIISEKRTLVQMRRVEKLNLQVGQISYVFPG-TRLTLNCPVKNFLSSNLIWGHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIKSKSPSDGYKDWAIRNSISNKDMPNELVQLDMMQENHVRWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDE-CVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEKCDSTRKPVYECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSCNPPKCNLKC 1784
            E D +  CS TCG G Q     C+      +  +    C + P   K K   + CN   C   +GY              W+ T W+ CS +CG  GIQ R V C      G V  V++  C    K   ++ CN ++C P +LA+EW    V    C  G + R + C+    ++TG         C AK    P    +C   I P  C+K  E LP I ++     Q + +E+      + S++    +  T+ C V                         ++R+ R   L+  S  + D     C  G    S       P +G  +    N  +   +   L  LD + +    W    +++CS SC   G Q  +V C + Q R   +L+D+  CV    P P   + C  + PCP  +  +  +N+             + D  C     S            V  C    C   W  ++W  CSRTCG  GIQ R ++C     ++  G+      LE+P+   S + P  +  C
Sbjct:  303 ETDFF-PCSATCGGGYQLTSAECYDLRSNRV--VADQYCHYYPENVKPKPKLQECNLDPCPASDGYKQIMPYDLYHPLPRWEATPWTACSSSCG-GGIQSRAVSCVEEDIQGHVTSVEEWKCMYTPKMPVVQPCNIFDC-PKWLAQEWSPCTVT---CGQGLRYRVVLCIDHRGMHTG--------GCSAK--TKPHIKEEC---IIPTPCYKPREKLP-IEAKLPWFKQAQELEEGAAVSEEPSFIPEAWSACTVTCGV-----------------------GTQVRIIRCQVLLPFSQSVADLPADEC-EGPKPASQRACYAGPCNG--ETPEFNPDNGDGLLGGLQDLDELYD----WEYEGFTKCSESC-GGGVQEAVVSCLNKQTR---ELADENLCVTSRRP-PQLLKSCNLD-PCPASHLLSREMNEVV----------VLADELCHHPKPST-----------VQACNRFNCPPAWYPAQWQLCSRTCG-GGIQKRDVLC---KQRMADGSF-----LELPETFCSASKPTSHQGC 758          

HSP 5 Score: 54.299 bits (129), Expect = 4.789e-6
Identity = 36/128 (28.12%), Postives = 54/128 (42.19%), Query Frame = 3
Query:  234 IDIWSKCSTTCGEGVQEKLQACFK-KTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTC--GYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEW 608
            +  WS C+ +CG GVQ +   C K K   +   +  D C  + K  V T+ CN   C     W F+ W +C+  C      +Q R+V C    G  +  E C    +P S + C    C  ++    W
Sbjct: 1534 VTSWSACTRSCGGGVQTRRVTCQKLKASGISTPVSNDMCSQLAKRPVDTQACNQQLCVE---WAFSSWGQCNGPCIGPRLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLW 1658          
BLAST of ADAMTS-like protein 3 vs. UniProt/SwissProt
Match: sp|Q8N6G6|ATL1_HUMAN (ADAMTS-like protein 1 OS=Homo sapiens OX=9606 GN=ADAMTSL1 PE=1 SV=4)

HSP 1 Score: 98.2117 bits (243), Expect = 1.932e-19
Identity = 89/312 (28.53%), Postives = 130/312 (41.67%), Query Frame = 3
Query:  231 EIDIWSKCSTTCGEGVQEKLQAC-------FKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYH--SSGQVVD--QEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLVPP----ASWRQCFDHIDPKKCFKKSEFLPEIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWGHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIK 1121
            EI  WS CS TCG G+Q +   C         +TV L + +    C   PK   T + CN  +C     W    W  CS TCG  G+Q REV C    + G  ++  +  C  +K P   + C + +CP  +L  +W + C   + C  G Q R   C  +L TG    +    C      PP    +S R C      +     ++  P I + ++  +Q RR  KL+  VG  +Y+ P T + L CP +      + W  K  ++     S   + V   G L I      D G + C AG   +  VIK
Sbjct:  671 EIGKWSPCSLTCGVGLQTRDVFCSHLLSREMNETVILADEL----CRQ-PK-PSTVQACNRFNCPP--AWYPAQWQPCSRTCG-GGVQKREVLCKQRMADGSFLELPETFCSASK-PACQQACKKDDCPSEWLLSDWTE-CS--TSCGEGTQTRSAICRKMLKTGLSTVVNSTLC------PPLPFSSSIRPCMLATCARPGRPSTKHSPHIAAARKVYIQTRRQRKLHFVVGGFAYLLPKTAVVLRCPARRVRKPLITW-EKDGQHLI---SSTHVTVAPFGYLKIHRLKPSDAGVYTCSAGPAREHFVIK 959          

HSP 2 Score: 95.1301 bits (235), Expect = 1.451e-18
Identity = 98/372 (26.34%), Postives = 156/372 (41.94%), Query Frame = 3
Query:  867 LNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWGHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIKSKSPSDGYKDWAI-RNSISNKDMPNELVQ-------LDMMQENHV----------------------RWVIGDWSQCSVSCENTGFQSRMVRCESLQKR-FYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQ-SVGLEKCDSTRKPV--YECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWE--NSKLPAGNLCYLINLEVPQVLKSCNPPKC-NLKCVDMHPSCKRKKE--YCRMGIYSFSCCKTC 1865
            L   +G    + PG    L CP+K     N+ W H            + I    +  L + +     QGE+ CLA N +  ++ K+      Y  W++ R +  +    N  VQ       L+  + N                        RW++  WS C+ SC   G Q+R V C+ L+       +S+D C Q VA +P   + C +   C +W F +    QC   CIG   A     + C  ++  ++  E+C +  +PV    C++  C V W++S WT C+ TCG  G Q+R + CV    N  +P  +LC       P   + CN   C N++C D    C++ K+   C++  +   CC TC
Sbjct: 1398 LTSPLGTQLVLDPGNSALLGCPIKGHPVPNITWFHGGQPIVTATGLTHHILAAGQ-ILQVANLSGGSQGEFSCLAQNEAGVLMQKASLVIQDYW-WSVDRLATCSASCGNRGVQQPRLRCLLNSTEVNPAHCAGKVRPAVQPIACNRRDCPSRWMVTSWSACTRSC-GGGVQTRRVTCQKLKASGISTPVSNDMCTQ-VAKRPVDTQACNQQL-CVEWAFSS--WGQCNGPCIGPHLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLWTLCTATCGNYGFQSRRVECVHARTNKAVPE-HLCSWG--PRPANWQRCNITPCENMECRDTTRYCEKVKQLKLCQLSQFKSRCCGTC 1759          

HSP 3 Score: 82.4185 bits (202), Expect = 1.096e-14
Identity = 57/188 (30.32%), Postives = 91/188 (48.40%), Query Frame = 3
Query:  183 DGQSIGNRPIGKAFLEEIDIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYH------SSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYA 728
            DG   G +   + +  E + ++KCS +CG GVQE + +C  K     E    + C    +     + CN   C     W+   WS CS TCG  G+Q R+V C H      +   ++  E+C +  KP +++ CNR+NCPP +   +W + C +   C  G Q+R++ C   +  G  ++LP   C A
Sbjct:  596 DGLFGGLQDFDELYDWEYEGFTKCSESCGGGVQEAVVSCLNKQTR--EPAEENLCVTSRRPPQLLKSCNLDPCP--ARWEIGKWSPCSLTCGV-GLQTRDVFCSHLLSREMNETVILADELCRQ-PKPSTVQACNRFNCPPAWYPAQW-QPCSRT--CGGGVQKREVLCKQRMADGSFLELPETFCSA 774          

HSP 4 Score: 62.3882 bits (150), Expect = 1.816e-8
Identity = 55/169 (32.54%), Postives = 79/169 (46.75%), Query Frame = 3
Query: 1188 PNELVQLDMMQENHVRWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQ---LSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGL-EKCDSTRKPV--YECYNAECRVEWKISEWTKCSRTCGKSGIQARYLIC 1676
            P +L++   +     RW IG WS CS++C   G Q+R V C  L  R   +   L+D+ C Q   PKP   + C R F CP   +       C+  C G  + R +   + +     + L E   S  KP     C   +C  EW +S+WT+CS +CG+ G Q R  IC
Sbjct:  654 PPQLLKSCNLDPCPARWEIGKWSPCSLTC-GVGLQTRDVFCSHLLSREMNETVILADELCRQ---PKPSTVQACNR-FNCPPAWYP-AQWQPCSRTCGGGVQKREVLCKQRMADGSFLELPETFCSASKPACQQACKKDDCPSEWLLSDWTECSTSCGE-GTQTRSAIC 815          

HSP 5 Score: 59.3066 bits (142), Expect = 1.694e-7
Identity = 53/199 (26.63%), Postives = 90/199 (45.23%), Query Frame = 3
Query:  177 LFDGQSIGNRPIGKAFLEEIDIWSKCSTTCGEGVQEKLQAC-----FKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDC----------------------ENGYVWKFTDWSKCSHTCGYEGIQLREVECYH-SSGQVVDQEMCDENKKPKS-LRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLN 686
            L +G ++   P   +F+ E   WS C+ TCG G Q ++  C     F ++V    ++P+D+CE  PK   + R C  G C                      +  Y W++  ++KCS +CG  G+Q   V C +  + +  ++ +C  +++P   L+ CN   CP  +   +W    +    C  G Q RD+ C  LL+
Sbjct:  514 LEEGAAVSEEP---SFIPEA--WSACTVTCGVGTQVRIVRCQVLLSFSQSV---ADLPIDECEG-PK-PASQRACYAGPCSGEIPEFNPDETDGLFGGLQDFDELYDWEYEGFTKCSESCG-GGVQEAVVSCLNKQTREPAEENLCVTSRRPPQLLKSCNLDPCPARWEIGKWSPCSLT---CGVGLQTRDVFCSHLLS 698          

HSP 6 Score: 58.151 bits (139), Expect = 3.761e-7
Identity = 135/561 (24.06%), Postives = 210/561 (37.43%), Query Frame = 3
Query:  231 EIDIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIP---KIKVTTRVCNYGDC--ENGYV-------------WKFTDWSKCSHTCGYEGIQLREVECYHSS--GQV--VDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSL--LNTGKVIDLPRAACYAKGLVPPASWRQCFDHIDPKKCFKKSEFLPEIISEKRTLVQMRRVEKLNLQVGQISYVFPG-TRLTLNCPVKNFLSSNLIWGHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQD-----------QGEWRCLAGNISDSIVIKSKSPSDGYKDWAIRNSISNKDMPNELVQLDMMQENHVRWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCP-QWNFKNVNLNQCTDHCIGYEKARTI--GDLKCIFQNQSVGLEKCDSTRKP----VYECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSCNPPKCNLKC 1784
            E D +  CS TCG G Q     C+      +  +    C + P   K K   + CN   C   +GY              W+ T W+ CS +CG  GIQ R V C      G V  V++  C    K    + CN ++C P +LA+EW    V    C  G + R + C+    ++TG         C  K    P    +C   I P  C+K  E LP + ++     Q + +E+      + S++    +  T+ C V                         ++R+ R   L+  S  + D             +  C AG  S  I   +   +DG              +   L   D + +    W    +++CS SC   G Q  +V C  L K+      ++ CV    P P   + C  + PCP +W       + C+  C    + R +    L     N++V L   +  R+P    V  C    C   W  ++W  CSRTCG  G+Q R ++C     ++  G+      LE+P+   S + P C   C
Sbjct:  303 ETDFF-PCSATCGGGYQLTSAECYDLRSNRV--VADQYCHYYPENIKPKPKLQECNLDPCPASDGYKQIMPYDLYHPLPRWEATPWTACSSSCG-GGIQSRAVSCVEEDIQGHVTSVEEWKCMYTPKMPIAQPCNIFDC-PKWLAQEWSPCTVT---CGQGLRYRVVLCIDHRGMHTG--------GCSPK--TKPHIKEEC---IVPTPCYKPKEKLP-VEAKLPWFKQAQELEEGAAVSEEPSFIPEAWSACTVTCGV-----------------------GTQVRIVRCQVLLSFSQSVADLPIDECEGPKPASQRACYAGPCSGEIPEFNPDETDG--------------LFGGLQDFDELYD----WEYEGFTKCSESC-GGGVQEAVVSC--LNKQTREPAEENLCVTSRRP-PQLLKSCNLD-PCPARWEIG--KWSPCSLTCGVGLQTRDVFCSHLLSREMNETVILAD-ELCRQPKPSTVQACNRFNCPPAWYPAQWQPCSRTCG-GGVQKREVLC---KQRMADGSF-----LELPETFCSASKPACQQAC 783          

HSP 7 Score: 56.225 bits (134), Expect = 1.487e-6
Identity = 36/128 (28.12%), Postives = 55/128 (42.97%), Query Frame = 3
Query:  234 IDIWSKCSTTCGEGVQEKLQACFK-KTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTC--GYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEW 608
            +  WS C+ +CG GVQ +   C K K   +   +  D C  + K  V T+ CN   C     W F+ W +C+  C   +  +Q R+V C    G  +  E C    +P S + C    C  ++    W
Sbjct: 1551 VTSWSACTRSCGGGVQTRRVTCQKLKASGISTPVSNDMCTQVAKRPVDTQACNQQLCVE---WAFSSWGQCNGPCIGPHLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLW 1675          
BLAST of ADAMTS-like protein 3 vs. UniProt/SwissProt
Match: sp|Q9P2N4|ATS9_HUMAN (A disintegrin and metalloproteinase with thrombospondin motifs 9 OS=Homo sapiens OX=9606 GN=ADAMTS9 PE=1 SV=4)

HSP 1 Score: 86.6557 bits (213), Expect = 5.926e-16
Identity = 131/524 (25.00%), Postives = 201/524 (38.36%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVYLI--------ENIPMDK--CE----HIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLVPPASWRQCFDHIDPKKC---------FKKSEFLPEIISEKRTLVQMRRVEKLNLQVGQISYVFPGT-RLTLNCPVKNFLSSNLIWGHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEW----RCLAGNISDSIVIKSKSPSDGYKDWAIRNSISNKDMPNELVQLDMMQENH-VRWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLE-KCDSTRKPVYE--CYNAECRV-EWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLC 1715
            W +CS TCG+G Q +   C   T   +           P D   CE    H P     TR   Y        W+F  W+ CS TCG +G ++R V C   +G V D+  C    +P +   C+   C   + A +W    V    C  G+  R + C++   +  VID  R+ C    +  P + + C     P++          F+  ++ P   S  RT V      +        S    G+ R  + C  +N  ++N      K          +  R    G     ++     G W    +   G I   +V+  +S  + + D     S    D P +  Q +     H   W  G WS CSVSC   G + R V C +        L  D C  +   KP   R+C R   CP+W  K    +QC+  C    + R +G   C      +  E +C+   +P  E  C    C +  W+  EW +C++TCG+ G + R ++CV +N     G  C
Sbjct: 1116 WGQCSVTCGQGYQLRAVKCIIGTYMSVVDDNDCNAATRPTDTQDCELPSCHPPPAAPETRRSTYSAPRT--QWRFGSWTPCSATCG-KGTRMRYVSCRDENGSVADESACATLPRPVAKEECSVTPCG-QWKALDWSSCSVT---CGQGRATRQVMCVNY--SDHVID--RSECDQDYI--PETDQDCSMSPCPQRTPDSGLAQHPFQNEDYRPRSASPSRTHVLGGNQWRTGPWGACSSTCAGGSQRRVVVCQDENGYTANDCVERIK---------PDEQRACESGPCPQWAY-----GNWGECTKLCGGGIRTRLVVCQRSNGERFPDL----SCEILDKPPDREQCNTHACPHDAAWSTGPWSSCSVSC-GRGHKQRNVYCMAKDGS---HLESDYC--KHLAKPHGHRKC-RGGRCPKW--KAGAWSQCSVSCGRGVQQRHVG---CQIGTHKIARETECNPYTRPESERDCQGPRCPLYTWRAEEWQECTKTCGE-GSRYRKVVCVDDNKNEVHGARC 1595          

HSP 2 Score: 59.3066 bits (142), Expect = 1.564e-7
Identity = 49/153 (32.03%), Postives = 74/153 (48.37%), Query Frame = 3
Query: 1233 RWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKREC--PRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQS-VGLEKCDSTRKPV--YECYNAECRVEWKISEWTKCSRTCGKSGIQARYLIC 1676
            +W  G WSQCSVSC   G Q R V C+    +      + EC      +P ++R+C  PR   CP + ++     +CT  C    + R +    C+  N++ V   +CD +++PV    C    C   W   EW++CS TCGK G + R + C
Sbjct: 1500 KWKAGAWSQCSVSC-GRGVQQRHVGCQIGTHKI---ARETECNPYT--RPESERDCQGPR---CPLYTWRAEEWQECTKTCGEGSRYRKV---VCVDDNKNEVHGARCDVSKRPVDRESCSLQPCEYVWITGEWSECSVTCGK-GYKQRLVSC 1639          

