Multidrug resistance-associated protein 1

Overview
NameMultidrug resistance-associated protein 1
Smed IDSMED30029026
Length (bp)5261
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Multidrug resistance-associated protein 1 (SMED30029026) t-SNE clustered cells

Violin plots show distribution of expression levels for Multidrug resistance-associated protein 1 (SMED30029026) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Multidrug resistance-associated protein 1 (SMED30029026) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Multidrug resistance-associated protein 1 (SMED30029026) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30029026

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30029026h1SMcG0019624 Contig41031uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30029026h1SMcG0019624 Contig41031newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30029026h1SMcG0019624 dd_Smed_v4_3077_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30029026h1SMcG0019624 dd_Smed_v4_3077_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Human
Match: ABCC1 (ATP binding cassette subfamily C member 1 [Source:HGNC Symbol;Acc:HGNC:51])

HSP 1 Score: 1272.3 bits (3291), Expect = 0.000e+0
Identity = 727/1646 (44.17%), Postives = 1029/1646 (62.52%), Query Frame = 2
Query:  140 DWASEWNSPSPDIPTCFQ---FFDAPIYLLGYLILCFP-YIIHLIRKKVNERPFFKLTII---KLALIVCLMVLQILEIIYNAAKKNN---IPYAYTISNCSFLVCMSILAIMVGLERRCNAVNSGFYFNYWLLHFILCAVRARASGLSLKLKITNR-DYSRECFIFINLTFVTLSLVLSCFSEKVSQSEIERLNKKRKFQNVLHVNADDNHVSDRMEMSPNAVDSYKTTEKDILINKTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXX-XXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSH---DDTPGI-AATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSMENLKMDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFIN---GFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWP-VGCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNLI 5017
            DW   WN+ +PD   CFQ       P +   YL  CFP Y ++L R   ++R + ++T +   K AL   L ++   ++ Y+  +++    +   + +S     + M +   ++ LERR    +SG    +WL+  + CA+    S +   LK   + D  R+   ++  + + + LVLSCFS           ++   F   +H                                      D   CPE  +SFLSRI F+W T LIV+GY+ PL+  DLW LN E+    +VP+L++N+ K  A  +++  K   ++ + K+ +                 P +++K    +  E    K  +++++P L   L K+  PY L+S  +K IHD++ F GP +LKLL++FV+D++    W+GYF   L+ ++A ++T +LHQYFHI F  GMR+++++I AVYRK+L ++ ++RK STVGEIVNLMS+DAQ+F++L +YI+MIWS P Q+I AL LLW  LGPSVLAG+ +M+LM+PVNAV+   T+  Q   +K  D+RIK+MNEILNGIKVLKLYAWE +F + V  IR +ELK +K++AY +A  +FT+ C PFLV+L TF ++V I  +N+LDA+ AFVS+ LFNILRFPL +LPMVIS+++QASVSLKRL  FL  EE+  D++      D  G  + T++N  F W  + P P L  I  + PE  LVA+VG VGCGKSS+LSALL E+DK+EG+V +KGS+AYVPQQAWI N ++R+NI+FG   +   Y+ +I+AC L  D EIL   D TEIGEKG+NLSGGQKQRVSLARA YS++++YL DDPLSAVD+HVGK + +NVI   G+L   TRILVTH+++ L + D IIVM+ G +SE G+Y +L+   GAFA F+ T+ + E +    +N            +  +     E  Q    M+ + S  ++        L+  L    +    +  +     EL K      ++   KL+E + ++ G VK++VY  Y+++IG +++   I LF+     +L SN WL  W+D   +              N +Q           +   + L +YG  G  Q +     S+  +   I ++  LH  LL+ +LR PMS FE  P G ++NRFS +L+ V +M+P  I    G L   + A +V ++ T     II PL L+   Y  +QR YV++SRQLKRLESV +SP+YSHF ETL GVS IRA+   ++FI  +D KVD+N  +YY + V+NRWLA+ LE VGN IV  AALFAVIS  +   ++AGLVGLSVSY+L +T  LNWLVRMSSE+E+NIV+VER++EYS+   EAPW I E  P  +WP VG ++F NY  +YRE LD VL++IN  IN  EKVGIVGRTG+GKSSL L LFRI E ++GEI+IDG+ I ++GLHD+R ++TIIPQDPVLFSG+LR NLDPF+++ DEE+W  LE+++LK F V++  ++L+   +EGGENLSVGQRQLVCLARALLR+T ILVLDEATAAVDL+TD LIQ TIR +F++CT+LTIAHRLNT++DY +++VL+ GEI E  AP++LL+     FYSMAK + L+
Sbjct:   17 DWNVTWNTSNPDFTKCFQNTVLVWVPCF---YLWACFPFYFLYLSR---HDRGYIQMTPLNKTKTALGFLLWIVCWADLFYSFWERSRGIFLAPVFLVSPTLLGITMLLATFLIQLERRKGVQSSGIMLTFWLVALV-CALAILRSKIMTALKEDAQVDLFRDITFYVYFSLLLIQLVLSCFS-----------DRSPLFSETIH--------------------------------------DPNPCPESSASFLSRITFWWITGLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRKQPVK---VVYSSKDPA----------------QPKESSKVDANEEVEALIVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPQILKLLIKFVNDTKAPD-WQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWLNLGPSVLAGVAVMVLMVPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLKKSAYLSAVGTFTWVCTPFLVALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRPVKDGGGTNSITVRNATFTWARSDP-PTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEEN-----------GVTGVSGPGKEAKQMENGMLVTDSAGKQ--------LQRQLSSSSSYSGDISRHHNSTAELQK--AEAKKEETWKLMEADKAQTGQVKLSVYWDYMKAIGLFISFLSIFLFMCNHVSALASNYWLSLWTDDPIV--------------NGTQ-----------EHTKVRLSVYGALGISQGIAVFGYSMAVSIGGILASRCLHVDLLHSILRSPMSFFERTPSGNLVNRFSKELDTVDSMIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIPPLGLI---YFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHS---LSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVAVERLKEYSETEKEAPWQIQETAPPSSWPQVGRVEFRNYCLRYREDLDFVLRHINVTINGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGINIAKIGLHDLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWTSLELAHLKDF-VSALPDKLDHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVLDKGEIQEYGAPSDLLQQ-RGLFYSMAKDAGLV 1531          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Human
Match: ABCC1 (ATP binding cassette subfamily C member 1 [Source:HGNC Symbol;Acc:HGNC:51])

HSP 1 Score: 1272.3 bits (3291), Expect = 0.000e+0
Identity = 727/1646 (44.17%), Postives = 1029/1646 (62.52%), Query Frame = 2
Query:  140 DWASEWNSPSPDIPTCFQ---FFDAPIYLLGYLILCFP-YIIHLIRKKVNERPFFKLTII---KLALIVCLMVLQILEIIYNAAKKNN---IPYAYTISNCSFLVCMSILAIMVGLERRCNAVNSGFYFNYWLLHFILCAVRARASGLSLKLKITNR-DYSRECFIFINLTFVTLSLVLSCFSEKVSQSEIERLNKKRKFQNVLHVNADDNHVSDRMEMSPNAVDSYKTTEKDILINKTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXX-XXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSH---DDTPGI-AATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSMENLKMDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFIN---GFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWP-VGCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNLI 5017
            DW   WN+ +PD   CFQ       P +   YL  CFP Y ++L R   ++R + ++T +   K AL   L ++   ++ Y+  +++    +   + +S     + M +   ++ LERR    +SG    +WL+  + CA+    S +   LK   + D  R+   ++  + + + LVLSCFS           ++   F   +H                                      D   CPE  +SFLSRI F+W T LIV+GY+ PL+  DLW LN E+    +VP+L++N+ K  A  +++  K   ++ + K+ +                 P +++K    +  E    K  +++++P L   L K+  PY L+S  +K IHD++ F GP +LKLL++FV+D++    W+GYF   L+ ++A ++T +LHQYFHI F  GMR+++++I AVYRK+L ++ ++RK STVGEIVNLMS+DAQ+F++L +YI+MIWS P Q+I AL LLW  LGPSVLAG+ +M+LM+PVNAV+   T+  Q   +K  D+RIK+MNEILNGIKVLKLYAWE +F + V  IR +ELK +K++AY +A  +FT+ C PFLV+L TF ++V I  +N+LDA+ AFVS+ LFNILRFPL +LPMVIS+++QASVSLKRL  FL  EE+  D++      D  G  + T++N  F W  + P P L  I  + PE  LVA+VG VGCGKSS+LSALL E+DK+EG+V +KGS+AYVPQQAWI N ++R+NI+FG   +   Y+ +I+AC L  D EIL   D TEIGEKG+NLSGGQKQRVSLARA YS++++YL DDPLSAVD+HVGK + +NVI   G+L   TRILVTH+++ L + D IIVM+ G +SE G+Y +L+   GAFA F+ T+ + E +    +N            +  +     E  Q    M+ + S  ++        L+  L    +    +  +     EL K      ++   KL+E + ++ G VK++VY  Y+++IG +++   I LF+     +L SN WL  W+D   +              N +Q           +   + L +YG  G  Q +     S+  +   I ++  LH  LL+ +LR PMS FE  P G ++NRFS +L+ V +M+P  I    G L   + A +V ++ T     II PL L+   Y  +QR YV++SRQLKRLESV +SP+YSHF ETL GVS IRA+   ++FI  +D KVD+N  +YY + V+NRWLA+ LE VGN IV  AALFAVIS  +   ++AGLVGLSVSY+L +T  LNWLVRMSSE+E+NIV+VER++EYS+   EAPW I E  P  +WP VG ++F NY  +YRE LD VL++IN  IN  EKVGIVGRTG+GKSSL L LFRI E ++GEI+IDG+ I ++GLHD+R ++TIIPQDPVLFSG+LR NLDPF+++ DEE+W  LE+++LK F V++  ++L+   +EGGENLSVGQRQLVCLARALLR+T ILVLDEATAAVDL+TD LIQ TIR +F++CT+LTIAHRLNT++DY +++VL+ GEI E  AP++LL+     FYSMAK + L+
Sbjct:   17 DWNVTWNTSNPDFTKCFQNTVLVWVPCF---YLWACFPFYFLYLSR---HDRGYIQMTPLNKTKTALGFLLWIVCWADLFYSFWERSRGIFLAPVFLVSPTLLGITMLLATFLIQLERRKGVQSSGIMLTFWLVALV-CALAILRSKIMTALKEDAQVDLFRDITFYVYFSLLLIQLVLSCFS-----------DRSPLFSETIH--------------------------------------DPNPCPESSASFLSRITFWWITGLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRKQPVK---VVYSSKDPA----------------QPKESSKVDANEEVEALIVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPQILKLLIKFVNDTKAPD-WQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWLNLGPSVLAGVAVMVLMVPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLKKSAYLSAVGTFTWVCTPFLVALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRPVKDGGGTNSITVRNATFTWARSDP-PTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEEN-----------GVTGVSGPGKEAKQMENGMLVTDSAGKQ--------LQRQLSSSSSYSGDISRHHNSTAELQK--AEAKKEETWKLMEADKAQTGQVKLSVYWDYMKAIGLFISFLSIFLFMCNHVSALASNYWLSLWTDDPIV--------------NGTQ-----------EHTKVRLSVYGALGISQGIAVFGYSMAVSIGGILASRCLHVDLLHSILRSPMSFFERTPSGNLVNRFSKELDTVDSMIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIPPLGLI---YFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHS---LSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVAVERLKEYSETEKEAPWQIQETAPPSSWPQVGRVEFRNYCLRYREDLDFVLRHINVTINGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGINIAKIGLHDLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWTSLELAHLKDF-VSALPDKLDHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVLDKGEIQEYGAPSDLLQQ-RGLFYSMAKDAGLV 1531          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Human
Match: ABCC1 (ATP binding cassette subfamily C member 1 [Source:HGNC Symbol;Acc:HGNC:51])

HSP 1 Score: 1254.2 bits (3244), Expect = 0.000e+0
Identity = 708/1556 (45.50%), Postives = 993/1556 (63.82%), Query Frame = 2
Query:  416 FLVCMSILAI-------MVGLERRCNAVNSGFYFNYWLLHFILCAVRARASGLSLKLKITNR-DYSRECFIFINLTFVTLSLVLSCFSEKVSQSEIERLNKKRKFQNVLHVNADDNHVSDRMEMSPNAVDSYKTTEKDILINKTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXX-XXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSH---DDTPGI-AATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSM---ENLKMDLEKDVANITKLE-DNKRCQEELDKFLKPGAQKNGN-KLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFIN---GFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWP-VGCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNLI 5017
            FLV  ++L I       ++ LERR    +SG    +WL+  + CA+    S +   LK   + D  R+   ++  + + + LVLSCFS           ++   F   +H               PN                         CPE  +SFLSRI F+W T LIV+GY+ PL+  DLW LN E+    +VP+L++N+ K  A  +++  K   ++ + K+ +                 P +++K    +  E    K  +++++P L   L K+  PY L+S  +K IHD++ F GP +LKLL++FV+D++    W+GYF   L+ ++A ++T +LHQYFHI F  GMR+++++I AVYRK+L ++ ++RK STVGEIVNLMS+DAQ+F++L +YI+MIWS P Q+I AL LLW  LGPSVLAG+ +M+LM+PVNAV+   T+  Q   +K  D+RIK+MNEILNGIKVLKLYAWE +F + V  IR +ELK +K++AY +A  +FT+ C PFLV+L TF ++V I  +N+LDA+ AFVS+ LFNILRFPL +LPMVIS+++QASVSLKRL  FL  EE+  D++      D  G  + T++N  F W  + P P L  I  + PE  LVA+VG VGCGKSS+LSALL E+DK+EG+V +KGS+AYVPQQAWI N ++R+NI+FG   +   Y+ +I+AC L  D EIL   D TEIGEKG+NLSGGQKQRVSLARA YS++++YL DDPLSAVD+HVGK + +NVI   G+L   TRILVTH+++ L + D IIVM+ G +SE G+Y +L+   GAFA F+ T+ + E +    +N S                T  +  ++    +S   K  +++   M   ++    L++ +++ +    D  R      +  K  A+K    KL+E + ++ G VK++VY  Y+++IG +++   I LF+     +L SN WL  W+D   +              N +Q           +   + L +YG  G  Q +     S+  +   I ++  LH  LL+ +LR PMS FE  P G ++NRFS +L+ V +M+P  I    G L   + A +V ++ T     II PL L+   Y  +QR YV++SRQLKRLESV +SP+YSHF ETL GVS IRA+   ++FI  +D KVD+N  +YY + V+NRWLA+ LE VGN IV  AALFAVIS  +   ++AGLVGLSVSY+L +T  LNWLVRMSSE+E+NIV+VER++EYS+   EAPW I E  P  +WP VG ++F NY  +YRE LD VL++IN  IN  EKVGIVGRTG+GKSSL L LFRI E ++GEI+IDG+ I ++GLHD+R ++TIIPQDPVLFSG+LR NLDPF+++ DEE+W  LE+++LK F V++  ++L+   +EGGENLSVGQRQLVCLARALLR+T ILVLDEATAAVDL+TD LIQ TIR +F++CT+LTIAHRLNT++DY +++VL+ GEI E  AP++LL+     FYSMAK + L+
Sbjct:    5 FLVSPTLLGITMLLATFLIQLERRKGVQSSGIMLTFWLVALV-CALAILRSKIMTALKEDAQVDLFRDITFYVYFSLLLIQLVLSCFS-----------DRSPLFSETIH--------------DPNP------------------------CPESSASFLSRITFWWITGLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRKQPVK---VVYSSKDPA----------------QPKESSKVDANEEVEALIVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPQILKLLIKFVNDTKAPD-WQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWLNLGPSVLAGVAVMVLMVPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLKKSAYLSAVGTFTWVCTPFLVALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRPVKDGGGTNSITVRNATFTWARSDP-PTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGS----------------TVMDEEEAGVTGVSGPGKEAKQMENGMLVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKLSVYWDYMKAIGLFISFLSIFLFMCNHVSALASNYWLSLWTDDPIV--------------NGTQ-----------EHTKVRLSVYGALGISQGIAVFGYSMAVSIGGILASRCLHVDLLHSILRSPMSFFERTPSGNLVNRFSKELDTVDSMIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIPPLGLI---YFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHS---LSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVAVERLKEYSETEKEAPWQIQETAPPSSWPQVGRVEFRNYCLRYREDLDFVLRHINVTINGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGINIAKIGLHDLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWTSLELAHLKDF-VSALPDKLDHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVLDKGEIQEYGAPSDLLQQ-RGLFYSMAKDAGLV 1440          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Human
Match: ABCC1 (ATP binding cassette subfamily C member 1 [Source:HGNC Symbol;Acc:HGNC:51])

HSP 1 Score: 1254.2 bits (3244), Expect = 0.000e+0
Identity = 708/1556 (45.50%), Postives = 993/1556 (63.82%), Query Frame = 2
Query:  416 FLVCMSILAI-------MVGLERRCNAVNSGFYFNYWLLHFILCAVRARASGLSLKLKITNR-DYSRECFIFINLTFVTLSLVLSCFSEKVSQSEIERLNKKRKFQNVLHVNADDNHVSDRMEMSPNAVDSYKTTEKDILINKTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXX-XXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSH---DDTPGI-AATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSM---ENLKMDLEKDVANITKLE-DNKRCQEELDKFLKPGAQKNGN-KLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFIN---GFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWP-VGCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNLI 5017
            FLV  ++L I       ++ LERR    +SG    +WL+  + CA+    S +   LK   + D  R+   ++  + + + LVLSCFS           ++   F   +H               PN                         CPE  +SFLSRI F+W T LIV+GY+ PL+  DLW LN E+    +VP+L++N+ K  A  +++  K   ++ + K+ +                 P +++K    +  E    K  +++++P L   L K+  PY L+S  +K IHD++ F GP +LKLL++FV+D++    W+GYF   L+ ++A ++T +LHQYFHI F  GMR+++++I AVYRK+L ++ ++RK STVGEIVNLMS+DAQ+F++L +YI+MIWS P Q+I AL LLW  LGPSVLAG+ +M+LM+PVNAV+   T+  Q   +K  D+RIK+MNEILNGIKVLKLYAWE +F + V  IR +ELK +K++AY +A  +FT+ C PFLV+L TF ++V I  +N+LDA+ AFVS+ LFNILRFPL +LPMVIS+++QASVSLKRL  FL  EE+  D++      D  G  + T++N  F W  + P P L  I  + PE  LVA+VG VGCGKSS+LSALL E+DK+EG+V +KGS+AYVPQQAWI N ++R+NI+FG   +   Y+ +I+AC L  D EIL   D TEIGEKG+NLSGGQKQRVSLARA YS++++YL DDPLSAVD+HVGK + +NVI   G+L   TRILVTH+++ L + D IIVM+ G +SE G+Y +L+   GAFA F+ T+ + E +    +N S                T  +  ++    +S   K  +++   M   ++    L++ +++ +    D  R      +  K  A+K    KL+E + ++ G VK++VY  Y+++IG +++   I LF+     +L SN WL  W+D   +              N +Q           +   + L +YG  G  Q +     S+  +   I ++  LH  LL+ +LR PMS FE  P G ++NRFS +L+ V +M+P  I    G L   + A +V ++ T     II PL L+   Y  +QR YV++SRQLKRLESV +SP+YSHF ETL GVS IRA+   ++FI  +D KVD+N  +YY + V+NRWLA+ LE VGN IV  AALFAVIS  +   ++AGLVGLSVSY+L +T  LNWLVRMSSE+E+NIV+VER++EYS+   EAPW I E  P  +WP VG ++F NY  +YRE LD VL++IN  IN  EKVGIVGRTG+GKSSL L LFRI E ++GEI+IDG+ I ++GLHD+R ++TIIPQDPVLFSG+LR NLDPF+++ DEE+W  LE+++LK F V++  ++L+   +EGGENLSVGQRQLVCLARALLR+T ILVLDEATAAVDL+TD LIQ TIR +F++CT+LTIAHRLNT++DY +++VL+ GEI E  AP++LL+     FYSMAK + L+
Sbjct:    5 FLVSPTLLGITMLLATFLIQLERRKGVQSSGIMLTFWLVALV-CALAILRSKIMTALKEDAQVDLFRDITFYVYFSLLLIQLVLSCFS-----------DRSPLFSETIH--------------DPNP------------------------CPESSASFLSRITFWWITGLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRKQPVK---VVYSSKDPA----------------QPKESSKVDANEEVEALIVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPQILKLLIKFVNDTKAPD-WQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWLNLGPSVLAGVAVMVLMVPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLKKSAYLSAVGTFTWVCTPFLVALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRPVKDGGGTNSITVRNATFTWARSDP-PTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGS----------------TVMDEEEAGVTGVSGPGKEAKQMENGMLVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKLSVYWDYMKAIGLFISFLSIFLFMCNHVSALASNYWLSLWTDDPIV--------------NGTQ-----------EHTKVRLSVYGALGISQGIAVFGYSMAVSIGGILASRCLHVDLLHSILRSPMSFFERTPSGNLVNRFSKELDTVDSMIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIPPLGLI---YFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHS---LSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVAVERLKEYSETEKEAPWQIQETAPPSSWPQVGRVEFRNYCLRYREDLDFVLRHINVTINGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGINIAKIGLHDLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWTSLELAHLKDF-VSALPDKLDHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVLDKGEIQEYGAPSDLLQQ-RGLFYSMAKDAGLV 1440          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Human
Match: ABCC1 (ATP binding cassette subfamily C member 1 [Source:HGNC Symbol;Acc:HGNC:51])