HSP 3 Score: 59.3066 bits (142), Expect = 1.645e-7
Identity = 47/155 (30.32%), Postives = 71/155 (45.81%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENG----YVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGK 695
            WS+CS +CG GVQ++   C          I   K     +    TR  +  DC+      Y W+  +W +C+ TCG EG + R+V C   +   V    CD +K+P     C+   C   ++  EW +  V    C  G ++R +SC S + TGK
Sbjct: 1506 WSQCSVSCGRGVQQRHVGC---------QIGTHKIARETECNPYTRPESERDCQGPRCPLYTWRAEEWQECTKTCG-EGSRYRKVVCVDDNKNEVHGARCDVSKRPVDRESCSLQPCEYVWITGEWSECSVT---CGKGYKQRLVSC-SEIYTGK 1646          

HSP 4 Score: 56.225 bits (134), Expect = 1.384e-6
Identity = 45/144 (31.25%), Postives = 71/144 (49.31%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCL 674
            W++CS +C  G Q +   C      ++++    KC H  + KVT + C+   C     WK  DWS+C  TCG +G + R+V C     ++ D+ MCD   KP S++ C +  C  ++ A  W +  V    C  G Q R + C+
Sbjct: 1006 WTECSKSCDGGTQRRRAICVNTRNDVLDD---SKCTH--QEKVTIQRCSEFPCPQ---WKSGDWSECLVTCG-KGHKHRQVWCQFGEDRLNDR-MCDPETKPTSMQTCQQPEC-ASWQAGPWGQCSVT---CGQGYQLRAVKCI 1135          
BLAST of ADAMTS-like protein 3 vs. TrEMBL
Match: A0A183JCE1 (Ig-like domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS349 PE=4 SV=1)

HSP 1 Score: 426.787 bits (1096), Expect = 1.891e-136
Identity = 213/584 (36.47%), Postives = 333/584 (57.02%), Query Frame = 3
Query:  195 IGNRPIGKAFLEEIDIWSKCSTTCGEGVQEKLQACFKKTVYLIENI-PMDKCEHIPKIKVTT-----RVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSS--GQVVDQEM-----CDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLVPPASWRQCFDHIDPKKCFKKSEFLPEIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWGHKKIEYF-YKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIKSKSPSDGYKDWAIRNSISNKDMPNELVQLDMMQENHVRWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEKCDSTRKPVYECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSCNPPKCNLKCVDMHPSCKRKKEYCRMGIYSFSCCKTCQEYFKSTQKNQDN 1904
            +G   +   F    + WS CS  CG+GV+ +   C +   Y    +    +CEH+P           R C  G C  GY W+ ++W  CS TCG  GI  R+V+C +S   G +V  +      C   ++P+    CNR+ C P F+ ++W K C++   C PG+Q R LSC+S+   G + +LP AACY  G     +WR+CF+    +KC  K    P I ++  T+VQMR+V+ ++L+VGQ ++V P TR+T+ CPV+ F +  L W +       Y G   +RIRV ++G+L I+SF + D+G+W C+AG+++ ++ + +++P+ G+ DW  RN +  K M ++  +   +    ++WV+G WS CS SC  TG Q R+VRCE +  RFY  LSD  C+ ++ PKP + R+C  +  CP W  +N + + CTD C+   K    G+L C+   ++V  + CD   KP  EC N  C++ W +S W++CSR+CG  G+QAR+L+C W ++   AG+LCY   L +P V++SC  P C L CVDM   C ++ E C+  IY + CC++CQ Y +     +D+
Sbjct:   14 LGIDNVTPPFWMPSESWSSCSKECGDGVETRRFLCVQNDHYNATTLLDESQCEHLPNPSAQNTENNQRACKLGPCGKGYRWRVSNWGHCSQTCGGLGIMSRDVQCVYSGKDGDLVISDFDASYYCGNYRQPERHASCNRFACKPEFVPEKWGK-CIQSDPCRPGRQVRQLSCISVQVNGSLRELPMAACYMTGKTIQPTWRRCFEE-SSRKCDSKP---PMINTDTLTIVQMRKVKVIDLKVGQQAFVIPFTRVTVRCPVQYFTAQELQWANPNHGILAYTGAISDRIRVDKRGRLHIRSFRLIDEGDWTCIAGSMNATVTLTARTPAAGFHDWVQRNRLWTKGMLSDDPKAIAINHEIIQWVVGPWSTCSTSCGQTGQQFRVVRCEKVDSRFYQILSDQVCIDKLLPKPPSTRKCLESNKCPTWFVENRDTSVCTDRCLDVGKGSISGNLVCMIGERTVATKYCDKLDKPNMECENPICQLRWNVSNWSQCSRSCGGVGVQARHLLCTWSHNGELAGSLCYSHQLAIPDVIRSCEVPPCKLGCVDMSKHCSKRVELCKFTIYRYQCCQSCQRYVQMISSAKDS 592          
BLAST of ADAMTS-like protein 3 vs. TrEMBL
Match: A0A094ZL01 (ADAMTS-like protein 3 OS=Schistosoma haematobium OX=6185 GN=MS3_02878 PE=4 SV=1)

HSP 1 Score: 426.402 bits (1095), Expect = 2.233e-136
Identity = 212/579 (36.61%), Postives = 331/579 (57.17%), Query Frame = 3
Query:  210 IGKAFLEEIDIWSKCSTTCGEGVQEKLQACFKKTVYLIENI-PMDKCEHIPKIKVTT-----RVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSS--GQVVDQEM-----CDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLVPPASWRQCFDHIDPKKCFKKSEFLPEIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWGHKKIEYF-YKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIKSKSPSDGYKDWAIRNSISNKDMPNELVQLDMMQENHVRWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEKCDSTRKPVYECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSCNPPKCNLKCVDMHPSCKRKKEYCRMGIYSFSCCKTCQEYFKSTQKNQDN 1904
            +   F    + WS CS  CG+GV+ +   C +   Y    +    +CEH+P           R C  G C  GY W+ ++W  CS TCG  GI  R+V+C +S   G +V  +      C   ++P+    CNR+ C P F+ ++W K C++   C PG+Q R LSC+S+   G + +LP AACY  G     +WR+CF+    +KC  K    P I ++  T+VQMR+V+ ++L+VGQ ++V P TR+T+ CPV+ F +  L W +       Y G   +RIRV ++G+L I+SF + D+G+W C+AG+++ ++ + +++P+ G+ DW  RN +  K M ++  +   +    ++WV+G WS CS SC  TG Q R+VRCE +  RFY  LSD  C+ ++ PKP + R+C  +  CP W  +N + + CTD C+   K    G+L C+   ++V  + CD   KP  EC N  C++ W +S W++CSR+CG  G+QAR+L+C W ++   AG+LCY   L +P V++SC  P C L CVDM   C ++ E C+  IY + CC++CQ Y +     +D+
Sbjct:    7 VTPPFWMPSESWSSCSKECGDGVETRRFLCVQNDHYNATTLLDESQCEHLPNPSAQNTENNQRACKLGPCGKGYRWRVSNWGHCSQTCGGLGIMSRDVQCVYSGKDGDLVISDFDAFYYCGNYRQPERHASCNRFACKPEFVPEKWGK-CIQSDPCRPGRQVRQLSCISVQVNGSLRELPMAACYMTGKTIQPTWRRCFEE-SSRKCDSKP---PMINTDTLTIVQMRKVKVIDLKVGQQAFVIPFTRVTVRCPVQYFTAQELQWANPNHGILAYTGAISDRIRVDKRGRLHIRSFRLIDEGDWTCIAGSMNATVTLTARTPAAGFHDWVQRNRLWTKGMLSDDPKAIAINHEIIQWVVGPWSTCSTSCGQTGQQFRVVRCEKVDSRFYQILSDQVCIDKLLPKPPSTRKCLESNKCPTWFVENRDTSVCTDRCLDVGKGSISGNLVCMIGERTVATKYCDKLDKPNMECENPICQLRWNVSNWSQCSRSCGGVGVQARHLLCTWSHNGELAGSLCYSHQLAIPDVIRSCEVPPCKLGCVDMSKHCSKRVELCKFTIYRYQCCESCQRYVQMISSAKDS 580          
BLAST of ADAMTS-like protein 3 vs. TrEMBL
Match: A0A4E0R7Q3 (AdamTS protein 3 OS=Fasciola hepatica OX=6192 GN=D915_004461 PE=4 SV=1)

HSP 1 Score: 424.861 bits (1091), Expect = 1.299e-135
Identity = 226/593 (38.11%), Postives = 337/593 (56.83%), Query Frame = 3
Query:  195 IGNRPIGKAFLE-----EIDIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDK-CEHIPKIKVTT--------RVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYH--SSGQVVDQE-----MCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLVPPASWRQCFDHIDPKKCFKKSEFLPEIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWGHKKI-EYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIKSKSPSDGYKDWAIRNSISNKDM----PNELVQLDMMQENHVRWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEKCDSTRKPVYECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSCNPPKCNLKCVDMHPSCKRKKEYCRMGIYSFSCCKTCQEYFKSTQKN 1895
            +G+ P+  AF E     E D WS CS+TCG GVQ +   C  + +Y I  +  D  C   P    T         R+CN GDC +GY W+ + W  CS TCG  G   R+V+C +    G+V+ QE      C    +P+    CNR +C P F+ ++W K C++ + C PG+Q R +SC+S+   G    LP+AACY  G     +WR+CF       C  +    P I ++  T+VQMR+ + LNLQVGQ +YV P TRL + CPV  F   +L+W H+   E  Y G S  R++V ++G+L I+SF  +D GEW C+AG  + ++    ++P+ G+ DW  RN +  K M    P ++  +  +    V+WV G WS CSVSC +TG Q R+VRCE +  RFY  L D  C+ ++ PKP ++R+C ++  CP W     + + CTD+C+  ++    G+L C   +Q V  + CDS+ KP   C N+ C+V+W +S W++CSR+CG  G++AR LICVW ++  PAG LCY   + VP+V++ C  P C L+CVD    C ++ E C+  +Y + CC +C++ F + Q N
Sbjct:   24 LGSTPL-HAFTEPPYWQETDQWSSCSSTCGPGVQRRQYRCVSRDMYNILTVHEDSVCSSQPHPLTTNAGGDHVIERICNLGDC-HGYHWRISPWGHCSQTCGGFGTMTRDVDCVYIGQDGEVIVQEQEAGYFCGHYPRPEKHSSCNRIDCKPEFVPEQWGK-CIQSNPCQPGRQVRQVSCISVQVNGTHRQLPKAACYMAGRPQARTWRRCFV-ASTSNCESQE---PTIDTDAMTIVQMRKAKILNLQVGQQAYVIPFTRLNVRCPVHYFSVHDLVWKHRNHGEIRYTGLSNERVQVDKRGRLRIRSFRNEDAGEWTCIAGQKNATVTFSPRTPAAGFHDWVQRNRLWTKGMMSDDPKDMAGVHAI----VQWVEGPWSACSVSCGDTGQQFRVVRCERVDTRFYQILDDQACLDKLLPKPLSRRKCLKSKRCPGWFVDGADSSVCTDNCLAVDQGSIRGNLTCRIGSQRVEDKLCDSSEKPDMTCPNSVCQVKWNVSAWSQCSRSCGGVGVRARQLICVWSHNGSPAGPLCYANQIPVPEVIEQCEAPPCQLECVDFSKHCPKRVELCKFTLYRYQCCASCRD-FANIQSN 604          
BLAST of ADAMTS-like protein 3 vs. TrEMBL
Match: A0A564ZBH0 (Ig-like domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS14329 PE=4 SV=1)

HSP 1 Score: 423.705 bits (1088), Expect = 2.601e-135
Identity = 224/563 (39.79%), Postives = 313/563 (55.60%), Query Frame = 3
Query:  234 IDIWSKCSTTCGEGVQEKLQACFKKTVYLIENI-PMDKCEHIP--KIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSS--GQVV-----DQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLVPPASWRQCFDHIDPKKCFKKSEFLPEIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWGHKKIEYF-YKGKSKN---RIRVTRKGKLIIKSFLIQDQGEWRCLAG--NISDSIVIKSKSPSDGYKDWAIRNSISNKDMPNELVQLDMMQENHVRWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEKCDSTRKPVYECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSCNPPKCNLKCVDMHPSCKRKKEYCRMGIYSFSCCKTCQEY 1874
             D+W +CS  CG G+Q+K+ AC +   Y    + P   C  +P        R CN+GDC+    W+ ++WS CSH CG  G   REVEC  S   G++V     +   CD NKKP+S   CNR+NCP  F   EW+K C + + C+ G QRR LSC SL+  G  ++LP+ ACY     PP+ WR+C+      +C +    LP I   K  +VQMR V ++ LQVGQ +Y+ PGTRL++ CPV  F SSNL+W HKKI  F Y G   N      V++ G L+I+ F   D+GEWRC AG      SI +    PS G  DW  RN   N +M NE   + M ++  V+WV G WS CSV C   G Q+R+VRCE L    Y+ L D+EC ++   KP  +R C     CP W  +N +  +CTD+CIG  +    G++ C+    ++    C+   KP   C N  C+ +W +S W++CS TCG +G + R   CVW +S  PAG+ CY   +E P  +K C PP C  +C+D+   C + + +C    + F+CCKTC++Y
Sbjct:   34 TDLWERCSPHCGAGIQQKVFACVENDKYNCSRVKPGRYCGPLPVEMPSDAVRQCNWGDCQRKTWWRASNWSDCSHPCGNLGFATREVECVMSGDEGEIVINQKYENGFCDLNKKPESRGPCNRFNCPGEFQPLEWQK-CEQKNPCNTGVQRRQLSCRSLMANGDYVELPKVACYNHFKPPPSEWRRCYVPEISAQCTRN---LPVIDEMKMVVVQMRAVRRMRLQVGQEAYILPGTRLSIKCPVTFFPSSNLVWHHKKIGNFTYTGHPGNDPVSHFVSKSGNLVIRHFTSPDEGEWRCQAGQDGPQASIKLHYNLPSQGLADWEARNPKRNSEMQNEDPAVVMTRQKLVQWVEGPWSNCSVPCGGQGIQTRVVRCELLDTGVYHVLDDEECKRQFLVKPKTQRVCINLPKCPNWKLRNADYARCTDNCIGVGRGTYWGEMTCMLGGVAIPEHHCEQMTKPDISCDNPRCQAKWVVSNWSQCSVTCGGTGFRYREQKCVWVHSNKPAGSACYDAKIEAPPAVKQCQPPPCRTQCIDLSDQCPKYRHWCSFHTFKFNCCKTCRDY 592          
BLAST of ADAMTS-like protein 3 vs. TrEMBL
Match: A0A0R3S9E2 (Ig-like domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS861 PE=4 SV=1)

HSP 1 Score: 423.32 bits (1087), Expect = 3.143e-135
Identity = 224/563 (39.79%), Postives = 313/563 (55.60%), Query Frame = 3
Query:  234 IDIWSKCSTTCGEGVQEKLQACFKKTVYLIENI-PMDKCEHIP--KIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSS--GQVV-----DQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLVPPASWRQCFDHIDPKKCFKKSEFLPEIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWGHKKIEYF-YKGKSKN---RIRVTRKGKLIIKSFLIQDQGEWRCLAG--NISDSIVIKSKSPSDGYKDWAIRNSISNKDMPNELVQLDMMQENHVRWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEKCDSTRKPVYECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSCNPPKCNLKCVDMHPSCKRKKEYCRMGIYSFSCCKTCQEY 1874
             D+W +CS  CG G+Q+K+ AC +   Y    + P   C  +P        R CN+GDC+    W+ ++WS CSH CG  G   REVEC  S   G++V     +   CD NKKP+S   CNR+NCP  F   EW+K C + + C+ G QRR LSC SL+  G  ++LP+ ACY     PP+ WR+C+      +C +    LP I   K  +VQMR V ++ LQVGQ +Y+ PGTRL++ CPV  F SSNL+W HKKI  F Y G   N      V++ G L+I+ F   D+GEWRC AG      SI +    PS G  DW  RN   N +M NE   + M ++  V+WV G WS CSV C   G Q+R+VRCE L    Y+ L D+EC ++   KP  +R C     CP W  +N +  +CTD+CIG  +    G++ C+    ++    C+   KP   C N  C+ +W +S W++CS TCG +G + R   CVW +S  PAG+ CY   +E P  +K C PP C  +C+D+   C + + +C    + F+CCKTC++Y
Sbjct:   29 TDLWERCSPHCGAGIQQKVFACVENDKYNCSRVKPGRYCGPLPVEMPSDAVRQCNWGDCQRKTWWRASNWSDCSHPCGNLGFATREVECVMSGDEGEIVINQKYENGFCDLNKKPESRGPCNRFNCPGEFQPLEWQK-CEQKNPCNTGVQRRQLSCRSLMANGDYVELPKVACYNHFKPPPSEWRRCYVPEISAQCTRN---LPVIDEMKMVVVQMRAVRRMRLQVGQEAYILPGTRLSIKCPVTFFPSSNLVWHHKKIGNFTYTGHPGNDPVSHFVSKSGNLVIRHFTSPDEGEWRCQAGQDGPQASIKLHYNLPSQGLADWEARNPKRNSEMQNEDPAVVMTRQKLVQWVEGPWSNCSVPCGGQGIQTRVVRCELLDTGVYHVLDDEECKRQFLVKPKTQRVCINLPKCPNWKLRNADYARCTDNCIGVGRGTYWGEMTCMLGGVAIPEHHCEQMTKPDISCDNPRCQAKWVVSNWSQCSVTCGGTGFRYREQKCVWVHSNKPAGSACYDAKIEAPPAVKQCQPPPCRTQCIDLSDQCPKYRHWCSFHTFKFNCCKTCRDY 587          
BLAST of ADAMTS-like protein 3 vs. Ensembl Cavefish
Match: adamtsl3 (ADAMTS-like protein 3 [Source:NCBI gene;Acc:103028701])

HSP 1 Score: 119.783 bits (299), Expect = 3.832e-27
Identity = 89/301 (29.57%), Postives = 145/301 (48.17%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKT-VYLIENIPMDKCE--HIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYH----SSGQVVDQEMCDENKKPKSLRGCNRYNC-PPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLVPPASWRQCFDHIDPKKCFKKSEFLPEIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWGHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIK 1121
            WS+CS +CG G+Q +   C +     L E++ + +C+    P+++     CN   C     W+  +W +CSH C   G Q R+V C       S + +  E CD   KP + R C    C  P+    EW K  V    C  G QRR+  C  L  +G+++ L R+AC   GL PP   R C      K  + K    P+++  KR  +Q R+ ++L+  +G  +Y+ P T + + CPV++F  + + W     +     ++   + +T+ G L + S   +D GE+RC A   SD  ++K
Sbjct:  713 WSQCSESCGVGLQTRRVRCVRSVGSNLTESVELSECKGSRPPELQA----CNQHHCPP--AWEAEEWQQCSHAC-VRGTQWRKVYCRQRLAGGSFRKLPDEECD-GVKPATQRPCTDPLCLQPHLDGGEWSKCSVT---CGKGIQRREPVCRRLSVSGQLVTLDRSAC--NGLQPPPLIRSCRMTPCNKHKYSKKR-CPQVLGLKRIYIQTRQEKRLSFTIGGRAYLLPKTSVVIKCPVRHFPKAQIRWEKDGQDL----QNSKHLSITKSGALRLYSLETRDIGEYRCWANQASDIFILK 995          

HSP 2 Score: 58.151 bits (139), Expect = 3.349e-8
Identity = 51/190 (26.84%), Postives = 85/190 (44.74%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVYLIE--NIPMDKCEHIPKIKVTTRVCNYGDCEN------------------GYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQ-VVDQEMCDENKKPKSL-RGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLVPP 746
            WS CS +CG G+Q++   C     +     ++P ++CE   +  V  R C+ G C                    G++W++  ++ CS +C   G Q+  V C  +  Q VV+   CDE ++P ++ R CN   CP  +   EW  +C +   C  G Q R + C+  + +     +  + C  KG  PP
Sbjct:  573 WSSCSVSCGVGLQKRWVKCRVLLSFTQAEVDLPEEECEG--EKPVLQRTCSMGPCSGPGGSLQWPVEVPANPTQLGFLWEYRGFTACSVSCAV-GRQVAVVRCVRAGRQEVVEDFFCDELRRPPAMVRICNPQPCPARWDFSEW-SQCSE--SCGVGLQTRRVRCVRSVGSNLTESVELSEC--KGSRPP 754          

HSP 3 Score: 54.6842 bits (130), Expect = 4.617e-7
Identity = 59/206 (28.64%), Postives = 90/206 (43.69%), Query Frame = 3
Query: 1188 PNELVQLDMMQENHVRWVIGDWSQCSVSCENTGFQSRMVRC-ESLQKRFYYQLSDDECVQRVAPKPFA--KRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGL--EKCDSTRKPVYE--CYNAEC-RVEWKISEWTKCSRTCGKSGIQARYLIC--VWENSKLPAGNLCYLINLEVPQVLKSCNPPKCN 1775
            P  +V++   Q    RW   +WSQCS SC   G Q+R VRC  S+       +   EC     P+  A  +  CP  +   +W        QC+  C+   + R +   + +       L  E+CD   KP  +  C +  C +      EW+KCS TCGK GIQ R  +C  +  + +L   +      L+ P +++SC    CN
Sbjct:  692 PPAMVRICNPQPCPARWDFSEWSQCSESC-GVGLQTRRVRCVRSVGSNLTESVELSECKGSRPPELQACNQHHCPPAWEAEEW-------QQCSHACVRGTQWRKVYCRQRLAGGSFRKLPDEECDGV-KPATQRPCTDPLCLQPHLDGGEWSKCSVTCGK-GIQRREPVCRRLSVSGQLVTLDRSACNGLQPPPLIRSCRMTPCN 887          

HSP 4 Score: 54.299 bits (129), Expect = 6.321e-7
Identity = 71/259 (27.41%), Postives = 104/259 (40.15%), Query Frame = 3
Query: 1194 ELVQLDMMQENHVRWVIGDWSQCSVSCENTGFQSRMVRCESLQK--RFYYQLSDDECVQRVAPKPFAKRECPRNFPCP------QWNFK-NVNLNQC---------TDHCIGYEKARTIGDLKCIFQNQSVGLEK--CDSTRKP---VYECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEV-----PQVLKSCN----PP--------KCNLKCVDMHPSCKRKKEYCRMGIYSFS 1850
            EL +  +  E+   ++ G WS CSVSC   G Q R V+C  L    +    L ++EC      KP  +R C    PC       QW  +   N  Q          T   +     R +  ++C+   +   +E   CD  R+P   V  C    C   W  SEW++CS +CG  G+Q R + CV    +    NL   + L       P  L++CN    PP        +C+  CV      + +K YCR  +   S
Sbjct:  555 ELEETKVATEDPT-FIPGPWSSCSVSC-GVGLQKRWVKCRVLLSFTQAEVDLPEEECE---GEKPVLQRTCSMG-PCSGPGGSLQWPVEVPANPTQLGFLWEYRGFTACSVSCAVGRQVAVVRCVRAGRQEVVEDFFCDELRRPPAMVRICNPQPCPARWDFSEWSQCSESCG-VGLQTRRVRCV----RSVGSNLTESVELSECKGSRPPELQACNQHHCPPAWEAEEWQQCSHACVR---GTQWRKVYCRQRLAGGS 799          

HSP 5 Score: 52.7582 bits (125), Expect = 1.780e-6
Identity = 53/200 (26.50%), Postives = 80/200 (40.00%), Query Frame = 3
Query:  231 EIDIWSKCSTTCGEGVQEKLQACFKKTVY-LIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGC--------NRYNCP-----------------------PNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLN-TGKVIDLPRAACYAK 731
            E + W+ CS +CG G Q++   C ++ +   +  +   KC H P+  +T + CN  DC     W   +WS+C+ TCG  G++ R V C   +GQ      C  + KP     C         R + P                       P F+   W    V    C  G Q+R + C  LL+ T   +DLP   C  +
Sbjct:  423 EQNPWTSCSVSCGGGSQQRSVVCVEEDMQGQVVQVEEWKCTHSPR-PITEQPCNTFDCPK---WVAMEWSQCTVTCG-RGLRYRVVLCIDHNGQHTGG--CSSSLKPHIKEDCLVPIACHKPRESVPVEAKLPWLKQAQELEETKVATEDPTFIPGPWSSCSVS---CGVGLQKRWVKCRVLLSFTQAEVDLPEEECEGE 612          
BLAST of ADAMTS-like protein 3 vs. Ensembl Cavefish
Match: ENSAMXT00000039281.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:25842872:25855936:-1 gene:ENSAMXG00000032437.1 transcript:ENSAMXT00000039281.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.6481 bits (200), Expect = 1.229e-15
Identity = 81/328 (24.70%), Postives = 133/328 (40.55%), Query Frame = 3
Query:  912 RLTLNCPVKNFLSSNLIWGHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIKSKS--PSDGYKDWAIRNSISNKDMPNELVQLDMMQENHVRWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQS-VGLEKCDSTRKPVYE--CYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSCNPPKCNL-KCVDMHPSCK--RKKEYCRMGIYSFSCCKTCQE 1871
            R+ L C  +      +IW    +E      + +R+ +   G L+I++    D G + C A N      + S+      G  + A  N+ S+     +L      Q    RW +  WS CS  C   G Q+R V C  + +         E       +P   R C    PC  W  +      C   C+G + A     + C  +N + +    C S  +P     C    C + W++  WT+C+ TCG+ G Q+R+++CV   S  PA  L +      P   + CN   C   +C D    C+  R+ E C +  +   CC++C++
Sbjct:  321 RVELKCQAQGNPQPVVIWKKDGVEL----TNSSRVGLMPDGSLLIEAPQETDSGLYTCKATNHLGFTSLSSQVQITESGCVNGADENNTSSCTDSLQLPYSCHGQHCRHRWQVSSWSSCSADC-GGGLQTRSVTCLGVAE-------GAETCMGAGRRPVDSRACNIQ-PCVAWITRA--WGPCNGQCVGPQLALQHRHVFCQDKNSTRLQHRMCSSQPRPTSHRNCTTEACALHWRVGPWTQCTATCGRHGFQSRHVMCVHRRSGKPAREL-HCAWRPRPASWQRCNILSCGRGECRDSTRYCEKVRQLELCPLPQFKARCCRSCRD 632          

HSP 2 Score: 52.373 bits (124), Expect = 1.738e-6
Identity = 27/106 (25.47%), Postives = 52/106 (49.06%), Query Frame = 3
Query:  813 PEIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWGHKKIEYFYKGKSKN---RIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIK 1121
            P I+++++  VQ R+  KL+  VG  +Y+FP T + + CP ++F    + W          GK       + ++  G + I+     D G + C+AG   ++ ++K
Sbjct:   27 PTILAQRKVYVQWRKGPKLHFVVGGYAYLFPWTSVVIRCPTRHFRKGLIHW-------LKDGKPLALLPHVSLSHMGYIKIQQVRASDVGMYTCVAGQAQENFILK 125          
BLAST of ADAMTS-like protein 3 vs. Ensembl Cavefish
Match: si:ch211-267e7.3 (ADAMTS-like protein 2 [Source:NCBI gene;Acc:103033610])

HSP 1 Score: 70.4774 bits (171), Expect = 5.546e-12
Identity = 50/159 (31.45%), Postives = 75/159 (47.17%), Query Frame = 3
Query:  231 EIDIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIK--VTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVI 701
            E   WS+CS TCGEG Q +   C+K      ++   D   H  +++  +  + C    C  G  W+ +DWS+CS  CG  G++ REV C       +D  +C+E+ +P S R C    C   +   +W   C  +  C  G+  R + C S    GKVI
Sbjct:  643 ETSRWSECSRTCGEGFQFRTVRCWKMMAPGFDSSVYDDLCHAAELQKPMARKACKSKSC--GPQWEVSDWSECSARCGGRGVRSREVRC------SMDTRLCNESTRPPSQRECEGPPCDRRWTVSDW-GPCSGL--CGEGRMTRYVVCKS--GNGKVI 788          

HSP 2 Score: 57.3806 bits (137), Expect = 5.306e-8
Identity = 46/156 (29.49%), Postives = 71/156 (45.51%), Query Frame = 3
Query: 1233 RWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQ-WNFKNVNLNQCTDHCIGYEKARTI----GDLKCIFQNQSVGLEKCDSTRKP--VYECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICV 1679
            +W + DWS+CS  C   G +SR VRC S+  R   +          + +P ++REC    PC + W   +     C+  C      R +    G+ K I   Q      CD   KP  V+ C + +C   W   EW +C+ TCG+ G++ R ++C 
Sbjct:  704 QWEVSDWSECSARCGGRGVRSREVRC-SMDTRLCNE----------STRPPSQREC-EGPPCDRRWTVSD--WGPCSGLCGEGRMTRYVVCKSGNGKVISDGQ------CDPDLKPLAVHPCGDRDCPAHWVEQEWEQCNATCGR-GVKTRQVVCA 838          

HSP 3 Score: 56.9954 bits (136), Expect = 8.552e-8
Identity = 37/121 (30.58%), Postives = 59/121 (48.76%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKE 605
            W +C+ TCG GV+ +   C      + +  P   C  + + + +T  C    C     W  T WS+CS TCG  G+++REV+CY   G+ +    CD   KP++ + C    CP    A++
Sbjct:  819 WEQCNATCGRGVKTRQVVCAGLEAGVFKEYPEHTCAGVLQPEQST-ACFERPCSK---WFTTAWSQCSKTCG-SGVRVREVKCYQ--GEEIGHS-CDSVLKPQARQSCEVQACPTEAPAED 931          

HSP 4 Score: 53.9138 bits (128), Expect = 6.727e-7
Identity = 34/134 (25.37%), Postives = 59/134 (44.03%), Query Frame = 3
Query:  231 EIDIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCD------ENKKPKSLRGCNRYNCPPNFLAKEWKK 614
            ++  ++ CS+TC  G+      C +   Y    +    C+ + + + T   C   +C     W+ + WS+CS TCG EG Q R V C+       D  + D      E +KP + + C   +C P +   +W +
Sbjct:  585 KVSAYAPCSSTCTTGISTSYALCVR---YDGSEVDESYCDALTRPEPTHEFCTGKECPP--RWETSRWSECSRTCG-EGFQFRTVRCWKMMAPGFDSSVYDDLCHAAELQKPMARKACKSKSCGPQWEVSDWSE 712          
BLAST of ADAMTS-like protein 3 vs. Ensembl Cavefish
Match: ADAMTS20 (ADAM metallopeptidase with thrombospondin type 1 motif 20 [Source:HGNC Symbol;Acc:HGNC:17178])

HSP 1 Score: 68.1662 bits (165), Expect = 3.494e-11
Identity = 61/185 (32.97%), Postives = 80/185 (43.24%), Query Frame = 3
Query: 1233 RWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQN-QSVGLEKCDSTRKP--VYECYNAEC--RVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSCNPPKC 1772
            +W  G W  CS +CE  GFQ R+V C+  + R     S + C +RV  KP   + C    PCP WN+      +CT  C G ++ R +    C   N Q +    CD   KP  V +C    C     W    W  CS TCGK G + R L CV+ N        C   +L  P+  K C    C
Sbjct: 1249 QWRTGPWGSCSSTCEG-GFQRRVVVCQDSEGR-----STNYCDERV--KPSESKSCDSG-PCPLWNYG--IWGECTQSCGGGQRTRLV---VCQRPNGQRLNEHNCDMLDKPPDVEQCNMQPCPGSASWHRRPWKSCSVTCGK-GTRQRELACVYHNQTQTMEENC--AHLPRPKTHKPCRVEPC 1416          

HSP 2 Score: 65.855 bits (159), Expect = 1.863e-10
Identity = 56/187 (29.95%), Postives = 84/187 (44.92%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDK-CEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPP-NFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDL----PRAACYAKGLVPP-------ASWRQC 764
            W  CS TCG+G +++  AC    VY  +   M++ C H+P+ K T + C    C     WK   W  C  +CG  G+Q REV C       +++E CD + +P SL+ C   +C    + A EWK+     + C  G + R   C+ +  T  +  L     R A Y      P       A+W +C
Sbjct: 1368 WKSCSVTCGKGTRQRELAC----VYHNQTQTMEENCAHLPRPK-THKPCRVEPCP---TWKTNKWKACPVSCG-AGVQTREVYCRLKGKGRIEEERCDAHIRPSSLQSCMLPDCHHYTWSATEWKE---CNASCGKGIRHRTAICVDMKMTPVLDSLCDPSSRPALYEPCFSAPCQYVWVTAAWTEC 1542          

HSP 3 Score: 56.225 bits (134), Expect = 1.424e-7
Identity = 41/147 (27.89%), Postives = 71/147 (48.30%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVT-TRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCP--PNFLAKEWKKKCVKISDCSPGQQRRDLSCL 674
            W  CS+TC  G Q ++  C        E    + C+   ++K + ++ C+ G C    +W +  W +C+ +CG  G + R V C   +GQ +++  CD   KP  +  CN   CP   ++  + WK   V    C  G ++R+L+C+
Sbjct: 1255 WGSCSSTCEGGFQRRVVVCQDS-----EGRSTNYCDE--RVKPSESKSCDSGPCP---LWNYGIWGECTQSCG-GGQRTRLVVCQRPNGQRLNEHNCDMLDKPPDVEQCNMQPCPGSASWHRRPWKSCSVT---CGKGTRQRELACV 1387          