HSP 1 Score: 1171.38 bits (3029), Expect = 0.000e+0
Identity = 633/1266 (50.00%), Postives = 869/1266 (68.64%), Query Frame = 2
Query: 1259 LSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSH---DDTPGI-AATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSM---ENLKMDLEKDVANITKLE-DNKRCQEELDKFLKPGAQKNGN-KLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFIN---GFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWP-VGCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNLI 5017
            +S  +K IHD++ F GP +LKLL++FV+D++    W+GYF   L+ ++A ++T +LHQYFHI F  GMR+++++I AVYRK+L ++ ++RK STVGEIVNLMS+DAQ+F++L +YI+MIWS P Q+I AL LLW  LGPSVLAG+ +M+LM+PVNAV+   T+  Q   +K  D+RIK+MNEILNGIKVLKLYAWE +F + V  IR +ELK +K++AY +A  +FT+ C PFLV+L TF ++V I  +N+LDA+ AFVS+ LFNILRFPL +LPMVIS+++QASVSLKRL  FL  EE+  D++      D  G  + T++N  F W  + P P L  I  + PE  LVA+VG VGCGKSS+LSALL E+DK+EG+V +KGS+AYVPQQAWI N ++R+NI+FG   +   Y+ +I+AC L  D EIL   D TEIGEKG+NLSGGQKQRVSLARA YS++++YL DDPLSAVD+HVGK + +NVI   G+L   TRILVTH+++ L + D IIVM+ G +SE G+Y +L+   GAFA F+ T+ + E +    +N S                T  +  ++    +S   K  +++   M   ++    L++ +++ +    D  R      +  K  A+K    KL+E + ++ G VK++VY  Y+++IG +++   I LF+     +L SN WL  W+D   +              N +Q           +   + L +YG  G  Q +     S+  +   I ++  LH  LL+ +LR PMS FE  P G ++NRFS +L+ V +M+P  I    G L   + A +V ++ T     II PL L+   Y  +QR YV++SRQLKRLESV +SP+YSHF ETL GVS IRA+   ++FI  +D KVD+N  +YY + V+NRWLA+ LE VGN IV  AALFAVIS  +   ++AGLVGLSVSY+L +T  LNWLVRMSSE+E+NIV+VER++EYS+   EAPW I E  P  +WP VG ++F NY  +YRE LD VL++IN  IN  EKVGIVGRTG+GKSSL L LFRI E ++GEI+IDG+ I ++GLHD+R ++TIIPQDPVLFSG+LR NLDPF+++ DEE+W  LE+++LK F V++  ++L+   +EGGENLSVGQRQLVCLARALLR+T ILVLDEATAAVDL+TD LIQ TIR +F++CT+LTIAHRLNT++DY +++VL+ GEI E  AP++LL+     FYSMAK + L+
Sbjct:    1 MSFFFKAIHDLMMFSGPQILKLLIKFVNDTKAPD-WQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWLNLGPSVLAGVAVMVLMVPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLKKSAYLSAVGTFTWVCTPFLVALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRPVKDGGGTNSITVRNATFTWARSDP-PTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGS----------------TVMDEEEAGVTGVSGPGKEAKQMENGMLVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKLSVYWDYMKAIGLFISFLSIFLFMCNHVSALASNYWLSLWTDDPIV--------------NGTQ-----------EHTKVRLSVYGALGISQGIAVFGYSMAVSIGGILASRCLHVDLLHSILRSPMSFFERTPSGNLVNRFSKELDTVDSMIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIPPLGLI---YFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHS---LSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVAVERLKEYSETEKEAPWQIQETAPPSSWPQVGRVEFRNYCLRYREDLDFVLRHINVTINGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGINIAKIGLHDLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWTSLELAHLKDF-VSALPDKLDHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVLDKGEIQEYGAPSDLLQQ-RGLFYSMAKDAGLV 1215          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Celegans
Match: mrp-1 (pep chromosome:WBcel235:X:576318:587483:-1 gene:WBGene00003407.1 transcript:F57C12.5c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mrp-1)

HSP 1 Score: 1098.19 bits (2839), Expect = 0.000e+0
Identity = 638/1409 (45.28%), Postives = 880/1409 (62.46%), Query Frame = 2
Query:  821 TDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXXXXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLIS-RDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEIN-KDAVSHDDTPGIAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISS-TGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYS-EINQS-NANMISSLSKSREKIYKSMEN-LKMDLEKDVANITKLEDNKRCQEEL---DKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWPV-GCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNLI 5017
            ++G +    CPEY +SFL+++ F WF+ L   G K  L+ EDLW LN  ++  +I+P  + N    +   +R+  K                                N + +IP+N             P ++  + K++   LL  G YK++ D+L F+ P LL+ L+ F+ D + +  W G  IA LM +S+++++ ILHQYFH +F++GM +RS L SAVY K+L LS  +RK  T G IVNLMS+D Q+  ++ ++I + WS P QI+ +L  LW  LG SVLAG VI++L+IP N+ I    R  Q +Q+K  D RIKMM+EILNG+KVLKLY+WE S    V E+R KE++ +K+ +Y NAA + ++ CAPFLV++ TFG++VL    +NVL  +  FV++ LFNILRFPL +  MV S  +Q S S  RL  F   EE++ + ++++  T   A  +  G F W S   +  L +I        LVAIVG VG GKSS+L ALLGE++KL G V + GS+AYVPQ AWI N ++R+NI+F  PYDA  YQ +I+ C L +D E L   D TEIGEKGINLSGGQKQRVSLARA Y ++ + LLDDPLSAVDSHVGK + +NVIS+ TG L   TR+L+TH L  L  CD++IV+ +  +SE GTY +L+   GAF+ F+   L +E +    ++ SF E  ++   L       S  I Q   + M   + K+ +K  + + N L  D +   ++I K E+ +     +   +K  +P  Q    +LIE+E  + G VK  VYM+Y R+IG  +A    L++V +    + SNL+L RWSD +K  A LS         +SS+ QI              LGIY V G  QA     +S+  A  ++ ++  LH  LL  ++R PM+ F+  P+GRI+NRF  D+ A+   LPH I   ++T    I    ++    PW  I   ++   Y ++ R YVSTSRQLKRLES  +SPIYSHF E++QG SSIRAY + DKFI  + ++VD+NL +YY + V+NRWLA+ LE VGN IV  +A  A +  ++  G++AGLVGLSVSYAL+ITQTLNW VRM+SE+E+NIV+VERI EY+  P E   + S+    ++WP  G I   N+S +YR GLD VL  +   I+P EK+GIVGRTG+GKSSL LALFRI+E   G I IDG  I +L L  +R RLTI+PQDPVLFSGT+R NLDPF    D++IW+ L  ++L +F V S  E L   ISEGGENLSVGQRQL+CLARALLR+T +LVLDEA AAVD++TD L+Q+TIR +FK+CT+LTIAHRLNTV+D D++LVL+ G + E D P  LL NP+  FYSMAK +N++
Sbjct:  198 SNGYIGKNSCPEYTASFLNQLTFQWFSGLAYLGNKKSLEKEDLWDLNERDKAENIIPSFIENLIPEVEGYRRKIKK--------------------------------NPEAAIPKN------------HPSILIPIFKTYKFTLLAGGCYKLMFDLLQFVAPELLRQLISFIED-KNQPMWIGVSIALLMFLSSLLQSMILHQYFHEMFRLGMNIRSVLTSAVYTKTLNLSNEARKGKTTGAIVNLMSVDIQRIQDMTTFIMLFWSAPLQILLSLYFLWKLLGVSVLAGFVILILLIPFNSFISVKMRNCQMEQMKFKDERIKMMSEILNGMKVLKLYSWEKSMEKMVLEVREKEIRVLKKLSYLNAATTLSWACAPFLVAVLTFGLYVLWDPENNVLTPQITFVALALFNILRFPLAVFAMVFSQAVQCSASNTRLKEFFAAEEMSPQTSIAYGGTDS-AIKMDGGSFAWGSKEEDRKLHDITFNIKRGQLVAIVGRVGSGKSSLLHALLGEMNKLSGSVQVNGSVAYVPQLAWIQNLSLRNNILFNRPYDAKLYQNVIENCALVQDLESLPAEDRTEIGEKGINLSGGQKQRVSLARAVYQNAEIVLLDDPLSAVDSHVGKHIFENVISTATGCLGTKTRVLLTHGLTYLKHCDQVIVLKDETISEMGTYQELMNSNGAFSEFLEEFLLEESKH-KGRSVSFGEDSKEVNELLRDLDQVSPAIRQRIQSQMSQEIEKTDDKNAEIIRNGLHKDEQTAHSSIGKSEEKESLLGAISPKEKTPEPPKQTK-TQLIEKEAVETGKVKFEVYMSYFRAIGIKIALVFFLVYVASSMLGVFSNLYLARWSDDAKEIA-LSGN------GSSSETQI-------------RLGIYAVLGMGQATSVCAASIIMALGMVCASRLLHATLLENIMRSPMAFFDVTPLGRILNRFGKDIEAIDQTLPHSIRAMVMTIFNVISTVFVIIWATPWAGIGFLVLGFVYFVVLRFYVSTSRQLKRLESASRSPIYSHFQESIQGASSIRAYGVVDKFIRESQHRVDENLATYYPSIVANRWLAVRLEMVGNLIVLSSA-GAAVYFRDSPGLSAGLVGLSVSYALNITQTLNWAVRMTSELETNIVAVERINEYTITPTEG--NNSQSLAPKSWPENGEISIKNFSVRYRPGLDLVLHGVTAHISPCEKIGIVGRTGAGKSSLTLALFRIIEADGGCIEIDGTNIADLLLEQLRSRLTIVPQDPVLFSGTMRMNLDPFFAFSDDQIWEALRNAHLDSF-VKSLQEGLHHHISEGGENLSVGQRQLICLARALLRKTKVLVLDEAAAAVDVETDSLLQKTIREQFKDCTVLTIAHRLNTVMDSDRLLVLDKGCVAEFDTPKKLLSNPDGIFYSMAKDANVV 1534          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Celegans
Match: mrp-1 (pep chromosome:WBcel235:X:576318:587483:-1 gene:WBGene00003407.1 transcript:F57C12.5b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mrp-1)

HSP 1 Score: 1095.88 bits (2833), Expect = 0.000e+0
Identity = 635/1409 (45.07%), Postives = 882/1409 (62.60%), Query Frame = 2
Query:  821 TDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXXXXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLIS-RDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEIN-KDAVSHDDTPGIAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISS-TGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYS-EINQS-NANMISSLSKSREKIYKSMEN-LKMDLEKDVANITKLEDNKRCQEEL---DKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWPV-GCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNLI 5017
            ++G +    CPEY +SFL+++ F WF+ L   G K  L+ EDLW LN  ++  +I+P  + N    +   +R+  K                                N + +IP+N             P ++  + K++   LL  G YK++ D+L F+ P LL+ L+ F+ D + +  W G  IA LM +S+++++ ILHQYFH +F++GM +RS L SAVY K+L LS  +RK  T G IVNLMS+D Q+  ++ ++I + WS P QI+ +L  LW  LG SVLAG VI++L+IP N+ I    R  Q +Q+K  D RIKMM+EILNG+KVLKLY+WE S    V E+R KE++ +K+ +Y NAA + ++ CAPFLV++ TFG++VL    +NVL  +  FV++ LFNILRFPL +  MV S  +Q S S  RL  F   EE++ + ++++  T   A  +  G F W S   +  L +I        LVAIVG VG GKSS+L ALLGE++KL G V + GS+AYVPQ AWI N ++R+NI+F  PYDA  YQ +I+ C L +D E L   D TEIGEKGINLSGGQKQRVSLARA Y ++ + LLDDPLSAVDSHVGK + +NVIS+ TG L   TR+L+TH L  L  CD++IV+ +  +SE GTY +L+   GAF+ F+   L +E +    ++ SF E  ++   L       S  I Q   + M   + K+ +K  + + N L  D +   ++I K E+ +     +   +K  +P  Q    +LIE+E  + G VK  VYM+Y R+IG  +A    L++V +    + SNL+L RWSD        +KE+      +SS+ QI              LGIY V G  QA     +S+  A  ++ ++  LH  LL  ++R PM+ F+  P+GRI+NRF  D++ +   LP  I  F+   +QA+ +F +     P    P+++++  Y  + R YVSTSRQLKRLES  +SPIYSHF E++QG SSIRAY + DKFI  + ++VD+NL +YY + V+NRWLA+ LE VGN IV  +A  A +  ++  G++AGLVGLSVSYAL+ITQTLNW VRM+SE+E+NIV+VERI EY+  P E   + S+    ++WP  G I   N+S +YR GLD VL  +   I+P EK+GIVGRTG+GKSSL LALFRI+E   G I IDG  I +L L  +R RLTI+PQDPVLFSGT+R NLDPF    D++IW+ L  ++L +F V S  E L   ISEGGENLSVGQRQL+CLARALLR+T +LVLDEA AAVD++TD L+Q+TIR +FK+CT+LTIAHRLNTV+D D++LVL+ G + E D P  LL NP+  FYSMAK +N++
Sbjct:  198 SNGYIGKNSCPEYTASFLNQLTFQWFSGLAYLGNKKSLEKEDLWDLNERDKAENIIPSFIENLIPEVEGYRRKIKK--------------------------------NPEAAIPKN------------HPSILIPIFKTYKFTLLAGGCYKLMFDLLQFVAPELLRQLISFIED-KNQPMWIGVSIALLMFLSSLLQSMILHQYFHEMFRLGMNIRSVLTSAVYTKTLNLSNEARKGKTTGAIVNLMSVDIQRIQDMTTFIMLFWSAPLQILLSLYFLWKLLGVSVLAGFVILILLIPFNSFISVKMRNCQMEQMKFKDERIKMMSEILNGMKVLKLYSWEKSMEKMVLEVREKEIRVLKKLSYLNAATTLSWACAPFLVAVLTFGLYVLWDPENNVLTPQITFVALALFNILRFPLAVFAMVFSQAVQCSASNTRLKEFFAAEEMSPQTSIAYGGTDS-AIKMDGGSFAWGSKEEDRKLHDITFNIKRGQLVAIVGRVGSGKSSLLHALLGEMNKLSGSVQVNGSVAYVPQLAWIQNLSLRNNILFNRPYDAKLYQNVIENCALVQDLESLPAEDRTEIGEKGINLSGGQKQRVSLARAVYQNAEIVLLDDPLSAVDSHVGKHIFENVISTATGCLGTKTRVLLTHGLTYLKHCDQVIVLKDETISEMGTYQELMNSNGAFSEFLEEFLLEESKH-KGRSVSFGEDSKEVNELLRDLDQVSPAIRQRIQSQMSQEIEKTDDKNAEIIRNGLHKDEQTAHSSIGKSEEKESLLGAISPKEKTPEPPKQTK-TQLIEKEAVETGKVKFEVYMSYFRAIGIKIALVFFLVYVASSMLGVFSNLYLARWSDD-------AKEIALSGNGSSSETQI-------------RLGIYAVLGMGQATSVCAASIIMALGMVCASRLLHATLLENIMRSPMAFFDVTPLGRILNRFGKDIDVIDYRLPSCIMTFVGAIVQAVTIFAVPIYATPLSSFPITIVLIGYYFLLRFYVSTSRQLKRLESASRSPIYSHFQESIQGASSIRAYGVVDKFIRESQHRVDENLATYYPSIVANRWLAVRLEMVGNLIVLSSA-GAAVYFRDSPGLSAGLVGLSVSYALNITQTLNWAVRMTSELETNIVAVERINEYTITPTEG--NNSQSLAPKSWPENGEISIKNFSVRYRPGLDLVLHGVTAHISPCEKIGIVGRTGAGKSSLTLALFRIIEADGGCIEIDGTNIADLLLEQLRSRLTIVPQDPVLFSGTMRMNLDPFFAFSDDQIWEALRNAHLDSF-VKSLQEGLHHHISEGGENLSVGQRQLICLARALLRKTKVLVLDEAAAAVDVETDSLLQKTIREQFKDCTVLTIAHRLNTVMDSDRLLVLDKGCVAEFDTPKKLLSNPDGIFYSMAKDANVV 1534          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Celegans
Match: mrp-1 (pep chromosome:WBcel235:X:576318:587483:-1 gene:WBGene00003407.1 transcript:F57C12.5e.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mrp-1)