HSP 4 Score: 55.4546 bits (132), Expect = 2.270e-7
Identity = 44/154 (28.57%), Postives = 67/154 (43.51%), Query Frame = 3
Query:  213 GKAFLEEIDIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVEC-YHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSC 671
            G   L    IW +C+ +CG G + +L  C +     +     D  +  P ++     CN   C     W    W  CS TCG +G + RE+ C YH+  Q + +E C    +PK+ + C    C P +   +WK   V    C  G Q R++ C
Sbjct: 1299 GPCPLWNYGIWGECTQSCGGGQRTRLVVCQRPNGQRLNEHNCDMLDKPPDVE----QCNMQPCPGSASWHRRPWKSCSVTCG-KGTRQRELACVYHNQTQTM-EENCAHLPRPKTHKPCRVEPC-PTWKTNKWKACPV---SCGAGVQTREVYC 1442          
BLAST of ADAMTS-like protein 3 vs. Ensembl Cavefish
Match: adamts2 (A disintegrin and metalloproteinase with thrombospondin motifs 2 [Source:NCBI gene;Acc:103038015])

HSP 1 Score: 68.1662 bits (165), Expect = 3.501e-11
Identity = 47/153 (30.72%), Postives = 70/153 (45.75%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYH----SSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNT 689
            WS CS  CG G Q     C +K+   + +  +  C +I K +  +R CN   C    VW   DW +CS +CG  G Q R V C       + + ++ + C ++ +P+  R CNR  CP  +    W +  V    C  G Q R + C +  NT
Sbjct:  850 WSHCSKPCGGGKQYTRFGCRRKSDGKMVHRTL--CSNISKPRAISRACNQKQCSEP-VWVTGDWEECSKSCGKTGTQTRPVRCVRPQADGTQKTINSKYCSDD-RPEGRRTCNRNLCPAQWRTGPWSQCSVT---CGNGTQERQVMCSTPDNT 995          
BLAST of ADAMTS-like protein 3 vs. Ensembl Sea Lamprey
Match: adamtsl3 (ADAMTS-like 3 [Source:ZFIN;Acc:ZDB-GENE-121030-8])

HSP 1 Score: 94.3597 bits (233), Expect = 6.674e-20
Identity = 81/321 (25.23%), Postives = 129/321 (40.19%), Query Frame = 3
Query:  231 EIDIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTT-------RVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYH----SSGQVVDQEMCDENKKPKSLRGC--NRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSC--------LSLLNTGKVIDLPRAACYAKGLVPPASWRQCFDHIDPKKCFKKSEFLPEIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWGHKKIEYFYKGKS---KNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIK 1121
            E   W  CS +CG G++ +   C +           D  E   +    T         C   DC     W   DW  CS TCG  G+Q R + C       S + VD+++C ++ +P + + C   +  CP  ++A EW +      + +   Q RD+SC         S+ N  +   LP+        +PP +          +K    +   P+I+  +R  +       L   VG  +Y+FP + + L CPV  F        H ++ +   G+S    +R  VTR G L I+     D G + C+AG   +S  IK
Sbjct:  679 ETSEWGACSASCGAGLRARSVGCARTVAR-----EADGSEERQRATDCTGPRPPDVEPCARSDCPP--AWHARDWQPCSRTCGSSGVQSRSLRCRRLLADGSSRDVDEQLCPDS-RPLAQQACGGGQSECPAEWVASEWGQINTHQGNYT---QHRDVSCQFSTAAEATSVANASQCSSLPKPLASRACTLPPCN----------RKGGSSANGGPQILGVRRIYIPSPWENLLAFPVGGTAYLFPKSMVVLKCPVARFQ-------HSRVRWEKDGRSLAESDRHSVTRWGCLKIRCLQPDDIGVYTCVAGQARESFTIK 971          

HSP 2 Score: 78.9518 bits (193), Expect = 3.719e-15
Identity = 64/219 (29.22%), Postives = 90/219 (41.10%), Query Frame = 3
Query: 1236 WVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLE-KCDSTRKP--VYECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSCNPPKCNL--KCVDMHPSCK--RKKEYCRMGIYSFSCCKTCQE 1871
            WV G WS CS +C   G + R V C S        L D  C  R A +P     C R+  CP+W        +CT  C+G         + C   N +   E  C S  +P  V  C    C V+W+   W  C+ +CG  G QAR + C    +  PA +  +      P   + CN   C    +C D    C+  +K   C++  Y   CC+ C+E
Sbjct: 1570 WVTGPWSDCSEAC-GAGVRVRSVVCRS--PAGATALPDYSC--RGAERPARAEPCKRHG-CPEWAVGA--WAECTGRCVGLGIGTQHRRVLCFLHNGTAAPEGDCASKARPGSVQNCSVEACAVQWRTGPWAVCTASCGTHGFQARRVECAHVRTARPAPD-AHCAWQHKPATWQRCNITPCATTSECRDSSRYCEMVQKLNLCQLPTYRLRCCQACRE 1779          

HSP 3 Score: 62.3882 bits (150), Expect = 4.322e-10
Identity = 45/153 (29.41%), Postives = 68/153 (44.44%), Query Frame = 3
Query: 1236 WVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEK-----CDSTRKP-VYECYNAECRVEWKISEWTKCSRTCGKSGIQARYLIC 1676
            W  G +S CSVSC   G +  +V C + +     +  D+      A  P  +R C    PCP   ++      C+  C    +AR++G  + + +      E+     C   R P V  C  ++C   W   +W  CSRTCG SG+Q+R L C
Sbjct:  619 WEYGGFSHCSVSCAG-GNREAIVICVNKET---GEAEDESLCDADARPPQIQRPC-HTLPCPS-RWETSEWGACSASCGAGLRARSVGCARTVAREADGSEERQRATDCTGPRPPDVEPCARSDCPPAWHARDWQPCSRTCGSSGVQSRSLRC 765          
BLAST of ADAMTS-like protein 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000756.1 (pep scaffold:Pmarinus_7.0:GL477404:44246:61450:-1 gene:ENSPMAG00000000690.1 transcript:ENSPMAT00000000756.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.4774 bits (171), Expect = 9.370e-13
Identity = 56/223 (25.11%), Postives = 90/223 (40.36%), Query Frame = 3
Query: 1236 WVIGDWSQCSVSCENTGFQSRMVRCESLQKRF-YYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSV----GLEKCDSTRKPVYE--CYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSCNPPKCN-LKCVDMHPSCK--RKKEYCRMGIYSFSCCKTCQEY 1874
            W + +W  CS SC   G + R V C+ L        L    C     P+P  +  C     CP W    ++  QCT  C+G+        + C   N ++      +K  S  +P     C    C  EW+   W++C+ TCG  G Q+R L C    +    G        + P   + CN   C   +C D    C   ++ + C++ +Y   CC++C++ 
Sbjct:  394 WSVEEWGTCSRSC-GGGMRLRHVTCQMLSSDGEVTPLPVGLCEHDAGPRPTEEESCAATHDCPHW--VALDWGQCTGRCVGWMTGTKHRRVSCRTTNGTLVPDSACDKSSSVARPALSQNCSAEACAGEWRPGRWSECTATCGSHGFQSRRLECAGAAADAAGGEHSCAWQPK-PITWQRCNIIPCEKGECKDTTRYCHLVKRLKLCQLMMYKLRCCESCKDL 612          

HSP 2 Score: 54.6842 bits (130), Expect = 7.274e-8
Identity = 33/104 (31.73%), Postives = 51/104 (49.04%), Query Frame = 3
Query:  417 WKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPK--SLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAAC 722
            W   + S CS +CG  G+Q   + C     + VD  +C    KP   + + CNR +CPP++  +EW   C +   C  G + R ++C  L + G+V  LP   C
Sbjct:  334 WTPGEPSPCSASCGNTGVQSWRLRCVRDDLEEVDASLCQGLPKPSLAAPQRCNRRDCPPSWSVEEW-GTCSR--SCGGGMRLRHVTCQMLSSDGEVTPLPVGLC 434          
BLAST of ADAMTS-like protein 3 vs. Ensembl Sea Lamprey
Match: adamts17 (ADAM metallopeptidase with thrombospondin type 1 motif, 17 [Source:ZFIN;Acc:ZDB-GENE-121030-7])

HSP 1 Score: 67.3958 bits (163), Expect = 6.324e-12
Identity = 50/175 (28.57%), Postives = 73/175 (41.71%), Query Frame = 3
Query:  198 GNRPIGKAFLEEIDIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECY---HSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPR 713
            G RP    ++     W  CS  CG G    +  C K        +P + C ++ +  +  R CN   C N   WK ++WS CS TCG +G+Q R V C+    S G V  ++      +P S +GC  ++C   + A  W +     S C  G + R   C S          PR
Sbjct:  274 GERPRTPLYMWTHVGWENCSVQCGGGEVRSILGCTKIVNRSQSCVPDEDCRNVSRPPLQNRHCNSHPCPN--RWKVSEWSPCSRTCG-KGLQTRSVSCHLHLPSGGSVRTRDGRCPKPRPPSSQGCQGHDCLGVWQATSWSQ---CSSRCGKGTRVRTAQCTSPHGRCLATSRPR 442          

HSP 2 Score: 53.1434 bits (126), Expect = 1.983e-7
Identity = 39/120 (32.50%), Postives = 54/120 (45.00%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHS-SGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLA 599
            WS+CS+ CG+G + +   C           P  +C    + +      +Y  C   Y WK  DWSKCS +CG  G+Q R V C H  SG+      C+ + KP + R C    C   F A
Sbjct:  410 WSQCSSRCGKGTRVRTAQCTS---------PHGRCLATSRPREQDGCEDYSQC---YEWKTGDWSKCSTSCG-RGLQSRVVHCMHRVSGR--HGSGCEADGKPVTYRECGVGECDRTFDA 514          

HSP 3 Score: 51.9878 bits (123), Expect = 4.726e-7
Identity = 35/101 (34.65%), Postives = 53/101 (52.48%), Query Frame = 3
Query: 1419 PQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQS-VGLEKCDSTRKPVYE---CYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGN 1709
            P + + +V    C+  C G E    +G  K + ++QS V  E C +  +P  +   C +  C   WK+SEW+ CSRTCGK G+Q R + C   +  LP+G 
Sbjct:  280 PLYMWTHVGWENCSVQCGGGEVRSILGCTKIVNRSQSCVPDEDCRNVSRPPLQNRHCNSHPCPNRWKVSEWSPCSRTCGK-GLQTRSVSC---HLHLPSGG 376          

HSP 4 Score: 51.2174 bits (121), Expect = 6.899e-7
Identity = 48/180 (26.67%), Postives = 82/180 (45.56%), Query Frame = 3
Query:  231 EIDIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPM-DKCEHIPKIK-VTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLVPPASWRQC 764
            ++  WS CS TCG+G+Q +  +C    ++L     +  +    PK +  +++ C   DC    VW+ T WS+CS  CG +G ++R  +C    G+      C    +P+   GC  Y+    +   +W K     + C  G Q R + C+      +V     + C A G   P ++R+C
Sbjct:  346 KVSEWSPCSRTCGKGLQTRSVSCH---LHLPSGGSVRTRDGRCPKPRPPSSQGCQGHDCLG--VWQATSWSQCSSRCG-KGTRVRTAQCTSPHGR------CLATSRPREQDGCEDYSQCYEWKTGDWSK---CSTSCGRGLQSRVVHCMH-----RVSGRHGSGCEADGK--PVTYREC 503          

HSP 5 Score: 50.0618 bits (118), Expect = 1.588e-6
Identity = 59/242 (24.38%), Postives = 105/242 (43.39%), Query Frame = 3
Query: 1233 RWVIGDWSQCSVSCENTGFQSRMVRCE-SLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEKCDSTRKPVYE--CYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSCNPPKCN-----------------LKCVDMHPS--CK--RKKEYCRMGIYSFSCCKTCQEYFKST 1886
            RW + +WS CS +C   G Q+R V C   L      +  D  C +   P+P + + C  +     W  +  + +QC+  C    + RT    +C   +      +C +T +P  +  C +     EWK  +W+KCS +CG+ G+Q+R + C+   S    G+ C       P   + C   +C+                  KC+    S  C+  R+++ CR   +   CC+TC++++ + 
Sbjct:  344 RWKVSEWSPCSRTC-GKGLQTRSVSCHLHLPSGGSVRTRDGRCPK---PRPPSSQGCQGHDCLGVW--QATSWSQCSSRCGKGTRVRTA---QCTSPHG-----RCLATSRPREQDGCEDYSQCYEWKTGDWSKCSTSCGR-GLQSRVVHCMHRVSGR-HGSGCEADGK--PVTYRECGVGECDRTFDANTITSPRLVALTYKCLGDQWSVYCRLVRERQLCRDLRWYQRCCETCRDFYAAA 567          
BLAST of ADAMTS-like protein 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000757.1 (pep scaffold:Pmarinus_7.0:GL477404:45077:62293:-1 gene:ENSPMAG00000000690.1 transcript:ENSPMAT00000000757.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.3958 bits (163), Expect = 7.938e-12
Identity = 43/154 (27.92%), Postives = 63/154 (40.91%), Query Frame = 3
Query: 1236 WVIGDWSQCSVSCENTGFQSRMVRCESLQKRF-YYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSV----GLEKCDSTRKPVYE--CYNAECRVEWKISEWTKCSRTCGKSGIQARYLIC 1676
            W + +W  CS SC   G + R V C+ L        L    C     P+P  +  C     CP W    ++  QCT  C+G+        + C   N ++      +K  S  +P     C    C  EW+   W++C+ TCG  G Q+R L C
Sbjct:  572 WSVEEWGTCSRSC-GGGMRLRHVTCQMLSSDGEVTPLPVGLCEHDAGPRPTEEESCAATHDCPHW--VALDWGQCTGRCVGWMTGTKHRRVSCRTTNGTLVPDSACDKSSSVARPALSQNCSAEACAGEWRPGRWSECTATCGSHGFQSRRLEC 722          

HSP 2 Score: 53.9138 bits (128), Expect = 1.276e-7
Identity = 33/104 (31.73%), Postives = 51/104 (49.04%), Query Frame = 3
Query:  417 WKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPK--SLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAAC 722
            W   + S CS +CG  G+Q   + C     + VD  +C    KP   + + CNR +CPP++  +EW   C +   C  G + R ++C  L + G+V  LP   C
Sbjct:  512 WTPGEPSPCSASCGNTGVQSWRLRCVRDDLEEVDASLCQGLPKPSLAAPQRCNRRDCPPSWSVEEW-GTCSR--SCGGGMRLRHVTCQMLSSDGEVTPLPVGLC 612          
BLAST of ADAMTS-like protein 3 vs. Ensembl Sea Lamprey
Match: ADAMTS7 (ADAM metallopeptidase with thrombospondin type 1 motif 7 [Source:HGNC Symbol;Acc:HGNC:223])

HSP 1 Score: 65.855 bits (159), Expect = 3.450e-11
Identity = 54/190 (28.42%), Postives = 88/190 (46.32%), Query Frame = 3
Query: 1227 HVR----WVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEKCDSTRKP----VYECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSCNPPKC 1772
            HVR    W +G+WSQCS  C + G ++R+V+C    K     L    C  R    P     C  ++PCP+W+    N +QC+  C G  + R++    C   ++    +  D + KP    +  C    C +EW +  W +CS +C   G+Q R + CV   ++   GN  +   L  P+ +++C    C
Sbjct: 1224 HVRPCAVWSVGNWSQCSEECGDGGVKTRVVQCVDAHKPG-QALRPFHCHSR-GYTPPTSLAC-NSYPCPEWSTG--NWSQCSRECGGGWQHRSV---TCPPGHRCN--DDGDGSPKPPPIALRPCNPQPC-LEWTVGRWGECSVSC-DGGVQQRMVQCVIVATRQQGGNGTWCGTLPRPETIRACGTHPC 1401          

HSP 2 Score: 56.6102 bits (135), Expect = 2.323e-8
Identity = 43/149 (28.86%), Postives = 64/149 (42.95%), Query Frame = 3
Query:  234 IDIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECY--HSSGQVVDQEMC-DENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSC 671
            + +WS+CS +CG G   +   C            +D C+   K     R C+   C    VW   +WS+CS  CG  G++ R V+C   H  GQ +    C      P +   CN Y C P +    W  +C +  +C  G Q R ++C
Sbjct: 1182 VGVWSECSVSCGLGAMWRAVRCSSGR--------LDDCD-AAKRPEPARRCHVRPCA---VWSVGNWSQCSEECGDGGVKTRVVQCVDAHKPGQALRPFHCHSRGYTPPTSLACNSYPC-PEWSTGNW-SQCSR--ECGGGWQHRSVTC 1314          