HSP 1 Score: 1095.11 bits (2831), Expect = 0.000e+0
Identity = 637/1409 (45.21%), Postives = 880/1409 (62.46%), Query Frame = 2
Query:  821 TDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXXXXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLIS-RDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEIN-KDAVSHDDTPGIAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISS-TGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYS-EINQS-NANMISSLSKSREKIYKSMEN-LKMDLEKDVANITKLEDNKRCQEEL---DKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWPV-GCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNLI 5017
            ++G +    CPEY +SFL+++ F WF+ L   G K  L+ EDLW LN  ++  +I+P  + N    +   +R+  K                                N + +IP+N             P ++  + K++   LL  G YK++ D+L F+ P LL+ L+ F+ D + +  W G  IA LM +S+++++ ILHQYFH +F++GM +RS L SAVY K+L LS  +RK  T G IVNLMS+D Q+  ++ ++I + WS P QI+ +L  LW  LG SVLAG VI++L+IP N+ I    R  Q +Q+K  D RIKMM+EILNG+KVLKLY+WE S    V E+R KE++ +K+ +Y NAA + ++ CAPFLV++ TFG++VL    +NVL  +  FV++ LFNILRFPL +  MV S  +Q S S  RL  F   EE++ + ++++  T   A  +  G F W S   +  L +I        LVAIVG VG GKSS+L ALLGE++KL G V + GS+AYVPQ AWI N ++R+NI+F  PYDA  YQ +I+ C L +D E L   D TEIGEKGINLSGGQKQRVSLARA Y ++ + LLDDPLSAVDSHVGK + +NVIS+ TG L   TR+L+TH L  L  CD++IV+ +  +SE GTY +L+   GAF+ F+   L +E +    ++ SF E  ++   L       S  I Q   + M   + K+ +K  + + N L  D +   ++I K E+ +     +   +K  +P  Q    +LIE+E  + G VK  VYM+Y R+IG  +A    L++V +    + SNL+L RWSD        +KE+      +SS+ QI              LGIY V G  QA     +S+  A  ++ ++  LH  LL  ++R PM+ F+  P+GRI+NRF  D++ V   LP  I  FL+T  + +   +  +   P+ I P+ L+      I R YVSTSRQLKRLES  +SPIYSHF E++QG SSIRAY + DKFI  + ++VD+NL +YY + V+NRWLA+ LE VGN IV  +A  A +  ++  G++AGLVGLSVSYAL+ITQTLNW VRM+SE+E+NIV+VERI EY+  P E   + S+    ++WP  G I   N+S +YR GLD VL  +   I+P EK+GIVGRTG+GKSSL LALFRI+E   G I IDG  I +L L  +R RLTI+PQDPVLFSGT+R NLDPF    D++IW+ L  ++L +F V S  E L   ISEGGENLSVGQRQL+CLARALLR+T +LVLDEA AAVD++TD L+Q+TIR +FK+CT+LTIAHRLNTV+D D++LVL+ G + E D P  LL NP+  FYSMAK +N++
Sbjct:  198 SNGYIGKNSCPEYTASFLNQLTFQWFSGLAYLGNKKSLEKEDLWDLNERDKAENIIPSFIENLIPEVEGYRRKIKK--------------------------------NPEAAIPKN------------HPSILIPIFKTYKFTLLAGGCYKLMFDLLQFVAPELLRQLISFIED-KNQPMWIGVSIALLMFLSSLLQSMILHQYFHEMFRLGMNIRSVLTSAVYTKTLNLSNEARKGKTTGAIVNLMSVDIQRIQDMTTFIMLFWSAPLQILLSLYFLWKLLGVSVLAGFVILILLIPFNSFISVKMRNCQMEQMKFKDERIKMMSEILNGMKVLKLYSWEKSMEKMVLEVREKEIRVLKKLSYLNAATTLSWACAPFLVAVLTFGLYVLWDPENNVLTPQITFVALALFNILRFPLAVFAMVFSQAVQCSASNTRLKEFFAAEEMSPQTSIAYGGTDS-AIKMDGGSFAWGSKEEDRKLHDITFNIKRGQLVAIVGRVGSGKSSLLHALLGEMNKLSGSVQVNGSVAYVPQLAWIQNLSLRNNILFNRPYDAKLYQNVIENCALVQDLESLPAEDRTEIGEKGINLSGGQKQRVSLARAVYQNAEIVLLDDPLSAVDSHVGKHIFENVISTATGCLGTKTRVLLTHGLTYLKHCDQVIVLKDETISEMGTYQELMNSNGAFSEFLEEFLLEESKH-KGRSVSFGEDSKEVNELLRDLDQVSPAIRQRIQSQMSQEIEKTDDKNAEIIRNGLHKDEQTAHSSIGKSEEKESLLGAISPKEKTPEPPKQTK-TQLIEKEAVETGKVKFEVYMSYFRAIGIKIALVFFLVYVASSMLGVFSNLYLARWSDD-------AKEIALSGNGSSSETQI-------------RLGIYAVLGMGQATSVCAASIIMALGMVCASRLLHATLLENIMRSPMAFFDVTPLGRILNRFGKDMDVVDERLPDNIGDFLLTFSELVACVVFTSYATPFAIFPIVLIAIGCFAILRFYVSTSRQLKRLESASRSPIYSHFQESIQGASSIRAYGVVDKFIRESQHRVDENLATYYPSIVANRWLAVRLEMVGNLIVLSSA-GAAVYFRDSPGLSAGLVGLSVSYALNITQTLNWAVRMTSELETNIVAVERINEYTITPTEG--NNSQSLAPKSWPENGEISIKNFSVRYRPGLDLVLHGVTAHISPCEKIGIVGRTGAGKSSLTLALFRIIEADGGCIEIDGTNIADLLLEQLRSRLTIVPQDPVLFSGTMRMNLDPFFAFSDDQIWEALRNAHLDSF-VKSLQEGLHHHISEGGENLSVGQRQLICLARALLRKTKVLVLDEAAAAVDVETDSLLQKTIREQFKDCTVLTIAHRLNTVMDSDRLLVLDKGCVAEFDTPKKLLSNPDGIFYSMAKDANVV 1534          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Celegans
Match: mrp-2 (pep chromosome:WBcel235:X:563719:572701:-1 gene:WBGene00003408.1 transcript:F57C12.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mrp-2)

HSP 1 Score: 1093.95 bits (2828), Expect = 0.000e+0
Identity = 626/1403 (44.62%), Postives = 874/1403 (62.30%), Query Frame = 2
Query:  848 CPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXXXXXFDPCLMNALIKSHFPYLLLSGL-YKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLIS-RDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEIN-KDAVSHDDTPGIAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVI-SSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSK--SREKIYKSMENLKMDLEKDVANITKLEDNKRCQEELDKFLKPG------AQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWP-VGCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNLI 5017
            CPEY +SF++R+ F WFT L   G K  L+NEDLW LN  ++  +++P  ++N    L P      + D+   N K +                         ++P+N             P  +  + K+ + Y LL+G  YK+  D+L FL P LLK L+ F+ D + +  W G  I  +M  S+ +++  LHQY+H +F++GM VRS L SAVY K+L LS  +RK  T+G IVNLMS+D QK  ++   I + WS P QI  ++  LW  LG + LAGLV+++L +PVN +I    RK Q +Q+K+ D RIKMM+EILNG+KVLKLY+WE S  N V +IR +EL  +K+ +Y+ AAI F++ CAPFL S+ +F ++V +   +NVL  E  FV+++LF+ILR PL M+ MV    +Q SVS  RL  F   EE++ + ++SH +T   A  ++NG+F W S+  +P L+ I+    +  LVAIVG VG GKSS+L ALLGE++KL G V + G+IAYVPQQAWI N ++R+NI+F  PYD   Y+ ++K C L+ D   L   D TEIGEKGINLSGGQKQRVSLARA Y + ++ LLDDPLSAVDSHVGK + +NVI SSTG L   TR+LVTH L  L  CD++IV+  G +SE GTY +L+ ++GAFA F+   L +E +           +        ++     ++ Q    ++  L    S+E   +      ++  +D +  + L  + R Q E ++ L         AQ+N  +LIE+ET + G VK  VY+AY ++I   +      L+V + G  + SN +L + SD +K     S + K                        + LGIY V G  Q+ + L +S+     +++++  LH  LL  ++R PM+ F+  P+GRI+NR   D+ A+   LP  I    +T    +   +++    PW  I  +++   Y ++ R Y+STSRQLKRLES  +SPIYSHF E++QG SSIRA+ + D FI+ +  +VD +L +YY + V+NRWLA+ LE VGN IV  AA  A +  ++  G++AGLVGLSVSYAL+ITQTLNW VRM+SE+E+NIVSVERI+EY+  P E   + S +   ++WP  G I   N+S +YR GLD VL  I+  I P EKVGIVGRTG+GKSSL LALFRI+E   G I IDG+ I  L L  +R  LTI+PQDPVLFSGT++ NLDPF+ + D ++W+ LE ++LK F V S  + LE  ISEGGENLSVGQRQL+CLARALLR+T +LVLDEA AAVD++TD LIQ+TIR +FKECT+LTIAHRLNTV+D D++LVL+ G + E D+P NLL NP+  FYSMAK +N++
Sbjct:  207 CPEYTASFINRLTFQWFTGLAYLGNKKSLENEDLWDLNEIDKAENLIPSFMQN----LKP------RIDEYHQNIKKDPSA----------------------ALPKN------------HPSFVIPIFKT-YKYTLLAGFFYKLCFDMLQFLAPQLLKQLIGFIED-KNQPVWIGCSIVGIMFFSSFLQSMFLHQYYHSMFRLGMHVRSVLTSAVYSKALNLSNEARKGKTIGAIVNLMSVDIQKIQDMAPTIMLFWSAPLQIFLSIYFLWKFLGVAALAGLVVLILALPVNGLIAIQMRKCQTEQMKLKDERIKMMSEILNGMKVLKLYSWERSMENMVLKIRERELHILKKLSYFMAAIVFSWICAPFLASVISFVVYVYLDPENNVLTPEITFVALSLFDILRMPLAMVAMVYGEAVQCSVSNTRLKEFFAAEEMSPQTSISHGETDS-AIEVENGLFSW-SSDEDPTLREISFKIQKGQLVAIVGKVGSGKSSLLHALLGEMNKLSGSVQINGNIAYVPQQAWIQNMSLRNNILFNKPYDLENYEDVVKNCALKEDLANLPAGDRTEIGEKGINLSGGQKQRVSLARAVYQNPDIILLDDPLSAVDSHVGKHIFENVISSSTGCLASKTRVLVTHGLTYLKHCDQLIVLKEGTISELGTYQELLNNSGAFAEFLEEFLIEESKTRGR-------VASIGDGSGEVDEILRDLGQVKPGILKRLESHLSQESDKEDTSARAIEYSRDSSRRSVLLHSPRSQHEENEALLGAISEDVPAQEN-TQLIEKETVETGKVKFEVYIAYFQAISIPITLLFFFLYVGSSGLGILSNFYLAKLSDHAKSGNRTSSDAK------------------------MELGIYAVLGMGQSFVVLIASIILTIGVLRASRILHAGLLGNIMRSPMAFFDVTPIGRILNRIGKDIEAIDRTLPDVIRHMSMTIFNVVATLVVIMWATPWAGIAFAILSVIYFIVLRFYISTSRQLKRLESASRSPIYSHFQESIQGASSIRAFGVVDNFIKQSQQRVDDHLIAYYPSIVANRWLAVRLEMVGNLIVLSAA-GAAVYFRDSPGLSAGLVGLSVSYALNITQTLNWAVRMTSELETNIVSVERIKEYTVTPTEG--NNSRRLAAKSWPEKGEISIKNFSVRYRPGLDLVLHGISAHIAPSEKVGIVGRTGAGKSSLTLALFRIIEADGGSIEIDGINIANLQLEQLRSCLTIVPQDPVLFSGTMKMNLDPFSAYSDSQVWEALENAHLKPF-VKSLQDGLEHKISEGGENLSVGQRQLICLARALLRKTKVLVLDEAAAAVDVETDSLIQKTIREQFKECTVLTIAHRLNTVMDSDRLLVLDKGRVAEFDSPKNLLANPDGIFYSMAKDANVV 1525          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Celegans
Match: mrp-1 (pep chromosome:WBcel235:X:576318:587483:-1 gene:WBGene00003407.1 transcript:F57C12.5d.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mrp-1)

HSP 1 Score: 1092.03 bits (2823), Expect = 0.000e+0
Identity = 637/1409 (45.21%), Postives = 883/1409 (62.67%), Query Frame = 2
Query:  821 TDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXXXXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLIS-RDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEIN-KDAVSHDDTPGIAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISS-TGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYS-EINQS-NANMISSLSKSREKIYKSMEN-LKMDLEKDVANITKLEDNKRCQEEL---DKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWPV-GCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNLI 5017
            ++G +    CPEY +SFL+++ F WF+ L   G K  L+ EDLW LN  ++  +I+P  + N    +   +R+  K                                N + +IP+N             P ++  + K++   LL  G YK++ D+L F+ P LL+ L+ F+ D + +  W G  IA LM +S+++++ ILHQYFH +F++GM +RS L SAVY K+L LS  +RK  T G IVNLMS+D Q+  ++ ++I + WS P QI+ +L  LW  LG SVLAG VI++L+IP N+ I    R  Q +Q+K  D RIKMM+EILNG+KVLKLY+WE S    V E+R KE++ +K+ +Y NAA + ++ CAPFLV++ TFG++VL    +NVL  +  FV++ LFNILRFPL +  MV S  +Q S S  RL  F   EE++ + ++++  T   A  +  G F W S   +  L +I        LVAIVG VG GKSS+L ALLGE++KL G V + GS+AYVPQ AWI N ++R+NI+F  PYDA  YQ +I+ C L +D E L   D TEIGEKGINLSGGQKQRVSLARA Y ++ + LLDDPLSAVDSHVGK + +NVIS+ TG L   TR+L+TH L  L  CD++IV+ +  +SE GTY +L+   GAF+ F+   L +E +    ++ SF E  ++   L       S  I Q   + M   + K+ +K  + + N L  D +   ++I K E+ +     +   +K  +P  Q    +LIE+E  + G VK  VYM+Y R+IG  +A    L++V +    + SNL+L RWSD +K  A LS         +SS+ QI              LGIY V G  QA     +S+  A  ++ ++  LH  LL  ++R PM+ F+  P+GRI+NRF  D++ V T +P  ++ F+ T + +I +  ++    P  I  L  +   Y ++ R YVSTSRQLKRLES  +SPIYSHF E++QG SSIRAY + DKFI  + ++VD+NL +YY + V+NRWLA+ LE VGN IV  +A  A +  ++  G++AGLVGLSVSYAL+ITQTLNW VRM+SE+E+NIV+VERI EY+  P E   + S+    ++WP  G I   N+S +YR GLD VL  +   I+P EK+GIVGRTG+GKSSL LALFRI+E   G I IDG  I +L L  +R RLTI+PQDPVLFSGT+R NLDPF    D++IW+ L  ++L +F V S  E L   ISEGGENLSVGQRQL+CLARALLR+T +LVLDEA AAVD++TD L+Q+TIR +FK+CT+LTIAHRLNTV+D D++LVL+ G + E D P  LL NP+  FYSMAK +N++
Sbjct:  198 SNGYIGKNSCPEYTASFLNQLTFQWFSGLAYLGNKKSLEKEDLWDLNERDKAENIIPSFIENLIPEVEGYRRKIKK--------------------------------NPEAAIPKN------------HPSILIPIFKTYKFTLLAGGCYKLMFDLLQFVAPELLRQLISFIED-KNQPMWIGVSIALLMFLSSLLQSMILHQYFHEMFRLGMNIRSVLTSAVYTKTLNLSNEARKGKTTGAIVNLMSVDIQRIQDMTTFIMLFWSAPLQILLSLYFLWKLLGVSVLAGFVILILLIPFNSFISVKMRNCQMEQMKFKDERIKMMSEILNGMKVLKLYSWEKSMEKMVLEVREKEIRVLKKLSYLNAATTLSWACAPFLVAVLTFGLYVLWDPENNVLTPQITFVALALFNILRFPLAVFAMVFSQAVQCSASNTRLKEFFAAEEMSPQTSIAYGGTDS-AIKMDGGSFAWGSKEEDRKLHDITFNIKRGQLVAIVGRVGSGKSSLLHALLGEMNKLSGSVQVNGSVAYVPQLAWIQNLSLRNNILFNRPYDAKLYQNVIENCALVQDLESLPAEDRTEIGEKGINLSGGQKQRVSLARAVYQNAEIVLLDDPLSAVDSHVGKHIFENVISTATGCLGTKTRVLLTHGLTYLKHCDQVIVLKDETISEMGTYQELMNSNGAFSEFLEEFLLEESKH-KGRSVSFGEDSKEVNELLRDLDQVSPAIRQRIQSQMSQEIEKTDDKNAEIIRNGLHKDEQTAHSSIGKSEEKESLLGAISPKEKTPEPPKQTK-TQLIEKEAVETGKVKFEVYMSYFRAIGIKIALVFFLVYVASSMLGVFSNLYLARWSDDAKEIA-LSGN------GSSSETQI-------------RLGIYAVLGMGQATSVCAASIIMALGMVCASRLLHATLLENIMRSPMAFFDVTPLGRILNRFGKDVDGVDTDIPRTMSMFIRTAVSSIEIIAIILWATPLAISLLLPLFIVYFVVLRFYVSTSRQLKRLESASRSPIYSHFQESIQGASSIRAYGVVDKFIRESQHRVDENLATYYPSIVANRWLAVRLEMVGNLIVLSSA-GAAVYFRDSPGLSAGLVGLSVSYALNITQTLNWAVRMTSELETNIVAVERINEYTITPTEG--NNSQSLAPKSWPENGEISIKNFSVRYRPGLDLVLHGVTAHISPCEKIGIVGRTGAGKSSLTLALFRIIEADGGCIEIDGTNIADLLLEQLRSRLTIVPQDPVLFSGTMRMNLDPFFAFSDDQIWEALRNAHLDSF-VKSLQEGLHHHISEGGENLSVGQRQLICLARALLRKTKVLVLDEAAAAVDVETDSLLQKTIREQFKDCTVLTIAHRLNTVMDSDRLLVLDKGCVAEFDTPKKLLSNPDGIFYSMAKDANVV 1534          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Fly
Match: MRP (gene:FBgn0032456 transcript:FBtr0090025)

HSP 1 Score: 1249.57 bits (3232), Expect = 0.000e+0
Identity = 712/1614 (44.11%), Postives = 981/1614 (60.78%), Query Frame = 2
Query:  284 PFFKLTIIKLALIVCLMVLQILEIIYNAAKK---NNIP------YAYTISNCSFLVCMSILAIMVGLERRCNAVNSGFYFNYWLLHFILCAVRARASGL--SLKLKITN------RDYSRECFIFINLTFVTLS----LVLSCFSEKVSQSEIERLNKKRKFQNVLHVNADDNHVSDRMEMSPNAVDSYKTTEKDILINKTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXXXXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSHDDTPGIAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLAD-----------ELQATNNQNFSFXXXXXXXXXXXXXXRTYSE-INQSNANMISSLSKSREKIYKSMENLKMDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAF-YILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISE-KKPDENWPV-GCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNLI 5017
            P+ KL + K  + + L+V+  L++I    KK   + +P      +   I   +FL    +L I + L R+     +G  F +W L  +L   R R      + + KI N      +D+S E + F++           L+L+CF++      + R  K ++ +N                                            E PE  +SFLSRI + WF  + +KGY+ PL+ +DLW L  ++ CS ++PI   ++++ +  N +  ++ +        N                   P   K    +                +M  + KS     L   L K+  D L F  P +L L++ FV   +    WKG   A L+ + A  +TFIL QYFH +F +G+R+R++LI+A+YRK+LR+S +++KESTVGEIVNLM++DAQ+F+EL +Y++MIWS P QI  AL  LW +LGPSVLAGL +M+++IPVN VI +  +  Q +Q+K  D R+K+MNE+L+GIKVLKLYAWEPSF   V +IR+KE+  ++  AY NA  SF ++CAPFLVSL TF  +VLI  +NVLDA K FVS++LFNILRFPL MLPM+I+NL+Q  VS+ R+  FL  EE++ ++V HD +     +I+NG F W     E  L+NINI   +  LVA+VG VG GKSS++ A LGE++KL G VN  G +AYVPQQAWI NAT+RDNI+FG  YD  +Y ++I AC L  D +IL+  D TEIGEKGINLSGGQKQR+SLARA YSD+++YLLDDPLSAVD+HVGK + + VI   GIL   +R+LVTH +  L + D I V+  G +SE GT+  L+++ GAFA+FI  HL +           + Q ++  +        +  +      + S+ I+ ++A+ +     S  +  K     + D    VA+   L+  +  +                KLIE E S+ G V+ AVY  Y++S+G +L+   ++L    Q F +GSNLWL +W++   +A +                            RD+ LG+YG FGF Q     FS L  A   + +A  LH +LL  VLR PM+MF+T PVGRI++RFS D+ +V   +P  IN  +    + +   +++++  P I + + + IAF Y   QR YV+TSRQL RLESV +SPIYSHF ET+ G S+IRAY++ D+FIE +D KVDKN    Y + ++NRWLAI LE VGN I+  A+LFAV+    G   N GLVGLSVSYAL +TQTLNWLVRMSS++E+NIVSVERI+EY +   EAPW++ + K   +NWP  G ++F N+  +YREGLD VL+ ++F I   EKVGIVGRTG+GKSSL LALFRI+E + G I IDG+ I  +GLH +R RLTIIPQDPVLFSG+LR NLDPF    D+EIWK LE+S+LK+F V S    L   I+EGGENLSVGQRQLVCLARALLR+T +LVLDEATAAVDL+TD LIQ+TIR EFKECT+LTIAHRLNT+LD D+++VL+ G+IIE  +P  LL NP+S FYSMAK +NL+
Sbjct:   68 PWNKLNVSKALVNLGLLVITALDLIMALVKKGGDSELPLYDLDVWGPIIKFATFL----LLFIFIPLNRKYGVQTTGCQFIFWFLLTVLSIPRCRTEVRLDAERQKILNSQQPSEQDFSWEEYQFVSFFIFFTFTSIMLILNCFADG-----MPRQTKYQRGEN--------------------------------------------EIPELSASFLSRITYQWFDKMALKGYRNPLEEKDLWDLRPQDSCSEVMPIFAHHWNQNVRKNYKNKARVEPKAQFSNGN--------------VTFENPHGEKNGRKKGMA------------SIMPPIYKSFGGVFLFGALMKLFTDTLTFAQPQVLSLIISFVEAQDAEPEWKGILYAVLLFVLAAAQTFILGQYFHRMFIVGLRIRTALINAIYRKALRISNSTKKESTVGEIVNLMAVDAQRFMELTTYLNMIWSAPLQIGLALYFLWQQLGPSVLAGLAVMIILIPVNGVIASRIKTYQIRQMKYKDERVKLMNEVLSGIKVLKLYAWEPSFEKQVLDIRDKEIATLRSTAYLNAGTSFLWSCAPFLVSLVTFATYVLIDENNVLDATKTFVSLSLFNILRFPLTMLPMLITNLVQTQVSVNRINKFLNSEELDPNSVLHDSSKPHPMSIENGEFSWGD---EITLRNINIEVKKGSLVALVGTVGSGKSSVVQAFLGEMEKLAGVVNTVGKLAYVPQQAWIQNATVRDNILFGQTYDRKRYNKVIDACALRADIDILSAGDLTEIGEKGINLSGGQKQRISLARAVYSDADLYLLDDPLSAVDAHVGKHIFEEVIGPKGILARKSRVLVTHGVTFLPQVDSIYVIKMGEISESGTFDQLVKNKGAFADFIIQHLQEGNEEEEELNQIKRQISSTADVPELLGTVEKAIKLARTESLSDSISVTSADSLMGGGGSLRRRTK-----RQDSHDSVASAASLKKKQEVE---------------GKLIETEKSQTGGVEFAVYKHYIKSVGIFLSVATLVLNFVFQAFQIGSNLWLTQWANDQNVANDTG-------------------------LRDMYLGVYGAFGFGQGFTSFFSDLAPALGSLHAAKVLHSMLLENVLRAPMTMFDTTPVGRILSRFSKDVESVDQKMPQVINDCIWCAFEVLATIVVISLSTP-IFLAVIVPIAFLYYFAQRFYVATSRQLMRLESVSRSPIYSHFSETVTGASTIRAYNVGDRFIEESDAKVDKNQVCKYPSVIANRWLAIRLEMVGNLIILFASLFAVL----GGQTNPGLVGLSVSYALQVTQTLNWLVRMSSDIETNIVSVERIKEYGETKQEAPWELEQDKNKPKNWPQEGRVEFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFRIIEAAGGRISIDGVDIASMGLHMLRSRLTIIPQDPVLFSGSLRINLDPFEIKTDDEIWKALELSHLKSF-VKSLAAGLNHEIAEGGENLSVGQRQLVCLARALLRKTKVLVLDEATAAVDLETDDLIQKTIRTEFKECTVLTIAHRLNTILDSDKVIVLDKGQIIEFASPTELLDNPKSAFYSMAKDANLV 1548          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Fly
Match: MRP (gene:FBgn0032456 transcript:FBtr0090026)

HSP 1 Score: 1239.56 bits (3206), Expect = 0.000e+0
Identity = 707/1614 (43.80%), Postives = 980/1614 (60.72%), Query Frame = 2
Query:  284 PFFKLTIIKLALIVCLMVLQILEIIYNAAKK---NNIP------YAYTISNCSFLVCMSILAIMVGLERRCNAVNSGFYFNYWLLHFILCAVRARASGL--SLKLKITN------RDYSRECFIFINLTFVTLS----LVLSCFSEKVSQSEIERLNKKRKFQNVLHVNADDNHVSDRMEMSPNAVDSYKTTEKDILINKTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXXXXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSHDDTPGIAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLAD-----------ELQATNNQNFSFXXXXXXXXXXXXXXRTYSE-INQSNANMISSLSKSREKIYKSMENLKMDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAF-YILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISE-KKPDENWPV-GCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNLI 5017
            P+ KL + K  + + L+V+  L++I    KK   + +P      +   I   +FL    +L I + L R+     +G  F +W L  +L   R R      + + KI N      +D+S E + F++           L+L+CF++      + R  K ++ +N                                            E PE  +SFLSRI + WF  + +KGY+ PL+ +DLW L  ++ CS ++PI   ++++ +  N +  ++ +        N                   P   K    +                +M  + KS     L   L K+  D L F  P +L L++ FV   +    WKG   A L+ + A  +TFIL QYFH +F +G+R+R++LI+A+YRK+LR+S +++KESTVGEIVNLM++DAQ+F+EL +Y++MIWS P QI  AL  LW +LGPSVLAGL +M+++IPVN VI +  +  Q +Q+K  D R+K+MNE+L+GIKVLKLYAWEPSF   V +IR+KE+  ++  AY NA  SF ++CAPFLVSL TF  +VLI  +NVLDA K FVS++LFNILRFPL MLPM+I+NL+Q  VS+ R+  FL  EE++ ++V HD +     +I+NG F W     E  L+NINI   +  LVA+VG VG GKSS++ A LGE++KL G VN  G +AYVPQQAWI NAT+RDNI+FG  YD  +Y ++I AC L  D +IL+  D TEIGEKGINLSGGQKQR+SLARA YSD+++YLLDDPLSAVD+HVGK + + VI   GIL   +R+LVTH +  L + D I V+  G +SE GT+  L+++ GAFA+FI  HL +           + Q ++  +        +  +      + S+ I+ ++A+ +     S  +  K     + D    VA+   L+  +  +                KLIE E S+ G V+ AVY  Y++S+G +L+   ++L    Q F +GSNLWL +W++   +A +                            RD+ LG+YG FGF Q +    S+L  +   + SA  +H +LL+G LR PM MF+  P+GRI+NRFS D++ +   LP  +   ++     +   +++++  P I + + + IAF Y   QR YV+TSRQL RLESV +SPIYSHF ET+ G S+IRAY++ D+FIE +D KVDKN    Y + ++NRWLAI LE VGN I+  A+LFAV+    G   N GLVGLSVSYAL +TQTLNWLVRMSS++E+NIVSVERI+EY +   EAPW++ + K   +NWP  G ++F N+  +YREGLD VL+ ++F I   EKVGIVGRTG+GKSSL LALFRI+E + G I IDG+ I  +GLH +R RLTIIPQDPVLFSG+LR NLDPF    D+EIWK LE+S+LK+F V S    L   I+EGGENLSVGQRQLVCLARALLR+T +LVLDEATAAVDL+TD LIQ+TIR EFKECT+LTIAHRLNT+LD D+++VL+ G+IIE  +P  LL NP+S FYSMAK +NL+
Sbjct:   68 PWNKLNVSKALVNLGLLVITALDLIMALVKKGGDSELPLYDLDVWGPIIKFATFL----LLFIFIPLNRKYGVQTTGCQFIFWFLLTVLSIPRCRTEVRLDAERQKILNSQQPSEQDFSWEEYQFVSFFIFFTFTSIMLILNCFADG-----MPRQTKYQRGEN--------------------------------------------EIPELSASFLSRITYQWFDKMALKGYRNPLEEKDLWDLRPQDSCSEVMPIFAHHWNQNVRKNYKNKARVEPKAQFSNGN--------------VTFENPHGEKNGRKKGMA------------SIMPPIYKSFGGVFLFGALMKLFTDTLTFAQPQVLSLIISFVEAQDAEPEWKGILYAVLLFVLAAAQTFILGQYFHRMFIVGLRIRTALINAIYRKALRISNSTKKESTVGEIVNLMAVDAQRFMELTTYLNMIWSAPLQIGLALYFLWQQLGPSVLAGLAVMIILIPVNGVIASRIKTYQIRQMKYKDERVKLMNEVLSGIKVLKLYAWEPSFEKQVLDIRDKEIATLRSTAYLNAGTSFLWSCAPFLVSLVTFATYVLIDENNVLDATKTFVSLSLFNILRFPLTMLPMLITNLVQTQVSVNRINKFLNSEELDPNSVLHDSSKPHPMSIENGEFSWGD---EITLRNINIEVKKGSLVALVGTVGSGKSSVVQAFLGEMEKLAGVVNTVGKLAYVPQQAWIQNATVRDNILFGQTYDRKRYNKVIDACALRADIDILSAGDLTEIGEKGINLSGGQKQRISLARAVYSDADLYLLDDPLSAVDAHVGKHIFEEVIGPKGILARKSRVLVTHGVTFLPQVDSIYVIKMGEISESGTFDQLVKNKGAFADFIIQHLQEGNEEEEELNQIKRQISSTADVPELLGTVEKAIKLARTESLSDSISVTSADSLMGGGGSLRRRTK-----RQDSHDSVASAASLKKKQEVE---------------GKLIETEKSQTGGVEFAVYKHYIKSVGIFLSVATLVLNFVFQAFQIGSNLWLTQWANDQNVANDTG-------------------------LRDMYLGVYGAFGFGQVVTGYLSTLILSLGCVYSARYMHNVLLHGTLRWPMEMFDITPLGRIVNRFSKDVDTIDNTLPLNLRVVILQLFAVLATIVVISLSTP-IFLAVIVPIAFLYYFAQRFYVATSRQLMRLESVSRSPIYSHFSETVTGASTIRAYNVGDRFIEESDAKVDKNQVCKYPSVIANRWLAIRLEMVGNLIILFASLFAVL----GGQTNPGLVGLSVSYALQVTQTLNWLVRMSSDIETNIVSVERIKEYGETKQEAPWELEQDKNKPKNWPQEGRVEFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFRIIEAAGGRISIDGVDIASMGLHMLRSRLTIIPQDPVLFSGSLRINLDPFEIKTDDEIWKALELSHLKSF-VKSLAAGLNHEIAEGGENLSVGQRQLVCLARALLRKTKVLVLDEATAAVDLETDDLIQKTIRTEFKECTVLTIAHRLNTILDSDKVIVLDKGQIIEFASPTELLDNPKSAFYSMAKDANLV 1548          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Fly
Match: MRP (gene:FBgn0032456 transcript:FBtr0090022)

HSP 1 Score: 1236.09 bits (3197), Expect = 0.000e+0
Identity = 709/1614 (43.93%), Postives = 979/1614 (60.66%), Query Frame = 2
Query:  284 PFFKLTIIKLALIVCLMVLQILEIIYNAAKK---NNIP------YAYTISNCSFLVCMSILAIMVGLERRCNAVNSGFYFNYWLLHFILCAVRARASGL--SLKLKITN------RDYSRECFIFINLTFVTLS----LVLSCFSEKVSQSEIERLNKKRKFQNVLHVNADDNHVSDRMEMSPNAVDSYKTTEKDILINKTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXXXXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSHDDTPGIAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLAD-----------ELQATNNQNFSFXXXXXXXXXXXXXXRTYSE-INQSNANMISSLSKSREKIYKSMENLKMDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAF-YILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISE-KKPDENWPV-GCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNLI 5017
            P+ KL + K  + + L+V+  L++I    KK   + +P      +   I   +FL    +L I + L R+     +G  F +W L  +L   R R      + + KI N      +D+S E + F++           L+L+CF++      + R  K ++ +N                                            E PE  +SFLSRI + WF  + +KGY+ PL+ +DLW L  ++ CS ++PI   ++++ +  N +  ++ +        N                   P   K    +                +M  + KS     L   L K+  D L F  P +L L++ FV   +    WKG   A L+ + A  +TFIL QYFH +F +G+R+R++LI+A+YRK+LR+S +++KESTVGEIVNLM++DAQ+F+EL +Y++MIWS P QI  AL  LW +LGPSVLAGL +M+++IPVN VI +  +  Q +Q+K  D R+K+MNE+L+GIKVLKLYAWEPSF   V +IR+KE+  ++  AY NA  SF ++CAPFLVSL TF  +VLI  +NVLDA K FVS++LFNILRFPL MLPM+I+NL+Q  VS+ R+  FL  EE++ ++V HD +     +I+NG F W     E  L+NINI   +  LVA+VG VG GKSS++ A LGE++KL G VN  G +AYVPQQAWI NAT+RDNI+FG  YD  +Y ++I AC L  D +IL+  D TEIGEKGINLSGGQKQR+SLARA YSD+++YLLDDPLSAVD+HVGK + + VI   GIL   +R+LVTH +  L + D I V+  G +SE GT+  L+++ GAFA+FI  HL +           + Q ++  +        +  +      + S+ I+ ++A+ +     S  +  K     + D    VA+   L+  +  +                KLIE E S+ G V+ AVY  Y++S+G +L+   ++L    Q F +GSNLWL +W++   +A +                            RD+ LG+YG FGF Q     FSSL  +   +K +  LH+ LL   LR PM +F+T P+GRI+NRFS D++ +  +LP  I   +      +   +++++  P I + + + IAF Y   QR YV+TSRQL RLESV +SPIYSHF ET+ G S+IRAY++ D+FIE +D KVDKN    Y + ++NRWLAI LE VGN I+  A+LFAV+    G   N GLVGLSVSYAL +TQTLNWLVRMSS++E+NIVSVERI+EY +   EAPW++ + K   +NWP  G ++F N+  +YREGLD VL+ ++F I   EKVGIVGRTG+GKSSL LALFRI+E + G I IDG+ I  +GLH +R RLTIIPQDPVLFSG+LR NLDPF    D+EIWK LE+S+LK+F V S    L   I+EGGENLSVGQRQLVCLARALLR+T +LVLDEATAAVDL+TD LIQ+TIR EFKECT+LTIAHRLNT+LD D+++VL+ G+IIE  +P  LL NP+S FYSMAK +NL+
Sbjct:   68 PWNKLNVSKALVNLGLLVITALDLIMALVKKGGDSELPLYDLDVWGPIIKFATFL----LLFIFIPLNRKYGVQTTGCQFIFWFLLTVLSIPRCRTEVRLDAERQKILNSQQPSEQDFSWEEYQFVSFFIFFTFTSIMLILNCFADG-----MPRQTKYQRGEN--------------------------------------------EIPELSASFLSRITYQWFDKMALKGYRNPLEEKDLWDLRPQDSCSEVMPIFAHHWNQNVRKNYKNKARVEPKAQFSNGN--------------VTFENPHGEKNGRKKGMA------------SIMPPIYKSFGGVFLFGALMKLFTDTLTFAQPQVLSLIISFVEAQDAEPEWKGILYAVLLFVLAAAQTFILGQYFHRMFIVGLRIRTALINAIYRKALRISNSTKKESTVGEIVNLMAVDAQRFMELTTYLNMIWSAPLQIGLALYFLWQQLGPSVLAGLAVMIILIPVNGVIASRIKTYQIRQMKYKDERVKLMNEVLSGIKVLKLYAWEPSFEKQVLDIRDKEIATLRSTAYLNAGTSFLWSCAPFLVSLVTFATYVLIDENNVLDATKTFVSLSLFNILRFPLTMLPMLITNLVQTQVSVNRINKFLNSEELDPNSVLHDSSKPHPMSIENGEFSWGD---EITLRNINIEVKKGSLVALVGTVGSGKSSVVQAFLGEMEKLAGVVNTVGKLAYVPQQAWIQNATVRDNILFGQTYDRKRYNKVIDACALRADIDILSAGDLTEIGEKGINLSGGQKQRISLARAVYSDADLYLLDDPLSAVDAHVGKHIFEEVIGPKGILARKSRVLVTHGVTFLPQVDSIYVIKMGEISESGTFDQLVKNKGAFADFIIQHLQEGNEEEEELNQIKRQISSTADVPELLGTVEKAIKLARTESLSDSISVTSADSLMGGGGSLRRRTK-----RQDSHDSVASAASLKKKQEVE---------------GKLIETEKSQTGGVEFAVYKHYIKSVGIFLSVATLVLNFVFQAFQIGSNLWLTQWANDQNVANDTG-------------------------LRDMYLGVYGAFGFGQVATNFFSSLAISLGCLKCSQLLHQTLLYYNLRWPMELFDTTPLGRIVNRFSKDIDTIDNVLPFNIRVVIGQAYMVLATIVVISLSTP-IFLAVIVPIAFLYYFAQRFYVATSRQLMRLESVSRSPIYSHFSETVTGASTIRAYNVGDRFIEESDAKVDKNQVCKYPSVIANRWLAIRLEMVGNLIILFASLFAVL----GGQTNPGLVGLSVSYALQVTQTLNWLVRMSSDIETNIVSVERIKEYGETKQEAPWELEQDKNKPKNWPQEGRVEFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFRIIEAAGGRISIDGVDIASMGLHMLRSRLTIIPQDPVLFSGSLRINLDPFEIKTDDEIWKALELSHLKSF-VKSLAAGLNHEIAEGGENLSVGQRQLVCLARALLRKTKVLVLDEATAAVDLETDDLIQKTIRTEFKECTVLTIAHRLNTILDSDKVIVLDKGQIIEFASPTELLDNPKSAFYSMAKDANLV 1548          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Fly
Match: MRP (gene:FBgn0032456 transcript:FBtr0090023)

HSP 1 Score: 1236.09 bits (3197), Expect = 0.000e+0
Identity = 707/1614 (43.80%), Postives = 977/1614 (60.53%), Query Frame = 2
Query:  284 PFFKLTIIKLALIVCLMVLQILEIIYNAAKK---NNIP------YAYTISNCSFLVCMSILAIMVGLERRCNAVNSGFYFNYWLLHFILCAVRARASGL--SLKLKITN------RDYSRECFIFINLTFVTLS----LVLSCFSEKVSQSEIERLNKKRKFQNVLHVNADDNHVSDRMEMSPNAVDSYKTTEKDILINKTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXXXXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSHDDTPGIAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLAD-----------ELQATNNQNFSFXXXXXXXXXXXXXXRTYSE-INQSNANMISSLSKSREKIYKSMENLKMDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAF-YILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISE-KKPDENWPV-GCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNLI 5017
            P+ KL + K  + + L+V+  L++I    KK   + +P      +   I   +FL    +L I + L R+     +G  F +W L  +L   R R      + + KI N      +D+S E + F++           L+L+CF++      + R  K ++ +N                                            E PE  +SFLSRI + WF  + +KGY+ PL+ +DLW L  ++ CS ++PI   ++++ +  N +  ++ +        N                   P   K    +                +M  + KS     L   L K+  D L F  P +L L++ FV   +    WKG   A L+ + A  +TFIL QYFH +F +G+R+R++LI+A+YRK+LR+S +++KESTVGEIVNLM++DAQ+F+EL +Y++MIWS P QI  AL  LW +LGPSVLAGL +M+++IPVN VI +  +  Q +Q+K  D R+K+MNE+L+GIKVLKLYAWEPSF   V +IR+KE+  ++  AY NA  SF ++CAPFLVSL TF  +VLI  +NVLDA K FVS++LFNILRFPL MLPM+I+NL+Q  VS+ R+  FL  EE++ ++V HD +     +I+NG F W     E  L+NINI   +  LVA+VG VG GKSS++ A LGE++KL G VN  G +AYVPQQAWI NAT+RDNI+FG  YD  +Y ++I AC L  D +IL+  D TEIGEKGINLSGGQKQR+SLARA YSD+++YLLDDPLSAVD+HVGK + + VI   GIL   +R+LVTH +  L + D I V+  G +SE GT+  L+++ GAFA+FI  HL +           + Q ++  +        +  +      + S+ I+ ++A+ +     S  +  K     + D    VA+   L+  +  +                KLIE E S+ G V+ AVY  Y++S+G +L+   ++L    Q F +GSNLWL +W++   +A +                            RD+ LG+YG FGF Q     F SL  A   I  +  LH+ LL+ V R PM +F+T P+GR++NRFS D++ +  +LP      +      +   +++++  P I + + + IAF Y   QR YV+TSRQL RLESV +SPIYSHF ET+ G S+IRAY++ D+FIE +D KVDKN    Y + ++NRWLAI LE VGN I+  A+LFAV+    G   N GLVGLSVSYAL +TQTLNWLVRMSS++E+NIVSVERI+EY +   EAPW++ + K   +NWP  G ++F N+  +YREGLD VL+ ++F I   EKVGIVGRTG+GKSSL LALFRI+E + G I IDG+ I  +GLH +R RLTIIPQDPVLFSG+LR NLDPF    D+EIWK LE+S+LK+F V S    L   I+EGGENLSVGQRQLVCLARALLR+T +LVLDEATAAVDL+TD LIQ+TIR EFKECT+LTIAHRLNT+LD D+++VL+ G+IIE  +P  LL NP+S FYSMAK +NL+
Sbjct:   68 PWNKLNVSKALVNLGLLVITALDLIMALVKKGGDSELPLYDLDVWGPIIKFATFL----LLFIFIPLNRKYGVQTTGCQFIFWFLLTVLSIPRCRTEVRLDAERQKILNSQQPSEQDFSWEEYQFVSFFIFFTFTSIMLILNCFADG-----MPRQTKYQRGEN--------------------------------------------EIPELSASFLSRITYQWFDKMALKGYRNPLEEKDLWDLRPQDSCSEVMPIFAHHWNQNVRKNYKNKARVEPKAQFSNGN--------------VTFENPHGEKNGRKKGMA------------SIMPPIYKSFGGVFLFGALMKLFTDTLTFAQPQVLSLIISFVEAQDAEPEWKGILYAVLLFVLAAAQTFILGQYFHRMFIVGLRIRTALINAIYRKALRISNSTKKESTVGEIVNLMAVDAQRFMELTTYLNMIWSAPLQIGLALYFLWQQLGPSVLAGLAVMIILIPVNGVIASRIKTYQIRQMKYKDERVKLMNEVLSGIKVLKLYAWEPSFEKQVLDIRDKEIATLRSTAYLNAGTSFLWSCAPFLVSLVTFATYVLIDENNVLDATKTFVSLSLFNILRFPLTMLPMLITNLVQTQVSVNRINKFLNSEELDPNSVLHDSSKPHPMSIENGEFSWGD---EITLRNINIEVKKGSLVALVGTVGSGKSSVVQAFLGEMEKLAGVVNTVGKLAYVPQQAWIQNATVRDNILFGQTYDRKRYNKVIDACALRADIDILSAGDLTEIGEKGINLSGGQKQRISLARAVYSDADLYLLDDPLSAVDAHVGKHIFEEVIGPKGILARKSRVLVTHGVTFLPQVDSIYVIKMGEISESGTFDQLVKNKGAFADFIIQHLQEGNEEEEELNQIKRQISSTADVPELLGTVEKAIKLARTESLSDSISVTSADSLMGGGGSLRRRTK-----RQDSHDSVASAASLKKKQEVE---------------GKLIETEKSQTGGVEFAVYKHYIKSVGIFLSVATLVLNFVFQAFQIGSNLWLTQWANDQNVANDTG-------------------------LRDMYLGVYGAFGFGQVTSYFFCSLTLALGCIFCSKVLHETLLSYVFRWPMELFDTTPLGRVVNRFSKDVDTIDNVLPMLWRMVISQAFAVLATIVVISLSTP-IFLAVIVPIAFLYYFAQRFYVATSRQLMRLESVSRSPIYSHFSETVTGASTIRAYNVGDRFIEESDAKVDKNQVCKYPSVIANRWLAIRLEMVGNLIILFASLFAVL----GGQTNPGLVGLSVSYALQVTQTLNWLVRMSSDIETNIVSVERIKEYGETKQEAPWELEQDKNKPKNWPQEGRVEFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFRIIEAAGGRISIDGVDIASMGLHMLRSRLTIIPQDPVLFSGSLRINLDPFEIKTDDEIWKALELSHLKSF-VKSLAAGLNHEIAEGGENLSVGQRQLVCLARALLRKTKVLVLDEATAAVDLETDDLIQKTIRTEFKECTVLTIAHRLNTILDSDKVIVLDKGQIIEFASPTELLDNPKSAFYSMAKDANLV 1548          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Fly
Match: MRP (gene:FBgn0032456 transcript:FBtr0090024)