HSP 3 Score: 55.8398 bits (133), Expect = 3.738e-8
Identity = 58/188 (30.85%), Postives = 78/188 (41.49%), Query Frame = 3
Query: 1233 RWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHC-IGYEKARTIGDLKCIFQNQSVGLEKCDS---TRKPVYECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQ----VLKSCNPPKC 1772
             W +G WS+CSVSC   G   R VRC S +         D+C    A +P   R C    PC  W+    N +QC++ C  G  K R +  +      Q++    C S   T      C +  C  EW    W++CSR CG  G Q R + C       P G+ C       P+     L+ CNP  C
Sbjct: 1179 HWFVGVWSECSVSC-GLGAMWRAVRCSSGRL--------DDC--DAAKRPEPARRC-HVRPCAVWSVG--NWSQCSEECGDGGVKTRVVQCVDAHKPGQALRPFHCHSRGYTPPTSLACNSYPC-PEWSTGNWSQCSRECG-GGWQHRSVTC-------PPGHRCNDDGDGSPKPPPIALRPCNPQPC 1343          

HSP 4 Score: 54.6842 bits (130), Expect = 7.828e-8
Identity = 39/137 (28.47%), Postives = 58/137 (42.34%), Query Frame = 3
Query: 1185 MPNELVQLDMMQENHVRWVIGDWSQCSVSCENTGFQSRMVRCESLQKR---FYYQLSDDECVQRVAPKPFAKRECPRNFPCP-QWNFKNVNLNQCTDHCIGYEKARTI------GDLKCIFQNQSVGLEKCDSTRKP 1565
            +PN+  +    Q+   RW  G+W +CS +C   G   R VRCE   +        L D  C  R  PKP  +  C R  PCP +W     + +QC+  C G  + R            C  + +   +E+C+ T  P
Sbjct:  723 LPNDTRKECNTQDCPARWWTGEWQECSATCGELGLSKRSVRCERGGRAAGPHEPSLPDSHCYHR--PKPKTRTPCNRGMPCPARWLVG--DWSQCSVSCGGGHRTRATYCDDRRNRTACEGRARPAAMEECNLTECP 855          

HSP 5 Score: 51.2174 bits (121), Expect = 1.062e-6
Identity = 49/178 (27.53%), Postives = 69/178 (38.76%), Query Frame = 3
Query:  252 CSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQE------MCDENKKPKSLRGCNR-YNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLVPPASWRQC 764
            C   C  GVQ +   C ++++ ++E      C+       T + CN  DC     W   +W +CS TCG  G+  R V C          E       C    KPK+   CNR   CP  +L  +W +  V    C  G + R   C    N        R AC  +G   PA+  +C
Sbjct:  690 CVIACSRGVQYREPHCTEESLGIVEK---RFCDPATLPNDTRKECNTQDCP--ARWWTGEWQECSATCGELGLSKRSVRCERGGRAAGPHEPSLPDSHCYHRPKPKTRTPCNRGMPCPARWLVGDWSQCSVS---CGGGHRTRATYCDDRRN--------RTAC--EGRARPAAMEEC 849          
BLAST of ADAMTS-like protein 3 vs. Ensembl Nematostella
Match: EDO44376 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW19])

HSP 1 Score: 77.411 bits (189), Expect = 1.636e-14
Identity = 121/525 (23.05%), Postives = 191/525 (36.38%), Query Frame = 3
Query:  231 EIDIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYV------WKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKI--SDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLVPPASWRQCFD-HIDPKKCFKKSEFLPEIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWGHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIKSKSPSDGYKDWAIRNSISNKDMPNELVQLDMMQENHVRWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEKCDSTRKP--VYECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSCNPPKC 1772
            E   WS CS +CG G + +   C     Y   +I   +C+   +  +T R C    C           WK   WS+CS +CG +G ++R V C  S G  V + +CD   +P +   CN   C        WK     +    C  G Q R + C                          +W+   D   DP   FK+         E+R   ++++ E+L L V + + V P        P          WG   +    KG  +  +  TR G+                     + +  ++   P+D           +N   P               W++G WS+CS++C   G Q+R + C S         S  +C  R   KP   R C     CP   ++    ++C+  C   ++ R   ++ C+ +  +     CD   KP  +  C    C  EW +  W++CS TCG+ G+  R + C         GN C   +   P+V+K C  P C
Sbjct:  831 ETRNWSGCSVSCGVGEKTRSVTCR----YNGTSISPTRCDRALRPSLTER-CTQPPCPTQAFIYPETKWKAGPWSQCSQSCGDQGRRMRRVTCADSRGVAVAERLCDAPNRPATYERCNVKPC------TSWKHGAWGLCSKSCGKGVQSRIVKCAY-----------------------ENWKIAKDSQCDP---FKRPP-------EQRE-CELQKCEELALHVNKQATVLPTDPYRPLTPAHQPTWRTSAWGACSVT-CGKGIRRRPVTCTRNGR---------------------TSNACVQDSRPAD-------TEVCTNAACPT--------------WIMGSWSKCSLTC-GGGVQTRRIDCSS---------SLTKCDHR--KKPVESRRC-NTEACPA-TWREGPWSKCSVSCGRGQRRR---NVYCLPEGGN-----CDLRVKPSEIQPCAKKAC-PEWTVGRWSECSVTCGE-GVVRRVVTCS------AGGNRCQ--DDTKPEVVKLCELPDC 1235          

HSP 2 Score: 65.4698 bits (158), Expect = 7.374e-11
Identity = 51/163 (31.29%), Postives = 68/163 (41.72%), Query Frame = 3
Query:  204 RPIGKAFLE--EIDIWSKCSTTCGEGVQEKLQACFK----KTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCL 674
            RP+  A         W  CS TCG+G++ +   C +        + ++ P D           T VC    C     W    WSKCS TCG  G+Q R ++C  S  +      CD  KKP   R CN   CP  +    W K  V    C  GQ+RR++ CL
Sbjct: 1024 RPLTPAHQPTWRTSAWGACSVTCGKGIRRRPVTCTRNGRTSNACVQDSRPAD-----------TEVCTNAACP---TWIMGSWSKCSLTCG-GGVQTRRIDCSSSLTK------CDHRKKPVESRRCNTEACPATWREGPWSKCSV---SCGRGQRRRNVYCL 1162          

HSP 3 Score: 63.5438 bits (153), Expect = 2.922e-10
Identity = 55/195 (28.21%), Postives = 79/195 (40.51%), Query Frame = 3
Query: 1233 RWVIGDWSQ----CSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEKCDSTRKP--VYECYNAEC--------RVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSCNPPKCN 1775
            +W   DW Q    CS SC  +G QSR+V+C          +  D    R A KP   + C +  PCP W  +N   + C+  C   EK R++    C +   S+   +CD   +P     C    C          +WK   W++CS++CG  G + R + C        A  LC   N   P   + CN   C 
Sbjct:  770 KWRAADWEQASNLCSASC-GSGMQSRVVQCS-----VGSVIHPDSACPRAA-KPTGTQRCNQQ-PCPAWETRN--WSGCSVSCGVGEKTRSV---TCRYNGTSISPTRCDRALRPSLTERCTQPPCPTQAFIYPETKWKAGPWSQCSQSCGDQGRRMRRVTCADSRGVAVAERLCDAPNR--PATYERCNVKPCT 949          

HSP 4 Score: 53.1434 bits (126), Expect = 4.565e-7
Identity = 48/166 (28.92%), Postives = 78/166 (46.99%), Query Frame = 3
Query: 1236 WVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPF---AKRECP-RNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCI-FQNQSVGLEKCDSTRKPV-YECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLC 1715
            W   +WS CSVSC   G ++R V C    +     +S   C + + P       +  CP + F  P+  +K    +QC+  C   ++ R +  + C   +  +V    CD+  +P  YE  N +    WK   W  CS++CGK G+Q+R + C +EN K+   + C
Sbjct:  830 WETRNWSGCSVSC-GVGEKTRSVTC----RYNGTSISPTRCDRALRPSLTERCTQPPCPTQAFIYPETKWKAGPWSQCSQSC--GDQGRRMRRVTCADSRGVAVAERLCDAPNRPATYERCNVKPCTSWKHGAWGLCSKSCGK-GVQSRIVKCAYENWKIAKDSQC 987          

HSP 5 Score: 51.9878 bits (123), Expect = 1.067e-6
Identity = 38/126 (30.16%), Postives = 53/126 (42.06%), Query Frame = 3
Query:  210 IGKAFLEEIDIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPP 587
            +G     +   WS+CS TCG+G Q +   C  K            C+   K + +T      +C     W   +WS+CS TCG  GI  REV+C   +   +    CD N +P   R C    C P
Sbjct: 1281 MGPCATWQTGTWSQCSVTCGKGTQVRTVTCSDKDT--------SACDLRTKPQSSTVCGTSQECPK---WIIGNWSQCSRTCGI-GITSREVQCILGNNS-LPYASCDSNSRPVIRRVCQLIECTP 1393          

HSP 6 Score: 50.8322 bits (120), Expect = 2.213e-6
Identity = 48/159 (30.19%), Postives = 71/159 (44.65%), Query Frame = 3
Query:  249 KCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKIS-DCSPGQQRRDLSCLSLLNTGKVIDLPRAAC 722
            KCS  CG G Q++   C + T    + + +  C+H+ +      V   G CEN   W +T WS+CS TCG  GI+ R   C    G  +    C  + +    + C    C P + A +W++     S  C  G Q R + C    + G VI  P +AC
Sbjct:  663 KCSAHCGPGKQKQKSDCMRVTGNKWQLVNVKYCKHLERPLAV--VPCEGKCENTR-WVYTRWSQCSRTCG-SGIKTRRANCVDHKGDFLPDTDCRPSDRLLLQQVCE-AEC-PKWRAADWEQASNLCSASCGSGMQSRVVQC----SVGSVIH-PDSAC 810          

HSP 7 Score: 49.6766 bits (117), Expect = 5.970e-6
Identity = 47/160 (29.38%), Postives = 71/160 (44.38%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAAC 722
            W +CS TCG G + +   C   +++        KC+   +   +T +CN G C     W+   WS+CS TCG +G Q+R V C        D   CD   KP+S   C      P ++   W  +C +   C  G   R++ C+   N+     LP A+C
Sbjct: 1243 WGECSVTCGVGRRLRSVVC---SIH-------GKCDKQRQPSSST-LCNMGPCA---TWQTGTWSQCSVTCG-KGTQVRTVTCSDK-----DTSACDLRTKPQSSTVCGTSQECPKWIIGNW-SQCSRT--CGIGITSREVQCILGNNS-----LPYASC 1374          

HSP 8 Score: 48.9062 bits (115), Expect = 9.932e-6
Identity = 43/146 (29.45%), Postives = 65/146 (44.52%), Query Frame = 3
Query:  234 IDIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSC 671
            +  WS+CS TCGEGV  ++  C         +   ++C+   K +V  ++C   DC +   W   +W +CS TCG  G +LR V C            CD+ ++P S   CN   C   +    W +  V    C  G Q R ++C
Sbjct: 1190 VGRWSECSVTCGEGVVRRVVTC---------SAGGNRCQDDTKPEV-VKLCELPDCPS---WLSQEWGECSVTCGV-GRRLRSVVCSI-------HGKCDKQRQPSSSTLCNMGPC-ATWQTGTWSQCSVT---CGKGTQVRTVTC 1310          
BLAST of ADAMTS-like protein 3 vs. Ensembl Nematostella
Match: EDO36399 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIR2])

HSP 1 Score: 65.855 bits (159), Expect = 2.575e-11
Identity = 42/114 (36.84%), Postives = 59/114 (51.75%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCP 584
            WSKCS  CG+G Q ++  C  +   + + +P+  C H P+ + + R C   +C     W  T W KCS TCG  G Q R V C +  G+ V    C+ +KKP   + CN  NCP
Sbjct:  227 WSKCSANCGQGKQTRIVFCTNEVRNVHQQVPIYNCRHSPQPE-SERNCTIKEC--APEWFVTSWQKCSTTCGG-GSQHRIVMCLNDQGKRVG--GCEVSKKPLHWQRCNTQNCP 334          

HSP 2 Score: 62.7734 bits (151), Expect = 2.108e-10
Identity = 44/149 (29.53%), Postives = 74/149 (49.66%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDK--CEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLL 683
            W +CS TCG G++ +   C      + +NI  ++  C   PK   TTR CN G C+  + +  + ++ CS TCGY G++ R V C    G  +    C+   +P+S + C    C  +++  EW K     ++C  G+Q R + C + +
Sbjct:  111 WRQCSVTCGTGIETRTVECMD----VEQNITQEESACAEKPKPH-TTRRCNPGGCKTHW-FIGSSFTSCSVTCGY-GVKERLVFCGRQGGDALPDSQCESRYRPRSTQRCREKRCQASWVTSEWSK---CSANCGQGKQTRIVFCTNEV 249          

HSP 3 Score: 58.151 bits (139), Expect = 6.898e-9
Identity = 50/159 (31.45%), Postives = 75/159 (47.17%), Query Frame = 3
Query:  210 IGKAFLEEIDIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQ---EMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLS 677
            IG +F       + CS TCG GV+E+L  C ++     + +P  +CE   + + T R C    C+  +V   ++WSKCS  CG +G Q R V C +    V  Q     C  + +P+S R C    C P +    W+K     + C  G Q R + CL+
Sbjct:  166 IGSSF-------TSCSVTCGYGVKERLVFCGRQGG---DALPDSQCESRYRPRSTQR-CREKRCQASWV--TSEWSKCSANCG-QGKQTRIVFCTNEVRNVHQQVPIYNCRHSPQPESERNCTIKECAPEWFVTSWQK---CSTTCGGGSQHRIVMCLN 307          

HSP 4 Score: 55.4546 bits (132), Expect = 4.042e-8
Identity = 47/153 (30.72%), Postives = 68/153 (44.44%), Query Frame = 3
Query: 1236 WVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQN-QSVGLEKCDSTRKP--VYECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWE 1685
            W  G W QCSV+C  TG ++R V C  +++    + S   C ++  PKP   R C        W F   +   C+  C    K R +    C  Q   ++   +C+S  +P     C    C+  W  SEW+KCS  CG+ G Q R + C  E
Sbjct:  106 WKTGPWRQCSVTC-GTGIETRTVECMDVEQNITQEES--ACAEK--PKPHTTRRCNPGGCKTHW-FIGSSFTSCSVTCGYGVKERLVF---CGRQGGDALPDSQCESRYRPRSTQRCREKRCQASWVTSEWSKCSANCGQ-GKQTRIVFCTNE 248          

HSP 5 Score: 51.2174 bits (121), Expect = 1.101e-6
Identity = 40/123 (32.52%), Postives = 55/123 (44.72%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKT----VYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQE-MCDENKKPKSLRGCNRYNCPPNFL 596
            W KC  TCG G+Q +   C +K       +   + ++ C    + KVT R C    C     WK   W +CS TCG  GI+ R VEC      +  +E  C E  KP + R CN   C  ++ 
Sbjct:   45 WKKCGKTCGTGIQLRNLYCRQKMDVDGRQVDRKVEINNCPQWSRPKVT-RPCQLPPCPPPNEWKTGPWRQCSVTCGT-GIETRTVECMDVEQNITQEESACAEKPKPHTTRRCNPGGCKTHWF 165          
BLAST of ADAMTS-like protein 3 vs. Ensembl Nematostella
Match: EDO30665 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T053])

HSP 1 Score: 63.929 bits (154), Expect = 1.240e-10
Identity = 40/114 (35.09%), Postives = 58/114 (50.88%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCP 584
            W +CS  CG+G Q ++  C  +   + + +P+  C H P+ + + R C   +C     W  T W KCS TCG  G Q R V C +  G+ V    C+ +KKP   + CN  NCP
Sbjct:  322 WRQCSANCGQGKQTRIVFCTNEVRNVHQQVPIYNCRHSPQPE-SERNCTIKEC--APEWFVTSWQKCSTTCG-GGSQHRIVMCLNDQGKRVGG--CEVSKKPLHWQRCNTQNCP 429          

HSP 2 Score: 53.9138 bits (128), Expect = 1.969e-7
Identity = 47/152 (30.92%), Postives = 67/152 (44.08%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVY----LIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQ---EMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLS 677
            W KC  TCG G+Q +   C +K       +   + ++ C    ++KV TR C    C     WK   W +CS  CG +G Q R V C +    V  Q     C  + +P+S R C    C P +    W +KC   + C  G Q R + CL+
Sbjct:  256 WKKCGKTCGSGIQLRNLYCRQKMDVDGRQVDRKVEINNCPQWSRLKV-TRPCQLPPCPPPNEWKTGPWRQCSANCG-QGKQTRIVFCTNEVRNVHQQVPIYNCRHSPQPESERNCTIKECAPEWFVTSW-QKCS--TTCGGGSQHRIVMCLN 402          
BLAST of ADAMTS-like protein 3 vs. Ensembl Nematostella
Match: EDO35202 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM44])

HSP 1 Score: 64.6994 bits (156), Expect = 1.244e-10
Identity = 85/312 (27.24%), Postives = 132/312 (42.31%), Query Frame = 3
Query:  198 GNRPIGKAFLE-EIDIWSKCSTTCGEGVQEKLQACFKKT--VYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREV----ECYHSSGQ--VVDQEMCDENKKPKSL-RGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSC-LSLLNTGKVIDLPRAACYAKGLVPPASWRQCFDHIDPKKCFKKSEFLPEIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWGHKKIEYF---YKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLA 1091
            GN  +  + +E +   WS CS  CG G QE+  AC +K    Y+ E++               + C    C +   W  T+WS CS TCG +G Q R V    E +  S Q   +    C  +K   +L + CN+ +CPP ++  EW   C K   C+ G+Q R LSC L  LN G   ++    C+    + P+  + C   +   KCF    FL    S  + L  +    + N+    +S      +   +C  K   + +  W +  IEY+   + G++  R    R GK+  +    Q  G    LA
Sbjct:  733 GNSSVSSSDVEWKTGAWSACSKACGTGSQERDVACVRKDDKTYVRESLCAG------SKPAANQECETAKCVSS--WYTTEWSPCSATCG-KGTQSRSVICRRETFTGSKQYETLPDASCTGSKPTVTLNQECNKVDCPPEWMPTEW-SACTKT--CAGGRQSRTLSCKLKDLN-GAYHEVADYHCH--NAIKPSRQQACNSDV---KCFN---FLGCYRSRTKPLSTLVASFRGNIDWYDMS------KTIAHCEAK-VKAEHPTWTYFGIEYYGECWSGENGARA-YARDGKIDCEGNSYQGTGGPGVLA 1015          

HSP 2 Score: 48.9062 bits (115), Expect = 8.599e-6
Identity = 45/161 (27.95%), Postives = 69/161 (42.86%), Query Frame = 3
Query: 1215 MQENHVRWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIF----QNQSVGLEKCDSTRKPVY---ECYNAECRVEWKISEWTKCSRTCGKSGIQARYLIC 1676
            +  + V W  G WS CS +C  TG Q R V C     + Y + S   C      KP A +EC        W       + C+  C    ++R++   +  F    Q +++    C  ++  V    EC   +C  EW  +EW+ C++TC   G Q+R L C
Sbjct:  737 VSSSDVEWKTGAWSACSKAC-GTGSQERDVACVRKDDKTYVRES--LCA---GSKPAANQECETAKCVSSW--YTTEWSPCSATCGKGTQSRSVICRRETFTGSKQYETLPDASCTGSKPTVTLNQECNKVDCPPEWMPTEWSACTKTCA-GGRQSRTLSC 888          
BLAST of ADAMTS-like protein 3 vs. Ensembl Nematostella
Match: EDO37724 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEZ8])

HSP 1 Score: 57.3806 bits (137), Expect = 1.764e-9
Identity = 42/139 (30.22%), Postives = 65/139 (46.76%), Query Frame = 3
Query:  270 EGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVEC----YHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCL 674
             G+Q+++  C++K   ++    +  C  + + K   R CN   C+  Y W+   WS+CS TC   GIQ+R+V+C    Y    +      C E+ KP + R C R  C   + A  W  +C K   C  G Q R + C 
Sbjct:    4 SGMQKRIYDCYRKKDSMMVKYKL--CYGVTRQKPWKRKCNTKICKASYFWRTYQWSQCSVTCS-NGIQVRDVKCISSKYGEPNKTASDSYCGED-KPLTTRNCIRDECLAMWKAGPW-GECSKT--CGRGLQTRTVECF 135          

HSP 2 Score: 47.7506 bits (112), Expect = 2.691e-6
Identity = 35/113 (30.97%), Postives = 52/113 (46.02%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNC 581
            WS+CS TC  G+Q +   C   + Y   N             +TTR C   +C    +WK   W +CS TCG  G+Q R VEC+   G+     +C +  + +S + C   +C
Sbjct:   56 WSQCSVTCSNGIQVRDVKCI-SSKYGEPNKTASDSYCGEDKPLTTRNCIRDECLA--MWKAGPWGECSKTCG-RGLQTRTVECFDRDGK--PSFLCTDESRMRSTKHCTLNDC 162          
BLAST of ADAMTS-like protein 3 vs. Ensembl Medaka
Match: adamts9 (ADAM metallopeptidase with thrombospondin type 1 motif 9 [Source:NCBI gene;Acc:101171570])

HSP 1 Score: 73.9442 bits (180), Expect = 6.380e-13
Identity = 45/150 (30.00%), Postives = 72/150 (48.00%), Query Frame = 3
Query:  234 IDIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWK-KKCVKISDCSPGQQRRDLSCLSL 680
             D WS CS +CG G + +  +C   +      +P + C+H+       R C  G C     WK   W +CS +CG +G+Q REV C+    +   +  C +  +P S + C   +CP  +  KE + + C K   C  G+++R L C+ L
Sbjct: 1449 TDPWSSCSASCGRGFKSRKVSCVTGSG---RAVPEENCQHLSPKPSKQRRCRGGRCPK---WKTGSWGECSASCG-DGVQQREVSCHDEGHRSPLETGCTQRSRPPSSQSCRVADCPSRYRWKEGEWQTCSK--SCGTGRRQRSLQCVDL 1589          

HSP 2 Score: 58.5362 bits (140), Expect = 2.667e-8
Identity = 33/124 (26.61%), Postives = 60/124 (48.39%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKK 614
            W +CS +CG+GVQ++  +C  +        P++          +++ C   DC + Y WK  +W  CS +CG  G + R ++C   + Q V +  C    +P ++  CN + C   ++  EW +
Sbjct: 1509 WGECSASCGDGVQQREVSCHDEG----HRSPLETGCTQRSRPPSSQSCRVADCPSRYRWKEGEWQTCSKSCG-TGRRQRSLQCVDLNQQEVHEIYCVNEIRPPNMESCNTHACELIWITGEWTE 1627          

HSP 3 Score: 57.7658 bits (138), Expect = 4.590e-8
Identity = 51/177 (28.81%), Postives = 76/177 (42.94%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCP--PNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLVP-PASWRQC 764
            W  CS+TC  G Q ++  C  +  Y     P + CE   +     R C  G C     W +  W +C+  CG  GI+ R V C   +G+  +   C+ + KP     CN   CP  P++    W   C   + C  G + R +SC+    TG    +P   C  + L P P+  R+C
Sbjct: 1339 WGACSSTCAGGFQRRVVVCQDENGY-----PANSCEDSSRPN-EQRSCESGPCPQ---WAYGSWGECTKPCG-GGIKTRLVVCQRPNGERFNDLSCEIHDKPPDQEQCNTQPCPSSPHWSTDPW-SSCS--ASCGRGFKSRKVSCV----TGSGRAVPEENC--QHLSPKPSKQRRC 1496          

HSP 4 Score: 57.3806 bits (137), Expect = 5.871e-8
Identity = 35/114 (30.70%), Postives = 56/114 (49.12%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCP 584
            W+ CS +CG+G   +  +C      L ++     C H+PK   +  VC+   C     WK  +W+ CS TCG +G+  R+V C   + Q V+   CD + +P + + C    CP
Sbjct: 1202 WAPCSASCGKGTWMRFVSCRDDQGGLADD---SACAHLPKPPASG-VCSVVACGQ---WKVLEWTLCSVTCG-QGLTTRQVLCVDFNEQEVNASECDPDDRPTTQQDCAMSQCP 1307          

HSP 5 Score: 56.225 bits (134), Expect = 1.570e-7
Identity = 47/174 (27.01%), Postives = 71/174 (40.80%), Query Frame = 3
Query: 1188 PNELVQLDMMQENHVRWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTI----------GDLKCIFQNQSVGLEKCDSTRKPVYECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICV 1679
            PN    L   Q +  +W  G W  CS +C   GFQ R+V C+           D       + +P  +R C  + PCPQW + +    +CT  C G  K R +           DL C   ++    E+C++   P            W    W+ CS +CG+ G ++R + CV
Sbjct: 1320 PNARSSLPHSQSH--QWRTGPWGACSSTCAG-GFQRRVVVCQDENGYPANSCED-------SSRPNEQRSC-ESGPCPQWAYGS--WGECTKPCGGGIKTRLVVCQRPNGERFNDLSCEIHDKPPDQEQCNTQPCPSSP--------HWSTDPWSSCSASCGR-GFKSRKVSCV 1471          

HSP 6 Score: 53.5286 bits (127), Expect = 1.058e-6
Identity = 47/152 (30.92%), Postives = 68/152 (44.74%), Query Frame = 3
Query: 1233 RWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCP-QWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEK--CDSTRKPVYE-CYNAECRVEWKISEWTKCSRTCGKSGIQARYLIC 1676
            +W  G W +CS SC + G Q R V C     R   +     C QR   +P + + C R   CP ++ +K      C+  C    + R+   L+C+  NQ    E    +  R P  E C    C + W   EWT+CS TCG+ G + R + C
Sbjct: 1503 KWKTGSWGECSASCGD-GVQQREVSCHDEGHRSPLETG---CTQRS--RPPSSQSC-RVADCPSRYRWKEGEWQTCSKSCGTGRRQRS---LQCVDLNQQEVHEIYCVNEIRPPNMESCNTHACELIWITGEWTECSATCGR-GYRQRLVYC 1643          
BLAST of ADAMTS-like protein 3 vs. Ensembl Medaka
Match: ENSORLT00000013062.2 (thrombospondin type-1 domain-containing protein 4 [Source:NCBI gene;Acc:101158050])

HSP 1 Score: 72.7886 bits (177), Expect = 1.162e-12
Identity = 41/120 (34.17%), Postives = 61/120 (50.83%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAK 602
            W+KC+  CG+G Q +   C KK       +P  +C H+ K  V  + C  G+C++   W  T+WS CS +CG  G+Q+REV C   +      + CD + KP+  + CN   C P    K
Sbjct: 1024 WTKCNVPCGDGTQRRDIICVKKMGNDFTVVPSTECAHLEK-PVAVQECQMGECQSS--WFTTEWSACSRSCG-RGLQVREVRCL--TPDKTHSQACDASSKPEQEQACNTIPCGPQVTDK 1137          

HSP 2 Score: 70.4774 bits (171), Expect = 5.079e-12
Identity = 44/150 (29.33%), Postives = 73/150 (48.67%), Query Frame = 3
Query:  231 EIDIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKF-TDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLS 677
            E+  WS+CS +CG G+Q++   C +        +   +C ++     +T+ C+   C +   W+  +DWS CS  CG  G + R V C    G VV+   C+   +P+    CN   C  N+   +W   C   + C PG Q+R++ CL+
Sbjct:  842 EVSAWSECSVSCGPGMQQRQLQCRQSFGNRSTMVHPQRCANL-TPPPSTQACHLQLCSH---WEVDSDWSTCSVDCGV-GKRTRSVRCVSDQGGVVNDNECNSRVRPQGSEECNMGPCVTNWYFTDWSNTCS--AQCGPGVQKREVVCLT 984          

HSP 3 Score: 59.3066 bits (142), Expect = 1.747e-8
Identity = 44/156 (28.21%), Postives = 74/156 (47.44%), Query Frame = 3
Query:  246 SKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQ---VVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVID 704
            ++CS +CG+G Q ++  C  +     E +P  KC+   K       CN   C     W+ + WS+CS +CG  G+Q R+++C  S G    +V  + C     P S + C+   C    +  +W    V   DC  G++ R + C+S  + G V++
Sbjct:  788 TQCSASCGKGFQHRVIICVNRQT--DEEVPERKCDSAAKPVPEEEPCNTHSCPP--FWEVSAWSECSVSCG-PGMQQRQLQCRQSFGNRSTMVHPQRCANLTPPPSTQACHLQLCSHWEVDSDWSTCSV---DCGVGKRTRSVRCVS--DQGGVVN 933          

HSP 4 Score: 55.0694 bits (131), Expect = 3.179e-7
Identity = 52/169 (30.77%), Postives = 74/169 (43.79%), Query Frame = 3
Query:  231 EIDI-WSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSK-CSHTCGYEGIQLREVECYHSSGQVVDQEMCD-ENKKPKSLRGCNRYNCPPNF--LAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAAC 722
            E+D  WS CS  CG G + +   C      ++ +   ++C    + + +   CN G C     W FTDWS  CS  CG  G+Q REV C    G    +   D  ++KP  L+ CN   C P     +  W K  V   D   G QRRD+ C+  +     + +P   C
Sbjct:  901 EVDSDWSTCSVDCGVGKRTRSVRCVSDQGGVVND---NECNSRVRPQGSEE-CNMGPCVTN--WYFTDWSNTCSAQCG-PGVQKREVVCLTRGGVREGEGGGDCVSEKPSELKACNSGPCVPTLTWFSSPWTKCNVPCGD---GTQRRDIICVKKMGNDFTV-VPSTEC 1058          

HSP 5 Score: 53.9138 bits (128), Expect = 6.551e-7
Identity = 43/149 (28.86%), Postives = 63/149 (42.28%), Query Frame = 3
Query:  243 WSK-CSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQ---VVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLS 677
            WS  CS  CG GVQ++   C  +          D     P      + CN G C     W  + W+KC+  CG +G Q R++ C    G    VV    C   +KP +++ C    C  ++   EW   C +   C  G Q R++ CL+
Sbjct:  963 WSNTCSAQCGPGVQKREVVCLTRGGVREGEGGGDCVSEKPS---ELKACNSGPCVPTLTWFSSPWTKCNVPCG-DGTQRRDIICVKKMGNDFTVVPSTECAHLEKPVAVQECQMGECQSSWFTTEW-SACSR--SCGRGLQVREVRCLT 1104          

HSP 6 Score: 50.8322 bits (120), Expect = 5.536e-6
Identity = 60/233 (25.75%), Postives = 99/233 (42.49%), Query Frame = 3
Query: 1236 WVIGDWSQ-CSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPC-PQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSV-GLEKCDSTRKPVY--ECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSCNPPKCNLKCVDMHPSCKRKKEYCRMGI---------YSFSCCKTCQEYFKSTQK 1892
            W   DWS  CS  C   G Q R V C +       +   D CV     KP   + C  + PC P   + +    +C   C    + R I  +K +  + +V    +C    KPV   EC   EC+  W  +EW+ CSR+CG+ G+Q R + C+  +        C   +   P+  ++CN   C  +  D +  C+ +++ C M +         Y  +CC +C +  +  ++
Sbjct:  958 WYFTDWSNTCSAQC-GPGVQKREVVCLTRGGVREGEGGGD-CVSE---KPSELKAC-NSGPCVPTLTWFSSPWTKCNVPCGDGTQRRDIICVKKMGNDFTVVPSTECAHLEKPVAVQECQMGECQSSWFTTEWSACSRSCGR-GLQVREVRCLTPDKT--HSQACDASSK--PEQEQACNTIPCGPQVTDKN--CRDRRDNCMMVVQARMCVYPYYKTACCASCTQSAQRAKR 1177          

HSP 7 Score: 50.447 bits (119), Expect = 8.186e-6
Identity = 39/127 (30.71%), Postives = 59/127 (46.46%), Query Frame = 3
Query:  396 DCENGYVWKFTDWSKCSHTCGYEGIQLREVECYH-SSGQVVDQEMCDENKKP-KSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCL-SLLNTGKVIDLPRAACYAKGLVPPASWRQCF 767
            D +  +VW+    ++CS +CG +G Q R + C +  + + V +  CD   KP      CN ++CPP +    W +  V    C PG Q+R L C  S  N   ++   R A     L PP S + C 
Sbjct:  775 DTQLPFVWRRGGLTQCSASCG-KGFQHRVIICVNRQTDEEVPERKCDSAAKPVPEEEPCNTHSCPPFWEVSAWSECSV---SCGPGMQQRQLQCRQSFGNRSTMVHPQRCA----NLTPPPSTQACH 893          
BLAST of ADAMTS-like protein 3 vs. Ensembl Medaka
Match: THSD4 (thrombospondin type 1 domain containing 4 [Source:NCBI gene;Acc:101159659])

HSP 1 Score: 72.0182 bits (175), Expect = 1.814e-12
Identity = 54/179 (30.17%), Postives = 80/179 (44.69%), Query Frame = 3
Query:  231 EIDIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKF-TDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLVPPASWRQC 764
            +I  WS+CS TCG G+Q +   C +       N+    C H+ + + T   C    C     W+  ++W+ CS  CG  G + REV C  + G  V  E C+ N +P  +  C+   C  ++   EW  KC   ++C  G + R + CL    T  +  LP   C   G   PA  R C
Sbjct:  610 DIGEWSECSKTCGLGMQHRQVLCRQVYANRTLNVHTSHCRHLERPE-TASSCQLKICSE---WQIRSEWTSCSVPCGL-GQRSREVRCVSNVGDFVSDEECNMNLRPIDMENCDMGACAKSWFYTEWGDKCS--AECGMGVKTRGVLCL----TNHISSLPLEGC---GSERPADSRVC 774          

HSP 2 Score: 66.2402 bits (160), Expect = 1.050e-10
Identity = 42/117 (35.90%), Postives = 58/117 (49.57%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNF 593
            WS+CS  CG G Q++   C  K+   I  +P  +C  + +  ++ + CN   C  G  W  T+WS CS TC   G ++REV C  S  +V   E CDE  KP +   CN   C P  
Sbjct:  790 WSQCSAECGPGSQQRAVVCLVKSEEGISVMPPYECSSLNR-PLSQQSCNLKAC--GAKWYHTEWSACSKTC-EGGFRVREVRCL-SDHEVQSSEGCDERLKPAARESCNPEPCMPQI 901          