HSP 1 Score: 1233.39 bits (3190), Expect = 0.000e+0
Identity = 703/1614 (43.56%), Postives = 978/1614 (60.59%), Query Frame = 2
Query:  284 PFFKLTIIKLALIVCLMVLQILEIIYNAAKK---NNIP------YAYTISNCSFLVCMSILAIMVGLERRCNAVNSGFYFNYWLLHFILCAVRARASGL--SLKLKITN------RDYSRECFIFINLTFVTLS----LVLSCFSEKVSQSEIERLNKKRKFQNVLHVNADDNHVSDRMEMSPNAVDSYKTTEKDILINKTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXXXXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSHDDTPGIAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLAD-----------ELQATNNQNFSFXXXXXXXXXXXXXXRTYSE-INQSNANMISSLSKSREKIYKSMENLKMDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAF-YILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISE-KKPDENWPV-GCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNLI 5017
            P+ KL + K  + + L+V+  L++I    KK   + +P      +   I   +FL    +L I + L R+     +G  F +W L  +L   R R      + + KI N      +D+S E + F++           L+L+CF++      + R  K ++ +N                                            E PE  +SFLSRI + WF  + +KGY+ PL+ +DLW L  ++ CS ++PI   ++++ +  N +  ++ +        N                   P   K    +                +M  + KS     L   L K+  D L F  P +L L++ FV   +    WKG   A L+ + A  +TFIL QYFH +F +G+R+R++LI+A+YRK+LR+S +++KESTVGEIVNLM++DAQ+F+EL +Y++MIWS P QI  AL  LW +LGPSVLAGL +M+++IPVN VI +  +  Q +Q+K  D R+K+MNE+L+GIKVLKLYAWEPSF   V +IR+KE+  ++  AY NA  SF ++CAPFLVSL TF  +VLI  +NVLDA K FVS++LFNILRFPL MLPM+I+NL+Q  VS+ R+  FL  EE++ ++V HD +     +I+NG F W     E  L+NINI   +  LVA+VG VG GKSS++ A LGE++KL G VN  G +AYVPQQAWI NAT+RDNI+FG  YD  +Y ++I AC L  D +IL+  D TEIGEKGINLSGGQKQR+SLARA YSD+++YLLDDPLSAVD+HVGK + + VI   GIL   +R+LVTH +  L + D I V+  G +SE GT+  L+++ GAFA+FI  HL +           + Q ++  +        +  +      + S+ I+ ++A+ +     S  +  K     + D    VA+   L+  +  +                KLIE E S+ G V+ AVY  Y++S+G +L+   ++L    Q F +GSNLWL +W++   +A +                            RD+ LG+YG FGF Q L    +++    A + +++ +   L N ++ CP   F+T P GRI++R SSD+N +  ++P  I   + T  Q +   +++++  P I + + + IAF Y   QR YV+TSRQL RLESV +SPIYSHF ET+ G S+IRAY++ D+FIE +D KVDKN    Y + ++NRWLAI LE VGN I+  A+LFAV+    G   N GLVGLSVSYAL +TQTLNWLVRMSS++E+NIVSVERI+EY +   EAPW++ + K   +NWP  G ++F N+  +YREGLD VL+ ++F I   EKVGIVGRTG+GKSSL LALFRI+E + G I IDG+ I  +GLH +R RLTIIPQDPVLFSG+LR NLDPF    D+EIWK LE+S+LK+F V S    L   I+EGGENLSVGQRQLVCLARALLR+T +LVLDEATAAVDL+TD LIQ+TIR EFKECT+LTIAHRLNT+LD D+++VL+ G+IIE  +P  LL NP+S FYSMAK +NL+
Sbjct:   68 PWNKLNVSKALVNLGLLVITALDLIMALVKKGGDSELPLYDLDVWGPIIKFATFL----LLFIFIPLNRKYGVQTTGCQFIFWFLLTVLSIPRCRTEVRLDAERQKILNSQQPSEQDFSWEEYQFVSFFIFFTFTSIMLILNCFADG-----MPRQTKYQRGEN--------------------------------------------EIPELSASFLSRITYQWFDKMALKGYRNPLEEKDLWDLRPQDSCSEVMPIFAHHWNQNVRKNYKNKARVEPKAQFSNGN--------------VTFENPHGEKNGRKKGMA------------SIMPPIYKSFGGVFLFGALMKLFTDTLTFAQPQVLSLIISFVEAQDAEPEWKGILYAVLLFVLAAAQTFILGQYFHRMFIVGLRIRTALINAIYRKALRISNSTKKESTVGEIVNLMAVDAQRFMELTTYLNMIWSAPLQIGLALYFLWQQLGPSVLAGLAVMIILIPVNGVIASRIKTYQIRQMKYKDERVKLMNEVLSGIKVLKLYAWEPSFEKQVLDIRDKEIATLRSTAYLNAGTSFLWSCAPFLVSLVTFATYVLIDENNVLDATKTFVSLSLFNILRFPLTMLPMLITNLVQTQVSVNRINKFLNSEELDPNSVLHDSSKPHPMSIENGEFSWGD---EITLRNINIEVKKGSLVALVGTVGSGKSSVVQAFLGEMEKLAGVVNTVGKLAYVPQQAWIQNATVRDNILFGQTYDRKRYNKVIDACALRADIDILSAGDLTEIGEKGINLSGGQKQRISLARAVYSDADLYLLDDPLSAVDAHVGKHIFEEVIGPKGILARKSRVLVTHGVTFLPQVDSIYVIKMGEISESGTFDQLVKNKGAFADFIIQHLQEGNEEEEELNQIKRQISSTADVPELLGTVEKAIKLARTESLSDSISVTSADSLMGGGGSLRRRTK-----RQDSHDSVASAASLKKKQEVE---------------GKLIETEKSQTGGVEFAVYKHYIKSVGIFLSVATLVLNFVFQAFQIGSNLWLTQWANDQNVANDTG-------------------------LRDMYLGVYGAFGFGQGLCNYGAAISLFTATLHASSRVFHRLFNNIMHCPSEFFDTTPKGRILDRCSSDVNCLDLVMPLNIRMVMSTAFQVLATIVVISLSTP-IFLAVIVPIAFLYYFAQRFYVATSRQLMRLESVSRSPIYSHFSETVTGASTIRAYNVGDRFIEESDAKVDKNQVCKYPSVIANRWLAIRLEMVGNLIILFASLFAVL----GGQTNPGLVGLSVSYALQVTQTLNWLVRMSSDIETNIVSVERIKEYGETKQEAPWELEQDKNKPKNWPQEGRVEFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFRIIEAAGGRISIDGVDIASMGLHMLRSRLTIIPQDPVLFSGSLRINLDPFEIKTDDEIWKALELSHLKSF-VKSLAAGLNHEIAEGGENLSVGQRQLVCLARALLRKTKVLVLDEATAAVDLETDDLIQKTIRTEFKECTVLTIAHRLNTILDSDKVIVLDKGQIIEFASPTELLDNPKSAFYSMAKDANLV 1548          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Zebrafish
Match: abcc3 (ATP-binding cassette, sub-family C (CFTR/MRP), member 3 [Source:ZFIN;Acc:ZDB-GENE-050517-16])

HSP 1 Score: 1263.06 bits (3267), Expect = 0.000e+0
Identity = 717/1631 (43.96%), Postives = 1012/1631 (62.05%), Query Frame = 2
Query:  170 PDIPTCFQFFDAPIYLLGYLILCFP-YIIHLIRKKVNERPFFKLTIIKLALIVCLMVLQIL------EIIYNAAKKNNIPYAYTISNCSFLVCMSILAIMVGLERRCNAVNSGFYFNYWLLHFILCAVRARASGLSLKLKITNRDYSRECFIFINLTFVTLSLVLSCFSEKVSQSEIERLNKKRKFQNVLHVNADDNHVSDRMEMSPNAVDSYKTTEKDILINKTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDK-MLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXX-XXXXXXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSH-DDTPGIAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSMENLKMDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNG--NKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNP---WIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENW-PVGCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNL 5014
            PD+P CFQ          YL    P YI+HL R   N R +  ++I+     V  ++L I+         +   + + I   Y ++     + M +   ++  ER     +SG  F +W L  +   V  R+  +    ++  +D  R    +I  +F  L L+LSCF+EK              F + +              M PN                         CPE  + FLSR+ F+WFT + +KGYK PL+N+DLW LN  +    +VP LL  ++   +     D ++ K  +T  K  SG +                 N+    P+ AE   + ++++   P  + AL+++  PY L+   +K++ D++ F+ P LL++L+ F   S+   +W GY +A LM  +++++T ILHQ+F   F  GMR+R+ +I A+YRK+L ++  +++ STVGE+VNLMS+DAQ+F++L ++++M+WS P QI  AL  LW  LGPSVLAG+ +M+L+IP NA I   TR  Q +Q+K  D RIK+MNEILNGIKVLKLYAWEPSF + + +IR KEL  +++ AY +A  +  +  APFLV+LT+F +FV +   NVLDAEKAFVS++LFNILRFPL MLP VIS+++QASVSLKRL  FL  +E++ ++V    +T   A ++ NG F W +   + +L NIN+  P+  L+A+VG VGCGK+S++SALLGE++KL+G ++++GS+AYVPQQAWI NAT+RDNI+FG PY   KY+ +++AC L  D E+L   D TEIGEKGINLSGGQ+QRVSLARA YS+++VYLLDDPLSAVD+HV K + D+VI   G L G TRILVTH ++ L + + I+V+ +G VSE G+Y DL+R  GAFA F+  +  +++   +    SFDE EE+         T    N+   N      ++R +  + M  +  D+E    N  K+   +RC E       P  +K     KLI+ ET++ G VK+ VY  Y+++IG  LA  I  L+      ++G+N WL  W++ +               HN +Q+ +              +G+Y   G  Q ++ +FSS   A   I++A  LH++LL    + P S F+T P GRIINRFS D+  V  +LP  +  FL T   ++   I++    P   ++I PL+L+   Y  +QR YV+TSRQLKRLESV +SPIYSHF E++ G S IRAY     F+  +DNKVD+N  SYY   VSNRWL + +E +GN IV  AALFAV        ++ GLVGLSVSYAL +T +LNW+VRM+S++ESNIV+VER++EYS+   EAPW++ EKKP  +W P+G ++FV+YS +YREGLD VLKNI+  +   EK+GIVGRTG+GKSS+ L LFR+LE + GEI+ID + I E+GLHD+R +LTIIPQ+PVLFSGTLR NLDPF ++ DEE+WK LE+S+L+ FV N    +LE+  SEGGENLSVGQRQLVCLARALLR+T ILVLDEATAAVDL+TD LIQ TIR EF++CT+ TIAHRLNT++DY ++LVL+ G+I E D P NL+ N +  F+ MAK + L
Sbjct:   23 PDLPECFQMSVLSWAPCIYLWAAAPLYILHLRR---NNRGYIMMSILNRIKTVLGLILWIVCWTDLFSAFHQMNQGSKISPIYFVTPLIVGMTMLLATFLIQFERLKGVQSSGVLFIFWTLSVVFAIVPFRSKIMHANTEV--KDKLRFTTFYIYFSFTLLELILSCFNEK-----------PPLFSSAV--------------MDPNV------------------------CPETTAGFLSRMTFWWFTRMAIKGYKSPLENKDLWSLNKNDSSELVVPGLLNQWEVEKSKAHSSDDQNVKEQVTFTKPGSGAE----------------SNHVNESPEEAEVLLSKQQQKSRQPSFLWALLRAFGPYFLIGSAFKLLQDLITFINPQLLRMLIAFTKQSDVPSWW-GYALAFLMFGTSLLQTLILHQHFQYCFVTGMRLRTGIIGAIYRKALVITNEAKRSSTVGEVVNLMSVDAQRFMDLTTFLNMLWSAPLQIFLALFFLWQNLGPSVLAGVAVMVLLIPFNAFIAMKTRTYQVEQMKYKDDRIKLMNEILNGIKVLKLYAWEPSFRDKILQIRQKELHVLRKTAYLSALSTMAWTSAPFLVALTSFAVFVNVDEKNVLDAEKAFVSLSLFNILRFPLNMLPQVISSIVQASVSLKRLQDFLNHDELDPESVDRKSNTTEYAVSVVNGKFSW-AKRDQVILDNINVLVPQGSLLAVVGHVGCGKTSLISALLGEMEKLDGQISIRGSVAYVPQQAWIQNATLRDNILFGRPYVEQKYRCVLEACALTPDLEVLPGGDLTEIGEKGINLSGGQRQRVSLARALYSEADVYLLDDPLSAVDAHVAKHIFDHVIGPEGALKGKTRILVTHGISFLPQVNNILVLVDGRVSEMGSYQDLLRQNGAFAEFLRNYSLEDIIEDDELTVSFDEEEEEFPEDALSNHTDMVDNEPVVN------EARRQFMRQMSIMSNDVE----NPKKMSRRRRCSERKHP-ETPTEKKEPKVEKLIQAETTETGRVKLQVYWEYVKAIGPLLALFICFLYGCQSAAAIGANFWLSEWTNDA--------------LHNRTQEMLQT-----------RVGVYAALGISQGILVMFSSFTLALGKIQAARKLHQVLLENKFQTPQSFFDTTPTGRIINRFSKDIYVVDEVLPSTLLMFLGTFFASLSTMIVIISSTPVFAFVIAPLALI---YFFVQRFYVATSRQLKRLESVSRSPIYSHFSESITGTSVIRAYGRNAAFVLMSDNKVDENQKSYYPGIVSNRWLGVRIEFIGNCIVLFAALFAVTGKDK---LSPGLVGLSVSYALQVTMSLNWMVRMTSDLESNIVAVERVKEYSETQTEAPWEVLEKKPPPDWPPLGNVEFVDYSVRYREGLDLVLKNISLKVRGGEKIGIVGRTGAGKSSMTLCLFRLLEAAAGEIVIDDVKISEIGLHDLRSKLTIIPQEPVLFSGTLRMNLDPFERYSDEEVWKALELSHLQKFVTNQA-AKLELECSEGGENLSVGQRQLVCLARALLRKTRILVLDEATAAVDLETDDLIQSTIRTEFQDCTVFTIAHRLNTIMDYTRVLVLDKGQIAEFDTPTNLM-NQKGLFFGMAKDAGL 1537          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Zebrafish
Match: abcc1 (ATP-binding cassette, sub-family C (CFTR/MRP), member 1 [Source:ZFIN;Acc:ZDB-GENE-050517-15])