HSP 3 Score: 60.077 bits (144), Expect = 8.812e-9
Identity = 49/146 (33.56%), Postives = 66/146 (45.21%), Query Frame = 3
Query:  249 KCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQ---VVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLS 677
            KCS  CG GV+ +   C       I ++P++ C    +    +RVCN G CEN   W    WS+CS  CG  G Q R V C   S +   V+    C    +P S + CN   C   +   EW   C K   C  G + R++ CLS
Sbjct:  734 KCSAECGMGVKTRGVLCLTNH---ISSLPLEGCGS--ERPADSRVCNNGPCENRIEWFTGPWSQCSAECG-PGSQQRAVVCLVKSEEGISVMPPYECSSLNRPLSQQSCNLKACGAKWYHTEW-SACSKT--CEGGFRVREVRCLS 870          

HSP 4 Score: 50.8322 bits (120), Expect = 5.938e-6
Identity = 41/156 (26.28%), Postives = 68/156 (43.59%), Query Frame = 3
Query:  246 SKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVEC---YHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVID 704
            ++CS +CG+GV+  +  C  +  ++   +    C+   +       CN   C     W   +WS+CS TCG  G+Q R+V C   Y +    V    C   ++P++   C    C    +  EW    V    C  GQ+ R++ C+S  N G  + 
Sbjct:  556 TECSVSCGKGVRYPIFHCVNRLNHV--QVSDSLCDSSSRPSSQEEACNLQPCPG--FWDIGEWSECSKTCGL-GMQHRQVLCRQVYANRTLNVHTSHCRHLERPETASSCQLKICSEWQIRSEWTSCSVP---CGLGQRSREVRCVS--NVGDFVS 701          
BLAST of ADAMTS-like protein 3 vs. Ensembl Medaka
Match: ENSORLT00000034543.1 (pep primary_assembly:ASM223467v1:18:11549707:11555570:-1 gene:ENSORLG00000021989.1 transcript:ENSORLT00000034543.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.3142 bits (155), Expect = 3.543e-11
Identity = 47/170 (27.65%), Postives = 80/170 (47.06%), Query Frame = 3
Query:  396 DCENGYVWKFTDWSKCSHTCGYEGIQLREVECYH-----SSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLVPPASWRQCFDHIDPKKCFKKSEFLPEIISEKRTLVQMRRVEKLNLQVGQI 890
            +    + WK  +WS CS TCG  G+  R V C H     S+  V+  E      KP  ++ CNR++CPP +    W  +C +   C+ G QRR + C   L  G V++LP + C ++    P S +QC     P + +  ++++ +++      V+ R +  +      I
Sbjct:   51 ETSGSHRWKTGEWSSCSATCGV-GLMTRAVACTHRPFADSNRTVILGEGDCHLPKPSPVQACNRFDCPPLWDLHPW-GQCSQ--SCAGGVQRRRVLCKQRLADGSVMELPDSFCPSRR---PPSQQQCEKQDCPAQ-WITTDWVDQVVKMPMVAVEHRCILLVTFSYAHI 212          

HSP 2 Score: 58.5362 bits (140), Expect = 2.930e-9
Identity = 42/139 (30.22%), Postives = 63/139 (45.32%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFK-------KTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDE---NKKPKSLRGCNRYNCPPNFLAKEWKKKCVKI 629
            WS CS TCG G+  +  AC         +TV L E      C H+PK     + CN  DC    +W    W +CS +C   G+Q R V C          E+ D    +++P S + C + +CP  ++  +W  + VK+
Sbjct:   63 WSSCSATCGVGLMTRAVACTHRPFADSNRTVILGEG----DC-HLPK-PSPVQACNRFDCPP--LWDLHPWGQCSQSCA-GGVQRRRVLCKQRLADGSVMELPDSFCPSRRPPSQQQCEKQDCPAQWITTDWVDQVVKM 192          
BLAST of ADAMTS-like protein 3 vs. Ensembl Medaka
Match: adamts3 (A disintegrin and metalloproteinase with thrombospondin motifs 3 [Source:NCBI gene;Acc:101167013])

HSP 1 Score: 67.781 bits (164), Expect = 4.093e-11
Identity = 48/147 (32.65%), Postives = 67/147 (45.58%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVEC----YHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSC 671
            WS CS  C  G Q+    C KK     + I    C+   K K   R+CN  DC     W   +W  C+ TCG  G Q+R V C    +  + + +  + C  N+KP+S R CNR  CP  +    W +  V    C  G +RR ++C
Sbjct:  832 WSPCSKPCSGGFQQTKYGCRKKGD--TKMIHRGFCDANKKPKPIRRMCNLQDCTQPQ-WVSDEWEHCTKTCGSLGFQIRTVRCLQLFHDGTNRSIHSKYC-SNEKPESRRPCNRTPCPSQWRTGAWSECSVT---CGEGTERRLVTC 971          

HSP 2 Score: 50.447 bits (119), Expect = 7.159e-6
Identity = 70/288 (24.31%), Postives = 123/288 (42.71%), Query Frame = 3
Query: 1053 FLIQDQGEWRCLAGNISDSIVIKSKSPSDGYKDWAIRNSISNKDMPNE----LVQLDMMQENHVRWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHC--IGYEKARTIGDLKCIFQ--NQSVGLEKCDS----TRKPVYECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSCNPPKC-NLKC-VDMHPSCKRK--KEYCRMGIYSFSCCKTCQ 1868
            ++I+   E     G + D +V+         KD   R+++  K + +E    +   +++QE    W + +WS CS  C   GFQ     C   +K     +    C     PKP  +    ++   PQW   +     CT  C  +G++  RT+  L+      N+S+  + C +    +R+P   C    C  +W+   W++CS TCG+ G + R + C         G+ C+    E P+ ++ C P  C +  C  D    C+ +    YC +  Y+  CC +C+
Sbjct:  767 YMIEGDVETLHTDGPLHDPVVVLIIP-----KDNETRSTLMYKYVIHEDSVPVHNNNVIQEETYEWALKNWSPCSKPCSG-GFQQTKYGCR--KKGDTKMIHRGFCDANKKPKPIRRMCNLQDCTQPQW--VSDEWEHCTKTCGSLGFQ-IRTVRCLQLFHDGTNRSIHSKYCSNEKPESRRP---CNRTPCPSQWRTGAWSECSVTCGE-GTERRLVTCR-------MGDQCF---GEKPETVRLCRPGSCYDGPCHGDKSIFCQMEVLARYCSIPGYNKLCCDSCR 1029          
BLAST of ADAMTS-like protein 3 vs. Planmine SMEST
Match: SMESG000073134.1 (SMESG000073134.1)

HSP 1 Score: 1186.4 bits (3068), Expect = 0.000e+0
Identity = 575/581 (98.97%), Postives = 576/581 (99.14%), Query Frame = 3
Query:  174 CLFDGQSIGNRPIGKAFLEEIDIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLVPPASWRQCFDHIDPKKCFKKSEFLPEIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWGHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIKSKSPSDGYKDWAIRNSISNKDMPNELVQLDMMQENHVRWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEKCDSTRKPVYECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSCNPPKCNLKCVDMHPSCKRKKEYCRMGIYSFSCCKTCQEYFKSTQKNQDNGNTR 1916
            CLFDGQSIGNRPIGK FLEEIDIWSKCSTTCGEGVQEK QACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKV+DLPRAACYAKGLVPPASWRQCFDHIDPKKCFKKSEFLPEIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIW HKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIKSKSPSDGYKDWAIRNSISNKDMPNELVQLDMMQENHVRWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEKCDSTRKPVYECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSCNPPKCNLKCVDMHPSCKRKKEYCRMGIYSFSCCKTCQEYFK TQK QDNGNTR
Sbjct:   17 CLFDGQSIGNRPIGKVFLEEIDIWSKCSTTCGEGVQEKFQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVVDLPRAACYAKGLVPPASWRQCFDHIDPKKCFKKSEFLPEIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWAHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIKSKSPSDGYKDWAIRNSISNKDMPNELVQLDMMQENHVRWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEKCDSTRKPVYECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSCNPPKCNLKCVDMHPSCKRKKEYCRMGIYSFSCCKTCQEYFKFTQKKQDNGNTR 597          
BLAST of ADAMTS-like protein 3 vs. Planmine SMEST
Match: SMESG000073115.1 (SMESG000073115.1)

HSP 1 Score: 578.556 bits (1490), Expect = 0.000e+0
Identity = 267/568 (47.01%), Postives = 389/568 (68.49%), Query Frame = 3
Query:  177 LFDGQSIGNRPIGKAFLEEIDIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLVPPASWRQCFDHIDPKKCFKKSEFLPEIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWGHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIKSKSPSDGYKDWAIRNSISNKDMPNELVQLDMMQENHVRWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEKCDSTRKPVYECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSCNPPKCNLKCVDMHPSCKRKKEYCRMGIYSFSCCKTCQEYFK 1880
            L        + I K F+ EI++WS CS TCG G Q+KL+ CF+ T+YL+ENIP + C +   +  T R CNYGDC NG+VW    W++CSH+CG  GIQ REVEC  S G+ VD + C++ +KP++ R C RYNCPP F++  W+  CV  S C  G Q R + C+SLL+ G V+ LP  ACY KGL+ P + R C      +KC  +     EI  + RTLVQM  +++L++Q+GQ+S++  GTRL+L C +K F   N+IW HK  ++ YK ++ +R+R+++ G+++I  F   D+GEW C AG++S  + +KS++  +GY+DW IRN     D+PN L +L ++ ++  RWV G WS+CS+SCE+TG Q R V CE L   FYY+L D+EC++ +  KP +KR+C   F CP+W   NV+L+QC++HCIG  +A    +++CIF++Q   L++CD   KP+ EC N  CRV+WKIS WT+CSR+CG++GIQARYLICVW+ + LPAG++C  INL++PQV+KSC PPKC LKC+D++  C++KK+YC + I+ + CCKTC+ +F+
Sbjct:   17 LLTKAQFEEKEIRKPFIHEINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEP-CVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHS----RKCLMEKSTNLEIKIDNRTLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDWEIRNIQLQSDLPNVLTKLSVIMKDIARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPTDLKRCDIKAKPMMECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICNQINLKLPQVMKSCTPPKCLLKCIDVYKICEKKKKYCHIEIFYYRCCKTCRLFFQ 579          
BLAST of ADAMTS-like protein 3 vs. Planmine SMEST
Match: SMESG000079770.1 (SMESG000079770.1)

HSP 1 Score: 485.337 bits (1248), Expect = 1.854e-161
Identity = 239/566 (42.23%), Postives = 349/566 (61.66%), Query Frame = 3
Query:  216 KAFLEEIDIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYH--SSGQVV--DQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLVPPASWRQCFDHIDPKKCFKKSEFLPEIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWGHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIKSKSPSDGYKDWAIRNSISNKDMPNELVQLDMMQENHVRWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEKCDSTRKPVYECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSCNPPKCNLKCVDMHPSCKRKKEYCRMGIYSFSCCKTCQEYFKSTQKNQD 1901
            + F  E+D W+ CSTTCG G ++K   C KK+ Y  E +  + C+ +P I  T + CN G+C + YVWK   WS+CS TCG  G + R+VEC +   SG +V  D + C+ + +P++   CN  +CP   +  EW K C K   CS G QRR ++C+S+L  GK   +PR AC +  + PP SWR+C+DH++ K+C K     P I  +K TLVQMR+ + LN+ VGQ++YV+  TR+ +NCPV  F+  +++W H    Y Y GKSK+ IRV +KG+L I+ F  +DQG W C+AG  + S +IK ++P+ G++DW +R ++ NK+M NE  ++ M +   ++W+   WSQCSV+C   GFQSR V CE  +K+ Y  L D  C ++   KP  +R C     CP+W    +N + CT+ CI     +  G+L CI Q Q +    CD   K   EC N +C+V WK S W+KCS++CG  GI ARYLIC+W+N++ PAG+LCY   + +P+V+KSC  PKCNLKCVD++ SCK   + C   IY ++CCK+C    + ++   D
Sbjct:   32 QTFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGK-CKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHAC-SSTIKPPVSWRKCYDHMNTKECLKDLRIPPIIEIKKNTLVQMRKTKLLNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVWKHGNTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKVRNPAVGFQDWKLRTTLWNKEMLNEDPEVGMTRNEVIQWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHCIHQGQIIEASACDKKEKYNMECPNEKCQVGWKTSNWSKCSKSCGGIGIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKSCRAPKCNLKCVDLYASCKPHAKKCIQSIYRYTCCKSCSRLAELSKMQGD 595          
BLAST of ADAMTS-like protein 3 vs. Planmine SMEST
Match: SMESG000042318.1 (SMESG000042318.1)

HSP 1 Score: 435.261 bits (1118), Expect = 2.218e-143
Identity = 210/564 (37.23%), Postives = 317/564 (56.21%), Query Frame = 3
Query:  243 WSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQV----VDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLVPPASWRQCFDHIDPKKCFKKSEFLP----EIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWGHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIKSKSPSDGYKDWAIRNSISNKDMPNELVQLDMMQENHVRWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEKCDSTRKPVYECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSCNPPKCNLKCVDMHPSCKRKKEYCRMGIYSFSCCKTCQEYFKSTQKNQDNGN 1910
            WS CS TCGEG Q K + C  K    +      +C  +       R C   +C   Y WK + WS+CSH+CG  G + R+VEC H+  +     V +  C +  KP     CNR +CPP F+  +W K CVK   C PG Q+R L+C  +L +G++  +P   CY K   PPA WR+C+D I+  KC K    +P    E         QMRR + + LQ+GQI+Y+ P +R+ + CPV+NF   N+IW HK   + Y G+   RIRV R G++ I+  L QDQGEW C+A     S +IK ++PS G++DWA+RN++    M +E     + ++  V+W+  DWS CSV+C   G Q R V CE ++ RFY  L D++C ++V P P   R C     CP W  + ++ ++CT+ C+    +  + +LKCI+ NQ V L  C+  +KP   C N  C ++W+++ W+KCS++C   G QAR + CVW++++  AG+LCY     +P+V++ C    CN+KC+D+   C  + + C   +Y + CC TCQ Y++   +   + N
Sbjct:   35 WSPCSVTCGEGKQTKEKFCAIKVNSTVIKTSKHRCSRLKASHTLIRFCYQTECPEKYRWKTSSWSQCSHSCGNLGFRFRDVECSHNISETNSIGVAEFFCAKFIKPMQRSLCNRVDCPPEFVTGKWGK-CVKGQGCHPGNQKRKLNCSQILQSGEIKQMPLFRCYTKKRPPPAQWRKCYDFINIPKCLKG---IPPRKVEFTMSNNNFYQMRRAKIVQLQIGQIAYLLPYSRIIITCPVENFPQHNIIWTHKNDTFKYNGRVSKRIRVDRIGQIRIRKLLFQDQGEWNCIADRSQKSAIIKIRNPSSGFRDWAVRNNLWKTGMLSEDSNKPINRQELVQWITSDWSVCSVTCSGDGLQYREVHCEKVEPRFYLVLDDNDC-EKVTPAPNKMRNCYTAIECPLWKVERIDKSKCTNECVDIRLSSVLVELKCIYMNQDVPLHLCEQKKKPEITCQNEACHLDWRLNSWSKCSKSCDGVGFQARSIACVWKSTRKSAGSLCYENKFPLPKVVRECETKPCNMKCIDLSTKCSSEPKRCHQNLYKYLCCYTCQTYYQKLNEQNSSKN 593          
BLAST of ADAMTS-like protein 3 vs. Planmine SMEST
Match: SMESG000002617.1 (SMESG000002617.1)