HSP 1 Score: 1223.76 bits (3165), Expect = 0.000e+0
Identity = 695/1640 (42.38%), Postives = 990/1640 (60.37%), Query Frame = 2
Query:  140 DWASEWNSPSPDIPTCFQFFDAPIYLLGYLILCFP-YIIHLIRKKVNERPFFKLTIIKLALIVCLMVLQIL---EIIYNAAKKNN---IPYAYTISNCSFLVCMSILAIMVGLERRCNAVNSGFYFNYWLLHFILCAVRARASGLSLKLKITNRDYSRECFIFINLTFVTLSLVLSCFSEKVSQSEIERLNKKRKFQNVLHVNADDNHVSDRMEMSPNAVDSYKTTEKDILINKTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXXXXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSHDDTPGIAAT-----IKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSMENLKMDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWP-VGCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSG-NEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNLI 5017
            DW   W +  PD+  CFQ          YL L  P YI++L   K ++R +  +T +  A  V    L ++   ++ Y+  ++++   +   Y +S     V M +   ++  ER     +SG   N+WL+  +   +  R+  +       +    R    +I  T + +SL+L+C S+           +   F  V+                                       D   CPE  +SFLS+I F+W T L+VKGYK PL+ +DLW LN E++   +VP L+R +D+     KR     DK L + K +                T     + + + ++        ++  +P L  AL ++  PY L+S LYKIIHD+L F+GP +L+LL+ FV+DS     W GYF  AL+ +   ++T IL +YFH+ F  GMR+R++++ AVYRK+L ++ A+R+ STVGEIVNLMS+DAQ+F++LI+YI+MIWS P Q+I AL  LW  LG SVLAG+ +M+LM+P+NAVI   T+  Q  Q+K  D+RIK+MNE+LNGIKVLKLYAWE +F   V+ IR  EL+ +K+ AY  A  +FT+ CAPFLV+L+TF ++VL+  +N+LDA+KAFVS+ LFNILRFPL MLPMVIS+++QASVS++RL  FL  EE++ D V   + P I+ T     I +G F W    P P LK IN++ PE  LVA+VG VG GKSS+LSALLGE+ K EG V++KGS+AYVPQQAWI NAT++DNI+FG       YQ++++AC L  D EIL   D TEIGEKG+NLSGGQKQRVS+ARA Y + +VYLLDDPLSAVD+HVGK + + VI   G+L G TR+LVTH L+ L + D I+VM +G ++E G+Y++L+   GAFA F+ T+       TN +                      E  +S  + +             +   ++ L    A  T     ++ +   D           ++L E + +  G VK++V+  Y+++IG  L+   I LF      SLGSN WL  W+D   +              N++Q            +R++ LG+YG  G  Q +     S+  +   I ++  LH+ +L  VLR PMS FE  P G ++NRF+ + + + +++P  I  F+ +    +    ++ I  P + I +  +   Y  +QR YV++SRQ+KRLESV +SP+Y+HF ETL G S IRA+    +FI+ +D +VD N  +Y+ + V+NRWLA+ LE VGN IV  AALFAV++  N   ++ G++GLS+SYAL +T +LNWLVRMSSE+E+NIV+VER++EY     EA W +        WP  G I+   +  +YRE L+  + +I+  I   EKVGIVGRTG+GKSSL L LFRI+E ++GEI IDG+ I +LGLH++R R+TIIPQDPVLFSG+LR NLDPF+ + DEE+W+ LE+++LKTFV  SG  ++L    SEGGENLS+GQRQLVCLARALLR+T ILVLDEATAAVDL+TD LIQ TIR +F++CT+LTIAHRLNT++DY ++LVL+ G++ E D+P+NL+   +  FY MAK S L+
Sbjct:   17 DWNRTWQTYYPDLTPCFQNTVLVWIPCLYLWLFAPLYILYL---KSHDRGYICMTHLNRAKTVIGFTLWLICWADVFYSFWERSHGATVAPVYLVSPTMLGVTMLLATFLIQYERMKGVQSSGVMLNFWLITIVCATITFRSKIMHALNDPASVGVFRYTTFYIYYTLLLISLILACLSD-----------QPPLFSEVVK--------------------------------------DSNPCPESGASFLSKITFWWITGLMVKGYKRPLEEKDLWSLNNEDKSERVVPQLVRRWDQECVKVKR---PVDKTLYSPKRS----------------TRGEKKDGQPVEESEILLAKALQKTGEPSLFFALCRTFGPYFLVSSLYKIIHDVLMFVGPEILRLLILFVNDSSAPT-WHGYFYTALLFVCTCLQTLILQKYFHVCFVTGMRLRTAIVGAVYRKALVITNAARRTSTVGEIVNLMSVDAQRFMDLITYINMIWSAPLQVILALYFLWQNLGASVLAGVAVMVLMVPLNAVIAMKTKTYQVAQMKSKDNRIKLMNEVLNGIKVLKLYAWELAFKGKVSAIRESELRVLKKMAYLGAISTFTWVCAPFLVALSTFAVYVLVDENNILDAQKAFVSLALFNILRFPLNMLPMVISSMVQASVSMQRLRVFLSHEELDDDNV---ERPAISGTPDSIRIADGAFSWSKDDP-PTLKRINVSIPEGALVAVVGHVGSGKSSLLSALLGEMHKQEGSVSIKGSVAYVPQQAWIQNATLKDNILFGRETKDSWYQKVVEACALLPDLEILPGGDTTEIGEKGVNLSGGQKQRVSVARAVYCNCSVYLLDDPLSAVDAHVGKHIFEKVIGPQGLLQGRTRVLVTHGLSFLPQADLILVMVDGEITEMGSYTELLGRQGAFAEFLRTY-------TNTEQ--------------------EEGEESLGDAVPRKGLENGGPAALLRQSQISLNATGAGKT----TQKTEANDDAAATKTKSAEASRLTEADKANTGRVKLSVFWEYMKAIGLPLSIFSIFLFFCHHLSSLGSNYWLSLWTDDPVV--------------NNTQP-----------KREMRLGVYGALGISQGIAVFCYSVSVSVGGILASRYLHQTMLYNVLRSPMSFFERTPSGNLVNRFAKETDTIDSVIPSIIKMFMGSMFNVLGSCAVILIATPLVAIIIPPLGLLYFFVQRFYVASSRQMKRLESVSRSPVYTHFNETLLGTSVIRAFGEQQRFIKESDGRVDHNQKAYFPSIVANRWLAVRLEFVGNCIVTFAALFAVMARNN---LSPGIMGLSISYALQVTASLNWLVRMSSELETNIVAVERVKEYGDTEKEAEWKLENSNLPPGWPTAGHIEIHKFGLRYREDLELAICDISVNIAGGEKVGIVGRTGAGKSSLTLGLFRIIEAAEGEIRIDGVNIADLGLHELRSRITIIPQDPVLFSGSLRMNLDPFDGYTDEEVWRSLELAHLKTFV--SGLPDKLNHECSEGGENLSLGQRQLVCLARALLRKTKILVLDEATAAVDLETDNLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVLVLDKGQMAEFDSPSNLIAK-KGIFYKMAKDSGLV 1518          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Zebrafish
Match: abcc1 (ATP-binding cassette, sub-family C (CFTR/MRP), member 1 [Source:ZFIN;Acc:ZDB-GENE-050517-15])

HSP 1 Score: 1172.92 bits (3033), Expect = 0.000e+0
Identity = 666/1542 (43.19%), Postives = 936/1542 (60.70%), Query Frame = 2
Query:  416 FLVCMSILA-IMVGLERRCNAVNSGFYFNYWLLHFILCAVRARASGLSLKLKITNRDYSRECFIFINLTFVTLSLVLSCFSEKVSQSEIERLNKKRKFQNVLHVNADDNHVSDRMEMSPNAVDSYKTTEKDILINKTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXXXXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSHDDTPGIAAT-----IKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSMENLKMDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWP-VGCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSG-NEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNLI 5017
            F+    +LA  ++  ER     +SG   N+WL+  +   +  R+  +       +    R    +I  T + +SL+L+C S+           +   F  V+                                       D   CPE  +SFLS+I F+W T L+VKGYK PL+ +DLW LN E++   +VP L+R +D+     KR     DK L + K +                T     + + + ++        ++  +P L  AL ++  PY L+S LYKIIHD+L F+GP +L+LL+ FV+DS     W GYF  AL+ +   ++T IL +YFH+ F  GMR+R++++ AVYRK+L ++ A+R+ STVGEIVNLMS+DAQ+F++LI+YI+MIWS P Q+I AL  LW  LG SVLAG+ +M+LM+P+NAVI   T+  Q  Q+K  D+RIK+MNE+LNGIKVLKLYAWE +F   V+ IR  EL+ +K+ AY  A  +FT+ CAPFLV+L+TF ++VL+  +N+LDA+KAFVS+ LFNILRFPL MLPMVIS+++QASVS++RL  FL  EE++ D V   + P I+ T     I +G F W    P P LK IN++ PE  LVA+VG VG GKSS+LSALLGE+ K EG V++KGS+AYVPQQAWI NAT++DNI+FG       YQ++++AC L  D EIL   D TEIGEKG+NLSGGQKQRVS+ARA Y + +VYLLDDPLSAVD+HVGK + + VI   G+L G TR+LVTH L+ L + D I+V    MV  E      I   G++   +    A                             ++E  ++  N      +      ++ E L  +   D A  TK +  +                  ++L E + +  G VK++V+  Y+++IG  L+   I LF      SLGSN WL  W+D   +              N++Q +           R++ LG+YG  G  Q +     S+  +   I ++  LH+ +L  VLR PMS FE  P G ++NRF+ + + + +++P  I  F+ +    +    ++ I  P + I +  +   Y  +QR YV++SRQ+KRLESV +SP+Y+HF ETL G S IRA+    +FI+ +D +VD N  +Y+ + V+NRWLA+ LE VGN IV  AALFAV++  N   ++ G++GLS+SYAL +T +LNWLVRMSSE+E+NIV+VER++EY     EA W +        WP  G I+   +  +YRE L+  + +I+  I   EKVGIVGRTG+GKSSL L LFRI+E ++GEI IDG+ I +LGLH++R R+TIIPQDPVLFSG+LR NLDPF+ + DEE+W+ LE+++LKTFV  SG  ++L    SEGGENLS+GQRQLVCLARALLR+T ILVLDEATAAVDL+TD LIQ TIR +F++CT+LTIAHRLNT++DY ++LVL+ G++ E D+P+NL+   +  FY MAK S L+
Sbjct:  120 FMYVFQLLATFLIQYERMKGVQSSGVMLNFWLITIVCATITFRSKIMHALNDPASVGVFRYTTFYIYYTLLLISLILACLSD-----------QPPLFSEVVK--------------------------------------DSNPCPESGASFLSKITFWWITGLMVKGYKRPLEEKDLWSLNNEDKSERVVPQLVRRWDQECVKVKR---PVDKTLYSPKRS----------------TRGEKKDGQPVEESEILLAKALQKTGEPSLFFALCRTFGPYFLVSSLYKIIHDVLMFVGPEILRLLILFVNDSSAPT-WHGYFYTALLFVCTCLQTLILQKYFHVCFVTGMRLRTAIVGAVYRKALVITNAARRTSTVGEIVNLMSVDAQRFMDLITYINMIWSAPLQVILALYFLWQNLGASVLAGVAVMVLMVPLNAVIAMKTKTYQVAQMKSKDNRIKLMNEVLNGIKVLKLYAWELAFKGKVSAIRESELRVLKKMAYLGAISTFTWVCAPFLVALSTFAVYVLVDENNILDAQKAFVSLALFNILRFPLNMLPMVISSMVQASVSMQRLRVFLSHEELDDDNV---ERPAISGTPDSIRIADGAFSWSKDDP-PTLKRINVSIPEGALVAVVGHVGSGKSSLLSALLGEMHKQEGSVSIKGSVAYVPQQAWIQNATLKDNILFGRETKDSWYQKVVEACALLPDLEILPGGDTTEIGEKGVNLSGGQKQRVSVARAVYCNCSVYLLDDPLSAVDAHVGKHIFEKVIGPQGLLQGRTRVLVTHGLSFLPQADLILV----MVDGE------ITEMGSYTELLGRQGA-----------------------------FAEFLRTYTNTEQEEGEESLGGEQTSEGLSSN---DDAAATKTKSAE-----------------ASRLTEADKANTGRVKLSVFWEYMKAIGLPLSIFSIFLFFCHHLSSLGSNYWLSLWTDDPVV--------------NNTQPK-----------REMRLGVYGALGISQGIAVFCYSVSVSVGGILASRYLHQTMLYNVLRSPMSFFERTPSGNLVNRFAKETDTIDSVIPSIIKMFMGSMFNVLGSCAVILIATPLVAIIIPPLGLLYFFVQRFYVASSRQMKRLESVSRSPVYTHFNETLLGTSVIRAFGEQQRFIKESDGRVDHNQKAYFPSIVANRWLAVRLEFVGNCIVTFAALFAVMARNN---LSPGIMGLSISYALQVTASLNWLVRMSSELETNIVAVERVKEYGDTEKEAEWKLENSNLPPGWPTAGHIEIHKFGLRYREDLELAICDISVNIAGGEKVGIVGRTGAGKSSLTLGLFRIIEAAEGEIRIDGVNIADLGLHELRSRITIIPQDPVLFSGSLRMNLDPFDGYTDEEVWRSLELAHLKTFV--SGLPDKLNHECSEGGENLSLGQRQLVCLARALLRKTKILVLDEATAAVDLETDNLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVLVLDKGQMAEFDSPSNLIAK-KGIFYKMAKDSGLV 1498          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Zebrafish
Match: abcc2 (ATP-binding cassette, sub-family C (CFTR/MRP), member 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1523])

HSP 1 Score: 1156.74 bits (2991), Expect = 0.000e+0
Identity = 672/1552 (43.30%), Postives = 953/1552 (61.40%), Query Frame = 2
Query:  386 PYAYTISNCSFLVCMSILAIMVGLERRCNAVNSGFYFNYWLLHFILCAVRARASGLSLKLKITNRDYSRECFIFINLTFVTLSLVLSCFSEKVSQSEIERLNKKRKFQNVLHVNADDNHVSDRMEMSPNAVDSYKTTEKDILINKTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEER----CSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXXXXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSHDDTPGIAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSMENLKMDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFS-LGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQ-RDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWP-VGCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFV--VNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNL 5014
            P  + +S    ++C         +  R   V+SG  F +WLL  ++CAV    + L   L     D  R C  +I+     ++LVLS  ++                                  +SP A    +T                   PE  ++FLSRI F WF  ++ KG+K PL  ED+W LN  +     C +   ++ +   K  A N  +  KS K  T D        K + +      T     +K+   +  +       + +   L+  ++KS    LL S L+K++ D+L+F  P LLKL++ F + +++ + W GY  A L+++ A V++ +L QYF   F +GM+VR+++++AVY+K+L +S  SRKEST GEIVNLMS DAQ+F ++ ++IH++WS P QI  ++  LW ELGPSVL+GL++M+LM+P+N  +   +R+ Q Q +K  DSR+K++N++LNGIK+LK YAWE SF   V EIR KELK M++ AY ++  +F F+CAP LVSL TF +FV +S DN+LDAEKAF SI+LFNILRFPL MLP +IS ++Q SVS KRL  FL  ++++   V+H+ +   A ++ NG + W+  T EPVLK +++      LVA+VG VG GK+S++SALLGE+  ++G +N+ GS+AYVPQQAWI NAT++DNI+FG   D  +YQ +IKAC LE D ++L   D TEIGEKGINLSGGQKQRVSLARA YS ++VYLLDDPLSAVDSHVGK L + VI   G+L   TRILVTH ++ L   D I+V+ +G+VSE G+Y  L    GAF+ F+ T+  DE    N++  +  +    + +    +   ++ + S  +++SS  K    +  S  + K +    V   + L   K  ++           K G +LIE+E  + G VK +VY+ YL ++G+W   G   +F   Q  + +G NLWL  W+D S                      I+   +   +  RD  +G++G  G  Q  +  F ++  A   I ++ +LH  LL  +L+ PM  F+T P GRI+NRF+ D+  V  M+P     +++  L  +    ++ +  P     +  M   Y  +QR YV+TSRQL+RL+SV +SPIYSHFGET+ G+S IRAY   D+F++ N++ +D+NL S Y   VSNRWLA+ LE++GN +VF AALFAVIS  +   +N+GLVGLS+SYAL++TQTLNWLVRM+SE+E+NIV+VER+ EY+++  EAPW  S + PD +WP  G I+F +Y  +YR  L+ VL  +   I   EK+GIVGRTG+GKSSL   LFRI+E +DG ILID + I  LGLHD+R RLTIIPQDPVLFSGTLR NLDPF    D EIW VLE+++LK +V  + +G   LE  +SEGGENLS+GQRQL+CLARALLR++ IL+LDEATAAVDL+TD LIQ TIRREF  CT+LTIAHRLNT+LD  +++VL++G+I+E D+PN LL  P   F SMA+ + +
Sbjct:  112 PVLFAVSWIVVMLCQE------SMRHRLMCVDSGSLFMFWLLQ-VVCAVFQFQTLLREALSQGISDVPRFCLFYISYGLQIIALVLSAIAD----------------------------------VSPEAKKVAETN------------------PEAKATFLSRITFNWFNSMVWKGFKRPLVQEDMWDLNKNDSTHFICQTFEDVMAKELKK--ARNNLQKKKSKKRKTVDAEGQNGLAKGVSQDVLVMETETEKESKKKKKKKQKDSDSDYPQSW---LVTTIVKSFKGVLLESALFKLLQDLLSFASPQLLKLMIAF-TQNKDSYAWTGYLYAVLLVLVAFVQSVVLQQYFQRCFILGMKVRTAIMAAVYKKALVVSNDSRKESTAGEIVNLMSADAQRFNDVTNFIHLLWSCPLQIALSIAFLWIELGPSVLSGLLVMVLMVPINGWLATKSRQFQMQNMKFKDSRMKIVNDLLNGIKILKYYAWETSFEAQVQEIREKELKVMRKFAYLSSVSTFIFSCAPALVSLATFAVFVSVSPDNILDAEKAFTSISLFNILRFPLAMLPQLISIMVQTSVSKKRLEKFLSGDDLDTTTVTHNSSITAAVSMTNGTYAWERDT-EPVLKQVSLDIKPGRLVAVVGAVGSGKTSLVSALLGELHSIKGNININGSVAYVPQQAWIQNATLKDNILFGSSVDEERYQSVIKACALEPDLDLLPGRDQTEIGEKGINLSGGQKQRVSLARAVYSSADVYLLDDPLSAVDSHVGKHLFEKVIGPNGLLRDKTRILVTHGISFLPYVDEIVVLVHGVVSEIGSYESLRASKGAFSEFLETYGKDESNKDNDKKAAAAQTPVYEEIETLPEGLETQADGSPEDIVSSTLKRENSLRHSQRHSKRNGSVKVRKNSSLRAQKDPED-----------KKGQRLIEKEMMETGRVKFSVYLQYLSAMGWWY-VGFSFVFYFIQNVAVIGQNLWLSDWTDDS----------------------IEYFNQTYPNHIRDTRIGVFGALGLAQGFLVFFGTILLADGSISASRTLHTSLLTNILKVPMMFFDTTPSGRIVNRFAKDIFTVDEMIPMSFRSWILCLLGVLGTLFVICLATPIFTAVVVPMAVVYYFVQRFYVATSRQLRRLDSVSRSPIYSHFGETVSGLSVIRAYGHQDRFLKHNEDTIDQNLKSVYPWIVSNRWLAMRLESLGNLVVFFAALFAVISRDS---LNSGLVGLSISYALNVTQTLNWLVRMTSELETNIVAVERVREYAEIQNEAPWVTSVRPPD-DWPSAGNIRFEDYKVRYRPELELVLHGVTCDIQSTEKIGIVGRTGAGKSSLTNCLFRIVEAADGRILIDDIDIATLGLHDLRSRLTIIPQDPVLFSGTLRMNLDPFQTFSDAEIWSVLELAHLKEYVRGLPTG---LEHEVSEGGENLSLGQRQLLCLARALLRKSRILILDEATAAVDLETDDLIQSTIRREFSHCTVLTIAHRLNTILDSSRVMVLDSGKIVEFDSPNELLSKP-GHFSSMAEDAGI 1555          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Zebrafish
Match: abcc2 (ATP-binding cassette, sub-family C (CFTR/MRP), member 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1523])

HSP 1 Score: 1155.97 bits (2989), Expect = 0.000e+0
Identity = 672/1552 (43.30%), Postives = 952/1552 (61.34%), Query Frame = 2
Query:  386 PYAYTISNCSFLVCMSILAIMVGLERRCNAVNSGFYFNYWLLHFILCAVRARASGLSLKLKITNRDYSRECFIFINLTFVTLSLVLSCFSEKVSQSEIERLNKKRKFQNVLHVNADDNHVSDRMEMSPNAVDSYKTTEKDILINKTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEER----CSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXXXXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSHDDTPGIAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSMENLKMDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFS-LGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQ-RDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWP-VGCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFV--VNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNL 5014
            P  + +S    ++C         +  R   V+SG  F +WLL  ++CAV    + L   L     D  R C  +I+     ++LVLS  ++                                  +SP A    +T                   PE  ++FLSRI F WF  ++ KG+K PL  ED+W LN  +     C +   ++ +   K  A N  +  KS K  T D        K + +      T     +K+   +  +       + +   L+  ++KS    LL S L+K++ D+L+F  P LLKL++ F + +++ + W GY  A L+++ A V++ +L QYF   F +GM+VR+++++AVY+K+L +S  SRKEST GEIVNLMS DAQ+F ++ ++IH++WS P QI  ++  LW ELGPSVL+GL++M+LM+P+N  +   +R+ Q Q +K  DSR+K++N++LNGIK+LK YAWE SF   V EIR KELK M++ AY ++  +F F+CAP LVSL TF +FV +S DN+LDAEKAF SI+LFNILRFPL MLP +IS ++Q SVS KRL  FL  ++++   V+HD +   A ++ NG + W+  T EPVLK +++      LVA+VG VG GK+S++SALLGE+  ++G +N+ GS+AYVPQQAWI NAT++DNI+FG   D  +YQ +IKAC L  D ++L   D TEIGEKGINLSGGQKQRVSLARA YS ++VYLLDDPLSAVDSHVGK L + VI   G+L   TRILVTH ++ L   D I+V+ +G+VSE G+Y  L    GAF+ F+ T+  DE    N++  +  +    + +    +   ++ + S  +++SS  K    +  S  + K +    V   + L   K  ++           K G +LIE+E  + G VK +VY+ YL ++G+W   G   +F   Q  + +G NLWL  W+D S                      I+   +   +  RD  +G++G  G  Q  +  F ++  A   I ++ +LH  LL  +L+ PM  F+T P GRI+NRF+ D+  V  M+P     +++  L  +    ++ +  P     +  M   Y  +QR YV+TSRQL+RL+SV +SPIYSHFGET+ G+S IRAY   D+F++ N++ +D+NL S Y   VSNRWLA+ LE++GN +VF AALFAVIS  +   +N+GLVGLS+SYAL++TQTLNWLVRM+SE+E+NIV+VER+ EY+++  EAPW  S + PD +WP  G I+F +Y  +YR  L+ VL  +   I   EK+GIVGRTG+GKSSL   LFRI+E +DG ILID + I  LGLHD+R RLTIIPQDPVLFSGTLR NLDPF    D EIW VLE+++LK +V  + +G   LE  +SEGGENLS+GQRQL+CLARALLR++ IL+LDEATAAVDL+TD LIQ TIRREF  CT+LTIAHRLNT+LD  +++VL++G+I+E D+PN LL  P   F SMA+ + +
Sbjct:   98 PVLFAVSWIVVMLCQE------SMRHRLMCVDSGSLFMFWLLQ-VVCAVFQFQTLLREALSQGISDVPRFCLFYISYGLQIIALVLSAIAD----------------------------------VSPEAKKVAETN------------------PEAKATFLSRITFNWFNSMVWKGFKRPLVQEDMWDLNKNDSTHFICQTFEDVMAKELKK--ARNNLQKKKSKKRKTVDAEGQNGLAKGVSQDVLVMETETEKESKKKKKKKQKDSDSDYPQSW---LVTTIVKSFKGVLLESALFKLLQDLLSFASPQLLKLMIAF-TQNKDSYAWTGYLYAVLLVLVAFVQSVVLQQYFQRCFILGMKVRTAIMAAVYKKALVVSNDSRKESTAGEIVNLMSADAQRFNDVTNFIHLLWSCPLQIALSIAFLWIELGPSVLSGLLVMVLMVPINGWLATKSRQFQMQNMKFKDSRMKIVNDLLNGIKILKYYAWETSFEAQVQEIREKELKVMRKFAYLSSVSTFIFSCAPALVSLATFAVFVSVSPDNILDAEKAFTSISLFNILRFPLAMLPQLISIMVQTSVSKKRLEKFLSGDDLDTTTVTHDSSITAAVSMTNGTYAWERDT-EPVLKQVSLDIKPGRLVAVVGAVGSGKTSLVSALLGELHSIKGNININGSVAYVPQQAWIQNATLKDNILFGSSVDEERYQSVIKACALGPDLDLLPGRDQTEIGEKGINLSGGQKQRVSLARAVYSSADVYLLDDPLSAVDSHVGKHLFEKVIGPNGLLRDKTRILVTHGISFLPYVDEIVVLVHGVVSEIGSYESLRASKGAFSEFLETYGKDESNKDNDKKAAAAQTPVYEEIETLPEGLETQADGSPEDIVSSTLKRENSLRHSQRHSKRNGSVKVRKNSSLRAQKDPED-----------KKGQRLIEKEMMETGRVKFSVYLQYLSAMGWWY-VGFSFVFYFIQNVAVIGQNLWLSDWTDDS----------------------IEYFNQTYPNHIRDTRIGVFGALGLAQGFLVFFGTILLADGSISASRTLHTSLLTNILKVPMMFFDTTPSGRIVNRFAKDIFTVDEMIPMSFRSWILCLLGVLGTLFVICLATPIFTAVVVPMAVVYYFVQRFYVATSRQLRRLDSVSRSPIYSHFGETVSGLSVIRAYGHQDRFLKHNEHTIDQNLKSVYPWIVSNRWLAMRLESLGNLVVFFAALFAVISRDS---LNSGLVGLSISYALNVTQTLNWLVRMTSELETNIVAVERVREYAEIQNEAPWVTSVRPPD-DWPSAGNIRFEDYKVRYRPELELVLHGVTCDIQSTEKIGIVGRTGAGKSSLTNCLFRIVEAADGRILIDDIDIATLGLHDLRSRLTIIPQDPVLFSGTLRMNLDPFQTFSDAEIWSVLELAHLKEYVRGLPTG---LEHEVSEGGENLSLGQRQLLCLARALLRKSRILILDEATAAVDLETDDLIQSTIRREFSHCTVLTIAHRLNTILDSSRVMVLDSGKIVEFDSPNELLSKP-GHFSSMAEDAGI 1541          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Xenopus
Match: septin9 (septin 9 [Source:Xenbase;Acc:XB-GENE-1012202])

HSP 1 Score: 1235.71 bits (3196), Expect = 0.000e+0
Identity = 700/1602 (43.70%), Postives = 996/1602 (62.17%), Query Frame = 2
Query:  254 HLIRKKVNERPFFKLTIIKLA------LIVCLMVLQILEIIYNAAKKNNIPYAYTISNCSFLVCMSILAIMVGLERRCNAVNSGFYFNYWLLHFILCAVRARASGLSLKLKITNRDYSRECFIFINLTFVTLSLVLSCFSEKVSQSEIERLNKKRKFQNVLHVNADDNHVSDRMEMSPNAVDSYKTTEKDILINKTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDK---CLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXXXXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSHDDT-PGIAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEI--NQSNANMISSLSKSREKIYKSMENLKMDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPW---IIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWPV-GCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSN 5011
            +L+  K N R +  L+++  A      L+ C+    +    +   +  + P  Y ++     + M    ++   ER     +SG    +W L  +   +  R+  ++   +    D  R    F+  + + + L+LSCF E             R F + +           R E++P                          CPE  + FLSR+ F+WFT + + GYK PL+++DLW LN ++  + +V  L++ ++K    LA  +   SK  + + N  +    +   +            DN K   P+             +P  +  L+++  PY L+   +K+  D+L+F+ P LL +L+ F+ + +   +W G+ IA LM ++++V+T ILHQ+F   F  GMR+RS++   +YRKSL ++ ++++ STVGE+VNLMS+DAQ+F +L ++++M+WS P QI  AL  LW  LGPSVLAG+ +M+L+IP+NA I   TR  Q +Q++  DSRIK+MNEILNGIKVLKLYAWEPSF   V EIRNKEL  +K+AAY NA  +F +  APFLV+LTTF ++V +   N+LDAEKAFVS++LFNILRFPL MLP VISNL QASVS+KR+  FL  +E++ +AV+ D T PG A T+ NG F W +     +L+NIN+  P   LVA+VG VGCGKSS++SALLGE++K EG V+++GS+AYVPQQAWI N T++DNI+FG   +   Y+++++AC L  D E+L   D TEIGEKGINLSGGQKQRVSLARA +S+++VYLLDDPLSAVD+HV K + DNVI   G+L G TR+LVTH ++ L + D I+V+ +G V+E G+Y +L++  GAF+ F+  +  D+      ++ +  + EE  L  + L  T++++  N+  AN      ++R+K  + +  L  D E   A  T+    +R  E+         Q    KLI+ ET++ G VKM V+  Y++++G  ++  I  L+      ++G+N+WL  W+++  I              N +Q+              + +G+Y   G  Q L+ + SS   A A I +A  LH  LL+  +  P S ++T P+GRIINRFS D+  +  ++P  I  FL T   ++   I++    P    +IIPL++    YI +QR YV+TSRQLKRLESV +SPIYSHF ET+ G S IRAY   + FI  +DNKVD+N  SYY   VSNRWL + +E VGN +V  AALFAV+  ++   ++ GLVGLSVSYAL +T +LNW+VRM+S++E+NIV+VER++EY++   EAPW I + KP E+WP  G ++  NYS +YR GLD VLKN+N  +N  EKVGIVGRTG+GKSS+ L LFRILE ++G + ID + I E+GL D+R RLTIIPQDPVLFSGTLR NLDPFNK+ D+EIWK LE+SNLK FV    + QLE   SEGGENLSVGQRQLVCLARALLR+T IL+LDEATAA+DL+TD LIQ TIR +F++CT+LTIAHRLNT++DY ++LVL+ G I E D P NL+   +  FY MAK + 
Sbjct:   52 YLLYLKYNRRGYIVLSMLSKAKTVFGVLLWCVCWADLFYSFHGLVQNQSPPPVYFVTPLILGITMITATVLAQYERLRGVQSSGVLIIFWFLATVCAIIPFRSKVMASARQGQVTDKFRFTTFFLYFSLLVIELLLSCFKEA------------RPFFSPV-----------RDEINP--------------------------CPESDAGFLSRLTFWWFTKMAILGYKRPLEDKDLWSLNEDDTSNVVVTNLIKEWEKEKSNLAQMQVSYSKKPEAVLNHTDEKAYESDVLIV----------DNKK---PK-------------EPSFLKVLLRTFGPYFLIGSFFKLFQDLLSFVNPQLLSILITFIKNKDAPSWW-GFCIAVLMFLTSLVQTLILHQHFQYCFVTGMRLRSAITGIIYRKSLVITNSAKRSSTVGEVVNLMSVDAQRFQDLTTFLNMLWSAPLQICLALYFLWQALGPSVLAGVAVMVLLIPINAFIAMKTRAFQVEQMQYKDSRIKLMNEILNGIKVLKLYAWEPSFAQKVLEIRNKELNILKKAAYLNALSTFAWTSAPFLVALTTFAVYVTVDEKNILDAEKAFVSLSLFNILRFPLNMLPQVISNLAQASVSIKRIQNFLANDELDLNAVTKDKTLPGNAITVHNGTFSW-AKNGGAILQNINLLVPSGSLVAVVGQVGCGKSSLVSALLGEMEKEEGEVSVRGSVAYVPQQAWIQNCTLKDNILFGRAANEKNYKKVLEACALVTDLEVLPGGDQTEIGEKGINLSGGQKQRVSLARAVFSNADVYLLDDPLSAVDAHVAKHIFDNVIGPDGLLRGKTRVLVTHGISFLPQVDHIVVLVDGRVTEMGSYQELLKQNGAFSEFLRNYAFDD--EVEEEDITIPDEEEVLLAEETLS-THTDLADNEPVAN------EARKKFIRQISILS-DGEPSHAMSTR----RRFTEKKPSENLVAKQPPTEKLIQTETTETGRVKMTVFWQYMKAVGLAISVFICFLYSCQNAAAIGANVWLSDWTNEPVI--------------NQTQQNT-----------QMRVGVYAALGILQGLLVMTSSFSLAIAGIGAARKLHSALLDNKMHTPQSFYDTTPIGRIINRFSKDIYVIDEVIPGTILMFLATFFTSLSTMIVIVASTPLFAVVIIPLAIA---YIFVQRFYVATSRQLKRLESVSRSPIYSHFSETITGASIIRAYGRQNSFIVLSDNKVDENQKSYYPGIVSNRWLGVRVEFVGNCVVLFAALFAVLGREH---LSPGLVGLSVSYALQVTMSLNWMVRMTSDLETNIVAVERVKEYAENETEAPWHIEDTKPPEDWPSKGEVELSNYSVRYRAGLDLVLKNLNLKVNGGEKVGIVGRTGAGKSSMTLCLFRILEPAEGIVKIDNVNISEIGLQDLRSRLTIIPQDPVLFSGTLRMNLDPFNKYSDDEIWKALELSNLKKFVAGQPS-QLEYECSEGGENLSVGQRQLVCLARALLRKTRILILDEATAAIDLETDDLIQMTIRTQFEDCTVLTIAHRLNTIMDYTRVLVLDKGRIAEFDTPTNLIA-LKGIFYGMAKDAG 1529          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Xenopus
Match: ABCC1 (ATP binding cassette subfamily C member 1 [Source:HGNC Symbol;Acc:HGNC:51])

HSP 1 Score: 1216.45 bits (3146), Expect = 0.000e+0
Identity = 677/1402 (48.29%), Postives = 920/1402 (65.62%), Query Frame = 2
Query:  836 DLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSD-KMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXXX-XXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSHDDTPGIAATI--KNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSMENLKMDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPW---IIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWP-VGCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNLI 5017
            D   CPE  +SFLS+I F+W + ++V+G+K PL+ +DLW LN E++   +VP+L +N++K    NK +  K   KM+ + K  + K                  N+K  + + AE    K   ++ +P L+ AL K+  PY  +S  +K  HD+L F GP LL+LL++FV D +    W GY    L+   A ++T ILH+YFHI F  GMR++++++  VYRK+L ++ ++R+ ST+GEIVNLMS+DAQ+F++L +YI+MIWS P Q+I A  LLW  LGPSVLAG+ +M+L++PVNAVI   T+K Q  Q+K  D+RIK+MNEILNGIKVLKLYAWE +F   V  IR  ELK +K++AY  A  +FT+ CAPFLV+L+TF ++VLI + NVLDAEKAFVS+ LFNILRFPL MLPMVIS+++QASVSLKRL  FL  EE+  +++  +       +I  K+  F W S    P LK+INI+ PE  LVA+VG VGCGKSS+LSALLGE++K +GYV MKGS+ YV QQAWI NA+++DN++FG   +   Y+++I+AC L  D EIL   D TEIGEKG+NLSGGQKQRVSLARA Y ++++YLLDDPLSAVD+HVGK + D VI   G+L   TRILVTH ++ L + D IIVM +G ++E G+Y DL+   GAFA F+ T+      A   QN                     +  ++ + + S   +    I ++  NL+  L    +    L  NK    +L+      ++K+  KL E + +K G VK+AV+  Y+++IG +L    I LF+     SL SN WL  W+D   +              N +Q+              + L +YG  GF Q +     S   +   I ++  LH  LL+ VLR PMS FE  P G ++NRFS +++ +   +P  I  F+ +    I   +++    P    II PL L+   Y  +QR YV+TSRQLKRLESV +SP+YSHF ETL G S IRA+    +FI+ +D KVD+N  +YY + VSNRWLAI LE VGN IV  A+LFAVIS    T ++ GLVGLSVSYAL +T  LNWLVRMSSE+E+NIV+VER++EY+ +  EA W + E  P+  WP  G I+F  Y  +YRE LD  LKNIN  I   EKVGIVGRTG+GKSSL L LFRI E + GEI+IDG  + ++GLHD+R R+TIIPQDPVLFSGTLR NLDPF+K+ D++IW  LE+++LK FV N   ++L    +EGGENLS+GQRQLVCLARALLR+T ILVLDEATAAVDL+TD LIQ TIR+EF++CT++TIAHRLNT++DY +++VL+ G+++E D+P+NLL+  +  F++MAK S L+
Sbjct:  188 DPNPCPESSASFLSQITFWWISRMMVQGFKRPLEAKDLWSLNKEDKSLEVVPVLSKNWEK--EYNKAKAKKVPLKMVYSPKKQTKKL-----------------NSKEDVREEAEALIVKPAPKELEPSLLKALYKTFGPYFFISCFFKFFHDVLMFSGPQLLQLLIKFVGDKDAPD-WHGYLYTFLLFFCACLQTLILHKYFHICFVTGMRLKTAVVGLVYRKALVINNSARRTSTIGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILAFYLLWQNLGPSVLAGIAVMVLLVPVNAVIAMKTKKYQVVQMKCKDNRIKLMNEILNGIKVLKLYAWELAFKEKVLGIRKDELKVLKKSAYLAAVGTFTWVCAPFLVALSTFAVYVLIDKQNVLDAEKAFVSLALFNILRFPLNMLPMVISSMVQASVSLKRLRVFLSHEELEPESIIREPQKSSEGSINMKDATFSW-SRNDLPSLKDINISIPEGSLVAVVGQVGCGKSSLLSALLGEMEKQDGYVAMKGSVGYVSQQAWIQNASLKDNVLFGRESNESMYKKVIEACALLPDLEILPTGDRTEIGEKGVNLSGGQKQRVSLARAVYCNTDIYLLDDPLSAVDAHVGKHIFDKVIGPKGMLKNKTRILVTHGVSYLPQMDSIIVMVDGKITEVGSYQDLLMQDGAFAEFLRTY------ANAEQN--------------------KDQEEAPSPVPSEEKRLENGILRNERNLQRQLSAS-SETKSLNQNK--TGDLN-----SSEKDDWKLTEADKAKTGRVKLAVFWEYMKAIGLFLCFLSIFLFMCNHVASLASNYWLSLWTDDKVV--------------NGTQQNT-----------TMRLSVYGALGFSQGIAVYGYSTAVSLGGILASRFLHTDLLHNVLRFPMSFFERTPSGNLVNRFSKEIDTIDNTIPQIIKMFMGSLFNVIGACVIILTATPIVAVIIPPLGLV---YFFVQRFYVATSRQLKRLESVSRSPVYSHFNETLLGSSVIRAFGEQKRFIQISDFKVDENQRAYYPSIVSNRWLAIRLEFVGNCIVLFASLFAVIS---RTTLSPGLVGLSVSYALQVTTYLNWLVRMSSELETNIVAVERVKEYADLKQEAAWTVQETAPEATWPHEGKIEFRGYGLRYREDLDLALKNINVTIQGGEKVGIVGRTGAGKSSLTLGLFRINEAAAGEIVIDGCNLAKIGLHDLRFRVTIIPQDPVLFSGTLRMNLDPFDKYTDDDIWTSLELAHLKRFVANL-PDRLNHECAEGGENLSIGQRQLVCLARALLRKTKILVLDEATAAVDLETDGLIQSTIRKEFQDCTVITIAHRLNTIMDYTKVIVLDKGQVVEFDSPSNLLQQ-QGIFFNMAKDSGLV 1501          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Xenopus
Match: ABCC1 (ATP binding cassette subfamily C member 1 [Source:HGNC Symbol;Acc:HGNC:51])

HSP 1 Score: 1216.06 bits (3145), Expect = 0.000e+0
Identity = 672/1395 (48.17%), Postives = 919/1395 (65.88%), Query Frame = 2
Query:  848 CPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSD-KMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXXX-XXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSHD--DTPGIAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSMENLKMDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWP-VGCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNLI 5017
            CPE  +SFLS+I F+W + ++V+G+K PL+ +DLW LN E++   +VP+L +N++K    NK +  K   KM+ + K  + K                  N+K  + + AE    K   ++ +P L+ AL K+  PY  +S  +K  HD+L F GP LL+LL++FV D +    W GY    L+   A ++T ILH+YFHI F  GMR++++++  VYRK+L ++ ++R+ ST+GEIVNLMS+DAQ+F++L +YI+MIWS P Q+I A  LLW  LGPSVLAG+ +M+L++PVNAVI   T+K Q  Q+K  D+RIK+MNEILNGIKVLKLYAWE +F   V  IR  ELK +K++AY  A  +FT+ CAPFLV+L+TF ++VLI + NVLDAEKAFVS+ LFNILRFPL MLPMVIS+++QASVSLKRL  FL  EE+  +++  +   T G +  +K+  F W S    P LK+INI+ PE  LVA+VG VGCGKSS+LSALLGE++K +GYV MKGS+ YV QQAWI NA+++DN++FG   +   Y+++I+AC L  D EIL   D TEIGEKG+NLSGGQKQRVSLARA Y ++++YLLDDPLSAVD+HVGK + D VI   G+L   TRILVTH ++ L + D IIVM +G ++E G+Y DL+   GAFA F+ T+      A   QN                     +  ++ + + S   +    I ++  NL+  L    +    L  NK    +L+      ++K+  KL E + +K G VK+AV+  Y+++IG +L    I LF+     SL SN WL  W+D   +              N +Q+              + L +YG  GF Q +     S   +   I ++  LH  LL+ VLR PMS FE  P G ++NRFS +++ +   +P  I  F+ +    I   +++    P + + +  +   Y  +QR YV+TSRQLKRLESV +SP+YSHF ETL G S IRA+    +FI+ +D KVD+N  +YY + VSNRWLAI LE VGN IV  A+LFAVIS    T ++ GLVGLSVSYAL +T  LNWLVRMSSE+E+NIV+VER++EY+ +  EA W + E  P+  WP  G I+F  Y  +YRE LD  LKNIN  I   EKVGIVGRTG+GKSSL L LFRI E + GEI+IDG  + ++GLHD+R R+TIIPQDPVLFSGTLR NLDPF+K+ D++IW  LE+++LK FV N   ++L    +EGGENLS+GQRQLVCLARALLR+T ILVLDEATAAVDL+TD LIQ TIR+EF++CT++TIAHRLNT++DY +++VL+ G+++E D+P+NLL+  +  F++MAK S L+
Sbjct:  167 CPESSASFLSQITFWWISRMMVQGFKRPLEAKDLWSLNKEDKSLEVVPVLSKNWEK--EYNKAKAKKVPLKMVYSPKKQTKKL-----------------NSKEDVREEAEALIVKPAPKELEPSLLKALYKTFGPYFFISCFFKFFHDVLMFSGPQLLQLLIKFVGDKDAPD-WHGYLYTFLLFFCACLQTLILHKYFHICFVTGMRLKTAVVGLVYRKALVINNSARRTSTIGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILAFYLLWQNLGPSVLAGIAVMVLLVPVNAVIAMKTKKYQVVQMKCKDNRIKLMNEILNGIKVLKLYAWELAFKEKVLGIRKDELKVLKKSAYLAAVGTFTWVCAPFLVALSTFAVYVLIDKQNVLDAEKAFVSLALFNILRFPLNMLPMVISSMVQASVSLKRLRVFLSHEELEPESIIREPQKTEG-SINMKDATFSW-SRNDLPSLKDINISIPEGSLVAVVGQVGCGKSSLLSALLGEMEKQDGYVAMKGSVGYVSQQAWIQNASLKDNVLFGRESNESMYKKVIEACALLPDLEILPTGDRTEIGEKGVNLSGGQKQRVSLARAVYCNTDIYLLDDPLSAVDAHVGKHIFDKVIGPKGMLKNKTRILVTHGVSYLPQMDSIIVMVDGKITEVGSYQDLLMQDGAFAEFLRTY------ANAEQN--------------------KDQEEAPSPVPSEEKRLENGILRNERNLQRQLSAS-SETKSLNQNK--TGDLN-----SSEKDDWKLTEADKAKTGRVKLAVFWEYMKAIGLFLCFLSIFLFMCNHVASLASNYWLSLWTDDKVV--------------NGTQQNT-----------TMRLSVYGALGFSQGIAVYGYSTAVSLGGILASRFLHTDLLHNVLRFPMSFFERTPSGNLVNRFSKEIDTIDNTIPQIIKMFMGSLFNVIGACVIILTATPIVAVIIPPLGLVYFFVQRFYVATSRQLKRLESVSRSPVYSHFNETLLGSSVIRAFGEQKRFIQISDFKVDENQRAYYPSIVSNRWLAIRLEFVGNCIVLFASLFAVIS---RTTLSPGLVGLSVSYALQVTTYLNWLVRMSSELETNIVAVERVKEYADLKQEAAWTVQETAPEATWPHEGKIEFRGYGLRYREDLDLALKNINVTIQGGEKVGIVGRTGAGKSSLTLGLFRINEAAAGEIVIDGCNLAKIGLHDLRFRVTIIPQDPVLFSGTLRMNLDPFDKYTDDDIWTSLELAHLKRFVANL-PDRLNHECAEGGENLSIGQRQLVCLARALLRKTKILVLDEATAAVDLETDGLIQSTIRKEFQDCTVITIAHRLNTIMDYTKVIVLDKGQVVEFDSPSNLLQQ-QGIFFNMAKDSGLV 1475          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Xenopus
Match: ABCC1 (ATP binding cassette subfamily C member 1 [Source:HGNC Symbol;Acc:HGNC:51])