HSP 1 Score: 347.436 bits (890), Expect = 1.084e-109
Identity = 207/571 (36.25%), Postives = 309/571 (54.12%), Query Frame = 3
Query:  213 GKAFLEEIDIWSKCSTTCGEGVQEKLQACFKKT-VYLIENIPMDKCEHIPKIKV-TTRVCNYGDCENG----YVWKFTDWSKCSHTCGYEGIQLREVECYHS--SGQVVDQEM--CDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDC-SPGQQRRDLSCLSLLNTGKVIDLPRAACYAKGLVPPASWRQCFDHIDPK---KC---FKKSEFLPEIIS-EKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWGHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIKSKSPSDGYKDWAIRNSISNKDM--PNELVQLDMMQENHVRWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEKCDSTRKPVYECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSCNPPKCNLKCVDMHPSCKRKKEYCRMGIYSFSCCKTC 1865
            GK   +   +WS CS  CG GVQE L AC +KT +   E +  DKC  I K +  T + C  G C       ++WK  +W+ CS +CG EG++ R+V+C  S  SG  ++ +   C    +P     C  ++CPP F    W K C K+ +C SPG +RR ++C+     G    +P+  CY +   PPA+W  CF   DP+   KC    KK +  P IIS  K  +  MR  +KL L VGQ ++V P TR+ + CPV NF S NL W    I Y +  ++K RI V+RKG LIIK F  +D+G+W C AG I+  I I +++PSDG+  +  R     +D+        +  ++    +WV+G WS CS SC   G+Q+R V CE +++R++ ++   +C+++ + KP   REC     CP W       ++CT+ C+   K+     LKC ++N+ +    CD + +P+  C+N  C + WK  +W+ CS +CG  GI+AR + C W N    AG+LC    + +P ++K C+ P CNL C+D+   C  KK  C +  Y   CCKTC
Sbjct:   26 GKFEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLK-CTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRS-KPPATWESCFK--DPEYQSKCQFKDKKKKRKPPIISISKLKIHHMRSSKKLKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAGTITAEIEILTQNPSDGFSHYLSRIIYFKEDIVEGKNNSAIKYIKPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPNNCDLSTQPIETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPCNLGCMDLSKHCGLKK-LCSVDHYQHFCCKTC 591          
The following BLAST results are available for this feature:
BLAST of ADAMTS-like protein 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ADAMTSL37.622e-2729.93ADAMTS like 3 [Source:HGNC Symbol;Acc:HGNC:14633][more]
ADAMTSL37.940e-2729.84ADAMTS like 3 [Source:HGNC Symbol;Acc:HGNC:14633][more]
ADAMTSL13.467e-2026.34ADAMTS like 1 [Source:HGNC Symbol;Acc:HGNC:14632][more]
ADAMTSL14.022e-2028.53ADAMTS like 1 [Source:HGNC Symbol;Acc:HGNC:14632][more]
ADAMTS92.453e-1725.00ADAM metallopeptidase with thrombospondin type 1 m... [more]
back to top
BLAST of ADAMTS-like protein 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
madd-46.530e-3724.64pep chromosome:WBcel235:I:8931035:8937718:-1 gene:... [more]
madd-41.222e-3624.56pep chromosome:WBcel235:I:8931035:8942287:-1 gene:... [more]
madd-41.378e-3624.56pep chromosome:WBcel235:I:8931035:8942287:-1 gene:... [more]
gon-13.166e-1524.68A disintegrin and metalloproteinase with thrombosp... [more]
gon-13.988e-1524.68A disintegrin and metalloproteinase with thrombosp... [more]
back to top
BLAST of ADAMTS-like protein 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nolo1.913e-2328.52gene:FBgn0051619 transcript:FBtr0339132[more]
nolo2.116e-2331.78gene:FBgn0051619 transcript:FBtr0301000[more]
nolo2.311e-2331.78gene:FBgn0051619 transcript:FBtr0307497[more]
nolo2.311e-2331.78gene:FBgn0051619 transcript:FBtr0110959[more]
nolo2.547e-2331.78gene:FBgn0051619 transcript:FBtr0085901[more]
back to top
BLAST of ADAMTS-like protein 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adamtsl34.947e-2528.71ADAMTS-like 3 [Source:ZFIN;Acc:ZDB-GENE-121030-8][more]
ADAMTS72.864e-1233.33ADAM metallopeptidase with thrombospondin type 1 m... [more]
adamts22.487e-1130.61ADAM metallopeptidase with thrombospondin type 1 m... [more]
adamts22.488e-1130.07ADAM metallopeptidase with thrombospondin type 1 m... [more]
LO018340.13.614e-1128.57ADAMTS-like 4 [Source:NCBI gene;Acc:100333903][more]
back to top
BLAST of ADAMTS-like protein 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vash11.465e-3031.31vasohibin 1 [Source:Xenbase;Acc:XB-GENE-956494][more]
vash12.088e-3031.54vasohibin 1 [Source:Xenbase;Acc:XB-GENE-956494][more]
ADAMTSL11.317e-2821.91ADAMTS like 1 [Source:NCBI gene;Acc:100494603][more]
ADAMTSL11.134e-2324.53ADAMTS like 1 [Source:NCBI gene;Acc:100494603][more]
ADAMTSL11.184e-2324.53ADAMTS like 1 [Source:NCBI gene;Acc:100494603][more]
back to top
BLAST of ADAMTS-like protein 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Adamtsl35.232e-2530.03ADAMTS-like 3 [Source:MGI Symbol;Acc:MGI:3028499][more]
Adamtsl17.850e-2329.68ADAMTS-like 1 [Source:MGI Symbol;Acc:MGI:1924989][more]
Adamtsl13.447e-2126.94ADAMTS-like 1 [Source:MGI Symbol;Acc:MGI:1924989][more]
Adamts95.490e-1624.18a disintegrin-like and metallopeptidase (reprolysi... [more]
Adamts99.048e-1323.73a disintegrin-like and metallopeptidase (reprolysi... [more]
back to top
BLAST of ADAMTS-like protein 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P90884|MADD4_CAEEL1.554e-3524.56Protein madd-4 OS=Caenorhabditis elegans OX=6239 G... [more]
sp|P82987|ATL3_HUMAN3.660e-2629.93ADAMTS-like protein 3 OS=Homo sapiens OX=9606 GN=A... [more]
sp|Q8BLI0|ATL1_MOUSE2.411e-2026.94ADAMTS-like protein 1 OS=Mus musculus OX=10090 GN=... [more]
sp|Q8N6G6|ATL1_HUMAN1.932e-1928.53ADAMTS-like protein 1 OS=Homo sapiens OX=9606 GN=A... [more]
sp|Q9P2N4|ATS9_HUMAN5.926e-1625.00A disintegrin and metalloproteinase with thrombosp... [more]
back to top
BLAST of ADAMTS-like protein 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183JCE11.891e-13636.47Ig-like domain-containing protein OS=Schistosoma c... [more]
A0A094ZL012.233e-13636.61ADAMTS-like protein 3 OS=Schistosoma haematobium O... [more]
A0A4E0R7Q31.299e-13538.11AdamTS protein 3 OS=Fasciola hepatica OX=6192 GN=D... [more]
A0A564ZBH02.601e-13539.79Ig-like domain-containing protein OS=Hymenolepis d... [more]
A0A0R3S9E23.143e-13539.79Ig-like domain-containing protein OS=Hymenolepis d... [more]
back to top
BLAST of ADAMTS-like protein 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adamtsl33.832e-2729.57ADAMTS-like protein 3 [Source:NCBI gene;Acc:103028... [more]
ENSAMXT00000039281.11.229e-1524.70pep primary_assembly:Astyanax_mexicanus-2.0:16:258... [more]
si:ch211-267e7.35.546e-1231.45ADAMTS-like protein 2 [Source:NCBI gene;Acc:103033... [more]
ADAMTS203.494e-1132.97ADAM metallopeptidase with thrombospondin type 1 m... [more]
adamts23.501e-1130.72A disintegrin and metalloproteinase with thrombosp... [more]
back to top
BLAST of ADAMTS-like protein 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adamtsl36.674e-2025.23ADAMTS-like 3 [Source:ZFIN;Acc:ZDB-GENE-121030-8][more]
ENSPMAT00000000756.19.370e-1325.11pep scaffold:Pmarinus_7.0:GL477404:44246:61450:-1 ... [more]
adamts176.324e-1228.57ADAM metallopeptidase with thrombospondin type 1 m... [more]
ENSPMAT00000000757.17.938e-1227.92pep scaffold:Pmarinus_7.0:GL477404:45077:62293:-1 ... [more]
ADAMTS73.450e-1128.42ADAM metallopeptidase with thrombospondin type 1 m... [more]
back to top
BLAST of ADAMTS-like protein 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ADAMTS-like protein 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO443761.636e-1423.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO363992.575e-1136.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO306651.240e-1035.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352021.244e-1027.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO377241.764e-930.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ADAMTS-like protein 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adamts96.380e-1330.00ADAM metallopeptidase with thrombospondin type 1 m... [more]
ENSORLT00000013062.21.162e-1234.17thrombospondin type-1 domain-containing protein 4 ... [more]
THSD41.814e-1230.17thrombospondin type 1 domain containing 4 [Source:... [more]
ENSORLT00000034543.13.543e-1127.65pep primary_assembly:ASM223467v1:18:11549707:11555... [more]
adamts34.093e-1132.65A disintegrin and metalloproteinase with thrombosp... [more]
back to top
BLAST of ADAMTS-like protein 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000073134.10.000e+098.97SMESG000073134.1[more]
SMESG000073115.10.000e+047.01SMESG000073115.1[more]
SMESG000079770.11.854e-16142.23SMESG000079770.1[more]
SMESG000042318.12.218e-14337.23SMESG000042318.1[more]
SMESG000002617.11.084e-10936.25SMESG000002617.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029046 ID=SMED30029046|Name=ADAMTS-like protein 3|organism=Schmidtea mediterranea sexual|type=transcript|length=2382bp
TTTTTATTGAAAATAAACTAAAGCAAAATCTGCGTGCTTGACAGATTTTA
AGCTTAGTTTAACTGATTAGTGTAAAAGATTAGCTTATGCTTCCATTCAA
TCTGATCAATTTCCTTTGGTCTGGTATGATTTCTTTTGGCGGAATTTTGA
TTATTATCATCAATTTTGCTATTTGCTTATTTGATGGTCAGTCGATTGGA
AATCGTCCAATTGGAAAAGCATTTCTAGAGGAAATCGACATTTGGAGCAA
ATGCTCAACGACTTGCGGAGAAGGAGTCCAAGAGAAATTACAAGCTTGTT
TTAAGAAAACAGTCTATTTAATTGAAAATATTCCAATGGACAAATGTGAA
CATATTCCAAAAATAAAAGTGACAACGAGAGTTTGTAATTACGGTGATTG
TGAAAACGGCTACGTATGGAAGTTCACAGATTGGAGTAAATGTAGCCATA
CTTGTGGCTATGAAGGAATTCAATTACGAGAAGTGGAATGTTATCATTCC
AGTGGCCAAGTTGTCGACCAAGAAATGTGCGATGAGAATAAAAAGCCAAA
ATCATTAAGAGGATGCAACAGATATAATTGTCCCCCTAATTTTCTGGCCA
AAGAATGGAAAAAGAAATGCGTAAAAATCAGTGATTGCTCTCCGGGTCAA
CAAAGGCGTGATTTAAGCTGTTTAAGCTTATTAAACACAGGAAAAGTTAT
AGATCTTCCCAGAGCTGCATGCTATGCTAAGGGCCTTGTTCCACCAGCAA
GTTGGCGGCAATGCTTTGATCACATAGATCCCAAAAAATGTTTCAAAAAA
AGTGAATTTCTCCCAGAAATAATTTCTGAAAAGCGAACACTGGTCCAAAT
GAGAAGAGTTGAAAAACTCAACCTTCAAGTTGGGCAAATATCTTACGTAT
TTCCTGGAACAAGATTGACATTGAATTGTCCAGTAAAAAACTTTTTGTCT
TCAAATTTAATATGGGGCCACAAAAAAATAGAGTATTTTTATAAAGGGAA
ATCTAAAAATAGAATAAGGGTTACAAGAAAAGGAAAATTAATTATCAAAT
CTTTTCTTATTCAAGATCAAGGAGAATGGCGTTGTTTAGCTGGAAATATT
AGTGACTCTATTGTAATAAAGTCAAAAAGTCCTTCTGATGGATATAAAGA
TTGGGCAATAAGAAATTCTATATCTAACAAAGATATGCCCAACGAACTTG
TACAGTTAGACATGATGCAAGAAAATCATGTTCGATGGGTTATAGGAGAT
TGGAGTCAATGTTCTGTGTCATGTGAAAACACTGGATTTCAAAGTAGAAT
GGTTCGCTGCGAAAGTTTACAAAAACGTTTTTACTATCAACTGTCAGACG
ATGAATGTGTTCAAAGAGTTGCCCCAAAACCGTTTGCAAAAAGAGAATGC
CCCAGAAATTTCCCATGTCCTCAATGGAACTTCAAAAACGTGAACTTGAA
TCAGTGCACGGATCATTGCATTGGCTACGAAAAAGCTCGCACAATTGGAG
ATTTAAAATGCATATTTCAAAATCAGTCAGTGGGACTTGAAAAATGCGAT
TCTACAAGAAAACCAGTTTATGAATGTTATAATGCTGAATGTCGAGTTGA
ATGGAAGATCAGTGAATGGACAAAATGTTCAAGAACTTGTGGAAAAAGTG
GAATCCAAGCCCGGTACTTAATTTGCGTATGGGAAAATTCCAAGTTGCCA
GCTGGTAATTTATGTTACTTAATAAATCTCGAAGTTCCTCAAGTCTTAAA
ATCATGCAACCCTCCGAAATGTAACTTAAAATGTGTCGACATGCATCCGA
GCTGTAAAAGAAAAAAAGAATATTGTCGAATGGGGATTTACAGTTTTTCT
TGCTGCAAAACTTGCCAAGAATATTTCAAATCTACTCAGAAAAACCAGGA
CAATGGAAATACTCGATGATTTTCATTGTTAATTAATATTCATTTTATAA
TTCAACTAAAATTTCAGTTCATACTTGTGAAAAGTCTTTACATTGTTTCG
ATAGTTTTAATAAATGTGCACTCATCCCTCGATTCGTTTTGCGCGGTTTC
ATTTTTATTTTTTCAAAAGAAAACCAAATTTTTTTAAATACACTCATCTT
TCGACTTACGCATTTATATTATCTGGAACCTATATTACATTTTTGACTTC
CTTGATCTAGAGATTTCTGTTTACGCGATTTTTCTTAGAACCAACCAACC
GCGTAAGTCTAGGTATTAGTGTTAGTCTTTTTTAATGATTATTGAATGAC
TTAATTTATAGAAATGTTTAATTCAGTTTAATTCATTATAATTTTCATTG
AAATAATAATATTAATAATTAATCCGAAACTCGAACATTCATTCGAAACA
ATGTTTACTATGTTATATACTTTCCAATTGCA
back to top

protein sequence of SMED30029046-orf-1

>SMED30029046-orf-1 ID=SMED30029046-orf-1|Name=SMED30029046-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=611bp
MLPFNLINFLWSGMISFGGILIIIINFAICLFDGQSIGNRPIGKAFLEEI
DIWSKCSTTCGEGVQEKLQACFKKTVYLIENIPMDKCEHIPKIKVTTRVC
NYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDE
NKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLN
TGKVIDLPRAACYAKGLVPPASWRQCFDHIDPKKCFKKSEFLPEIISEKR
TLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWGHKKIEY
FYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIKSKSPS
DGYKDWAIRNSISNKDMPNELVQLDMMQENHVRWVIGDWSQCSVSCENTG
FQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFK
NVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEKCDSTRKPVYECYNA
ECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEV
PQVLKSCNPPKCNLKCVDMHPSCKRKKEYCRMGIYSFSCCKTCQEYFKST
QKNQDNGNTR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000106ciliated epithelial cell
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036383TSP1_rpt_sf
IPR036179Ig-like_dom_sf
IPR000884TSP1_rpt
IPR013783Ig-like_fold
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008233peptidase activity
GO:0008237metallopeptidase activity
GO:0008270zinc ion binding
Vocabulary: cellular component
TermDefinition
GO:0005578proteinaceous extracellular matrix
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
GO:0007229integrin-mediated signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000884Thrombospondin type-1 (TSP1) repeatSMARTSM00209TSP1_2coord: 492..550
e-value: 0.11
score: 17.7
coord: 97..153
e-value: 0.01
score: 25.0
coord: 370..432
e-value: 0.19
score: 15.7
coord: 34..93
e-value: 0.78
score: 10.2
IPR000884Thrombospondin type-1 (TSP1) repeatPFAMPF00090TSP_1coord: 374..400
e-value: 9.7E-4
score: 19.3
coord: 40..61
e-value: 0.0011
score: 19.1
coord: 496..549
e-value: 1.1E-4
score: 22.4
coord: 100..152
e-value: 8.8E-6
score: 25.8
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 489..550
score: 8.977
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 368..432
score: 8.233
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 94..153
score: 10.179
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilyGENE3DG3DSA:2.20.100.10coord: 97..153
e-value: 2.7E-10
score: 42.5
coord: 488..549
e-value: 3.4E-6
score: 29.4
coord: 369..432
e-value: 8.7E-7
score: 31.3
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilyGENE3DG3DSA:2.20.100.10coord: 27..96
e-value: 5.0E-8
score: 34.6
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 367..427
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 488..549
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 94..152
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 40..92
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 250..335
e-value: 1.7E-7
score: 33.2
NoneNo IPR availablePANTHERPTHR13723ADAMTS A DISINTEGRIN AND METALLOPROTEASE WITH THROMBOSPONDIN MOTIFS PROTEASEcoord: 39..223
coord: 320..582
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..21
score: 0.704
NoneNo IPR availableTMHMMTMhelixcoord: 2..24
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 230..337
score: 8.375
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 256..331