HSP 1 Score: 1214.13 bits (3140), Expect = 0.000e+0
Identity = 673/1402 (48.00%), Postives = 917/1402 (65.41%), Query Frame = 2
Query:  836 DLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSD-KMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXXX-XXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSHDDTPGIAATI--KNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSMENLKMDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPW---IIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWP-VGCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNLI 5017
            D   CPE  +SFLS+I F+W + ++V+G+K PL+ +DLW LN E++   +VP+L +N++K    NK +  K   KM+ + K  + K                  N+K  + + AE    K   ++ +P L+ AL K+  PY  +S  +K  HD+L F GP LL+LL++FV D +    W GY    L+   A ++T ILH+YFHI F  GMR++++++  VYRK+L ++ ++R+ ST+GEIVNLMS+DAQ+F++L +YI+MIWS P Q+I A  LLW  LGPSVLAG+ +M+L++PVNAVI   T+K Q  Q+K  D+RIK+MNEILNGIKVLKLYAWE +F   V  IR  ELK +K++AY  A  +FT+ CAPFLV+L+TF ++VLI + NVLDAEKAFVS+ LFNILRFPL MLPMVIS+++QASVSLKRL  FL  EE+  +++  +       +I  K+  F W S    P LK+INI+ PE  LVA+VG VGCGKSS+LSALLGE++K +GYV MKGS+ YV QQAWI NA+++DN++FG   +   Y+++I+AC L  D EIL   D TEIGEKG+NLSGGQKQRVSLARA Y ++++YLLDDPLSAVD+HVGK + D VI   G+L   TRILVTH ++ L + D IIVM +G ++E G+Y DL+   GAFA F+ T+                                +E N+      S+  +SR  + +   +   +  +  A+      N+    +L+      ++K+  KL E + +K G VK+AV+  Y+++IG +L    I LF+     SL SN WL  W+D   +              N +Q+              + L +YG  GF Q +     S   +   I ++  LH  LL+ VLR PMS FE  P G ++NRFS +++ +   +P  I  F+ +    I   +++    P    II PL L+   Y  +QR YV+TSRQLKRLESV +SP+YSHF ETL G S IRA+    +FI+ +D KVD+N  +YY + VSNRWLAI LE VGN IV  A+LFAVIS    T ++ GLVGLSVSYAL +T  LNWLVRMSSE+E+NIV+VER++EY+ +  EA W + E  P+  WP  G I+F  Y  +YRE LD  LKNIN  I   EKVGIVGRTG+GKSSL L LFRI E + GEI+IDG  + ++GLHD+R R+TIIPQDPVLFSGTLR NLDPF+K+ D++IW  LE+++LK FV N   ++L    +EGGENLS+GQRQLVCLARALLR+T ILVLDEATAAVDL+TD LIQ TIR+EF++CT++TIAHRLNT++DY +++VL+ G+++E D+P+NLL+  +  F++MAK S L+
Sbjct:  198 DPNPCPESSASFLSQITFWWISRMMVQGFKRPLEAKDLWSLNKEDKSLEVVPVLSKNWEK--EYNKAKAKKVPLKMVYSPKKQTKKL-----------------NSKEDVREEAEALIVKPAPKELEPSLLKALYKTFGPYFFISCFFKFFHDVLMFSGPQLLQLLIKFVGDKDAPD-WHGYLYTFLLFFCACLQTLILHKYFHICFVTGMRLKTAVVGLVYRKALVINNSARRTSTIGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILAFYLLWQNLGPSVLAGIAVMVLLVPVNAVIAMKTKKYQVVQMKCKDNRIKLMNEILNGIKVLKLYAWELAFKEKVLGIRKDELKVLKKSAYLAAVGTFTWVCAPFLVALSTFAVYVLIDKQNVLDAEKAFVSLALFNILRFPLNMLPMVISSMVQASVSLKRLRVFLSHEELEPESIIREPQKSSEGSINMKDATFSW-SRNDLPSLKDINISIPEGSLVAVVGQVGCGKSSLLSALLGEMEKQDGYVAMKGSVGYVSQQAWIQNASLKDNVLFGRESNESMYKKVIEACALLPDLEILPTGDRTEIGEKGVNLSGGQKQRVSLARAVYCNTDIYLLDDPLSAVDAHVGKHIFDKVIGPKGMLKNKTRILVTHGVSYLPQMDSIIVMVDGKITEVGSYQDLLMQDGAFAEFLRTY------------------------------ANAEQNKDQEGKPSNQEESRLYLNRFHIHFLFNFRQLSASSETKSLNQNKTGDLN-----SSEKDDWKLTEADKAKTGRVKLAVFWEYMKAIGLFLCFLSIFLFMCNHVASLASNYWLSLWTDDKVV--------------NGTQQNT-----------TMRLSVYGALGFSQGIAVYGYSTAVSLGGILASRFLHTDLLHNVLRFPMSFFERTPSGNLVNRFSKEIDTIDNTIPQIIKMFMGSLFNVIGACVIILTATPIVAVIIPPLGLV---YFFVQRFYVATSRQLKRLESVSRSPVYSHFNETLLGSSVIRAFGEQKRFIQISDFKVDENQRAYYPSIVSNRWLAIRLEFVGNCIVLFASLFAVIS---RTTLSPGLVGLSVSYALQVTTYLNWLVRMSSELETNIVAVERVKEYADLKQEAAWTVQETAPEATWPHEGKIEFRGYGLRYREDLDLALKNINVTIQGGEKVGIVGRTGAGKSSLTLGLFRINEAAAGEIVIDGCNLAKIGLHDLRFRVTIIPQDPVLFSGTLRMNLDPFDKYTDDDIWTSLELAHLKRFVANL-PDRLNHECAEGGENLSIGQRQLVCLARALLRKTKILVLDEATAAVDLETDGLIQSTIRKEFQDCTVITIAHRLNTIMDYTKVIVLDKGQVVEFDSPSNLLQQ-QGIFFNMAKDSGLV 1510          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Xenopus
Match: ABCC1 (ATP binding cassette subfamily C member 1 [Source:HGNC Symbol;Acc:HGNC:51])

HSP 1 Score: 1212.59 bits (3136), Expect = 0.000e+0
Identity = 683/1408 (48.51%), Postives = 920/1408 (65.34%), Query Frame = 2
Query:  836 DLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSD-KMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXXX-XXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSHDDTPGIAATI--KNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHL-----ADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSM-ENLKMDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPW---IIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWP-VGCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNLI 5017
            D   CPE  +SFLS+I F+W + ++V+G+K PL+ +DLW LN E++   +VP+L +N++K    NK +  K   KM+ + K  + K                  N+K  + + AE    K   ++ +P L+ AL K+  PY  +S  +K  HD+L F GP LL+LL++FV D +    W GY    L+   A ++T ILH+YFHI F  GMR++++++  VYRK+L ++ ++R+ ST+GEIVNLMS+DAQ+F++L +YI+MIWS P Q+I A  LLW  LGPSVLAG+ +M+L++PVNAVI   T+K Q  Q+K  D+RIK+MNEILNGIKVLKLYAWE +F   V  IR  ELK +K++AY  A  +FT+ CAPFLV+L+TF ++VLI + NVLDAEKAFVS+ LFNILRFPL MLPMVIS+++QASVSLKRL  FL  EE+  +++  +       +I  K+  F W S    P LK+INI+ PE  LVA+VG VGCGKSS+LSALLGE++K +GYV MKGS+ YV QQAWI NA+++DN++FG   +   Y+++I+AC L  D EIL   D TEIGEKG+NLSGGQKQRVSLARA Y ++++YLLDDPLSAVD+HVGK + D VI   G+L   TRILVTH ++ L + D IIVM +G ++E G+Y DL+   GAFA F+ T+       D+    +NQ  S   L    LL   +   Y    Q+       LS S E   KS+ +N   DL                           ++K+  KL E + +K G VK+AV+  Y+++IG +L    I LF+     SL SN WL  W+D   +              N +Q+              + L +YG  GF Q +     S   +   I ++  LH  LL+ VLR PMS FE  P G ++NRFS +++ +   +P  I  F+ +    I   +++    P    II PL L+   Y  +QR YV+TSRQLKRLESV +SP+YSHF ETL G S IRA+    +FI+ +D KVD+N  +YY + VSNRWLAI LE VGN IV  A+LFAVIS    T ++ GLVGLSVSYAL +T  LNWLVRMSSE+E+NIV+VER++EY+ +  EA W + E  P+  WP  G I+F  Y  +YRE LD  LKNIN  I   EKVGIVGRTG+GKSSL L LFRI E + GEI+IDG  + ++GLHD+R R+TIIPQDPVLFSGTLR NLDPF+K+ D++IW  LE+++LK FV N   ++L    +EGGENLS+GQRQLVCLARALLR+T ILVLDEATAAVDL+TD LIQ TIR+EF++CT++TIAHRLNT++DY +++VL+ G+++E D+P+NLL+  +  F++MAK S L+
Sbjct:  176 DPNPCPESSASFLSQITFWWISRMMVQGFKRPLEAKDLWSLNKEDKSLEVVPVLSKNWEK--EYNKAKAKKVPLKMVYSPKKQTKKL-----------------NSKEDVREEAEALIVKPAPKELEPSLLKALYKTFGPYFFISCFFKFFHDVLMFSGPQLLQLLIKFVGDKDAPD-WHGYLYTFLLFFCACLQTLILHKYFHICFVTGMRLKTAVVGLVYRKALVINNSARRTSTIGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILAFYLLWQNLGPSVLAGIAVMVLLVPVNAVIAMKTKKYQVVQMKCKDNRIKLMNEILNGIKVLKLYAWELAFKEKVLGIRKDELKVLKKSAYLAAVGTFTWVCAPFLVALSTFAVYVLIDKQNVLDAEKAFVSLALFNILRFPLNMLPMVISSMVQASVSLKRLRVFLSHEELEPESIIREPQKSSEGSINMKDATFSW-SRNDLPSLKDINISIPEGSLVAVVGQVGCGKSSLLSALLGEMEKQDGYVAMKGSVGYVSQQAWIQNASLKDNVLFGRESNESMYKKVIEACALLPDLEILPTGDRTEIGEKGVNLSGGQKQRVSLARAVYCNTDIYLLDDPLSAVDAHVGKHIFDKVIGPKGMLKNKTRILVTHGVSYLPQMDSIIVMVDGKITEVGSYQDLLMQDGAFAEFLRTYANAEQNKDQEGKPSNQEESRLYLNALYLLCVTVYYVY--FPQAYNTGPRQLSASSET--KSLNQNKTGDLN-------------------------SSEKDDWKLTEADKAKTGRVKLAVFWEYMKAIGLFLCFLSIFLFMCNHVASLASNYWLSLWTDDKVV--------------NGTQQNT-----------TMRLSVYGALGFSQGIAVYGYSTAVSLGGILASRFLHTDLLHNVLRFPMSFFERTPSGNLVNRFSKEIDTIDNTIPQIIKMFMGSLFNVIGACVIILTATPIVAVIIPPLGLV---YFFVQRFYVATSRQLKRLESVSRSPVYSHFNETLLGSSVIRAFGEQKRFIQISDFKVDENQRAYYPSIVSNRWLAIRLEFVGNCIVLFASLFAVIS---RTTLSPGLVGLSVSYALQVTTYLNWLVRMSSELETNIVAVERVKEYADLKQEAAWTVQETAPEATWPHEGKIEFRGYGLRYREDLDLALKNINVTIQGGEKVGIVGRTGAGKSSLTLGLFRINEAAAGEIVIDGCNLAKIGLHDLRFRVTIIPQDPVLFSGTLRMNLDPFDKYTDDDIWTSLELAHLKRFVANL-PDRLNHECAEGGENLSIGQRQLVCLARALLRKTKILVLDEATAAVDLETDGLIQSTIRKEFQDCTVITIAHRLNTIMDYTKVIVLDKGQVVEFDSPSNLLQQ-QGIFFNMAKDSGLV 1500          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Mouse
Match: Abcc1 (ATP-binding cassette, sub-family C (CFTR/MRP), member 1 [Source:MGI Symbol;Acc:MGI:102676])

HSP 1 Score: 1273.46 bits (3294), Expect = 0.000e+0
Identity = 724/1650 (43.88%), Postives = 1009/1650 (61.15%), Query Frame = 2
Query:  140 DWASEWNSPSPDIPTCFQFFDAPIYLLGYLILCFP-YIIHLIRKKVNERPFFKLTII---KLALIVCLMVLQILEIIYNAAKKNN----IPYAYTISNCSFLVCMSILAIMVGLERRCNAVNSGFYFNYWLLHFILCAVRARASGLSLKLKITNRDYSRECFIFINLTFVTLSLVLSCFSEKVSQSEIERLNKKRKFQNVLHVNADDNHVSDRMEMSPNAVDSYKTTEKDILINKTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNN-SGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXXXXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAV---SHDDTPGIAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSMEN-------LKMDLEKDVANITKLE-DNKRCQEELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFIN---GFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWP-VGCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNLI 5017
            DW   W++ +PD   CFQ          YL  CFP Y  +L R   ++R + ++T +   K AL   L ++   ++ Y+  +++      P    +S     + M +   ++ LERR    +SG    +WL+  +      R+  +S   K  + D  R+   ++  T V + LVLSCFS           +    F   +H                                      D   CPE  +SFLSRI F+W T ++V GY+ PL++ DLW LN E+    +VP+L+ N+ K    ++++  +       D +   G    ++ E  +  +   P  ++                  +P L   L K+  PY L+S LYK +HD++ F GP +L+L++ FV+D E    W+GYF  AL+ +SA ++T  LHQYFHI F  GMR++++++ AVYRK+L ++ A+RK STVGEIVNLMS+DAQ+F++L +YI+MIWS P Q+I AL  LW  LGPSVLAG+ +M+LM+P+NAV+   T+  Q   +K  D+RIK+MNEILNGIKVLKLYAWE +F + V  IR +ELK +K++AY  A  +FT+ C PFLV+L+TF +FV +   N+LDA+KAFVS+ LFNILRFPL +LPMVIS+++QASVSLKRL  FL  EE+  D++   S     G + T+KN  F W    P P L  I  + PE  LVA+VG VGCGKSS+LSALL E+DK+EG+V +KGS+AYVPQQAWI N ++R+NI+FG P     Y+ +++AC L  D EIL   D TEIGEKG+NLSGGQKQRVSLARA YS+S++YL DDPLSAVD+HVGK + + V+   G+L   TRILVTH ++ L + D IIVM+ G +SE G+Y +L+   GAFA F+                                RTY+   Q  A+   S+S S ++  K +EN       +   L++ ++N +    D  +    + +  K GA++   KL+E + ++ G V+++VY  Y+++IG ++    I LF+     +L SN WL  W+D   +              N +Q             R+  L +YG  G  Q       S+  +   I ++  LH  LL  VLR PMS FE  P G ++NRFS +L+ V +M+P  I    G L + + A+++ ++ T     II PL L+   Y  +QR YV++SRQLKRLESV +SP+YSHF ETL GVS IRA+   ++FI  +D KVD+N  +YY + V+NRWLA+ LE VGN IV  AALFAVIS  +   ++AGLVGLSVSY+L IT  LNWLVRMSSE+E+NIV+VER++EYS+   EAPW I E  P   WP  G ++F +Y  +YRE LD VLK+IN  I   EKVGIVGRTG+GKSSL L LFRI E ++GEI+IDG+ I ++GLH++R ++TIIPQDPVLFSG+LR NLDPF+++ DEE+W  LE+++LK F V++  ++L    +EGGENLSVGQRQLVCLARALLR+T ILVLDEATAAVDL+TD LIQ TIR +F++CT+LTIAHRLNT++DY +++VL+ GE+ E  AP+ LL+     FYSMAK + L+
Sbjct:   17 DWNVTWHTSNPDFTKCFQNTVLTWVPCFYLWSCFPLYFFYLSR---HDRGYIQMTHLNKTKTALGFFLWIICWADLFYSFWERSQGVLRAP-VLLVSPTLLGITMLLATFLIQLERRKGVQSSGIMLTFWLVALLCALAILRSKIISALKKDAHVDVFRDSTFYLYFTLVLVQLVLSCFS-----------DCSPLFSETVH--------------------------------------DRNPCPESSASFLSRITFWWITGMMVHGYRQPLESSDLWSLNKEDTSEEVVPVLVNNWKKECDKSRKQPVRIVYAPPKDPSKPKGSSQLDVNEEVEALIVKSPHKDR------------------EPSLFKVLYKTFGPYFLMSFLYKALHDLMMFAGPKILELIINFVNDREAPD-WQGYFYTALLFVSACLQTLALHQYFHICFVSGMRIKTAVVGAVYRKALLITNAARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYFLWLSLGPSVLAGVAVMILMVPLNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFQDKVMSIRQEELKVLKKSAYLAAVGTFTWVCTPFLVALSTFAVFVTVDERNILDAKKAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRSIKSGEGNSITVKNATFTWARGEP-PTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVTLKGSVAYVPQQAWIQNDSLRENILFGHPLQENYYKAVMEACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNSDIYLFDDPLSAVDAHVGKHIFEKVVGPMGLLKNKTRILVTHGISYLPQVDVIIVMSGGKISEMGSYQELLDRDGAFAEFL--------------------------------RTYANAEQDLASEDDSVSGSGKE-SKPVENGMLVTDTVGKHLQRHLSNSSSHSGDTSQQHSSIAELQKAGAKEETWKLMEADKAQTGQVQLSVYWNYMKAIGLFITFLSIFLFLCNHVSALASNYWLSLWTDDPPVV-------------NGTQA-----------NRNFRLSVYGALGILQGAAIFGYSMAVSIGGIFASRRLHLDLLYNVLRSPMSFFERTPSGNLVNRFSKELDTVDSMIPQVIKMFMGSLFSVIGAVIIILLATPIAAVIIPPLGLV---YFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHS---LSAGLVGLSVSYSLQITAYLNWLVRMSSEMETNIVAVERLKEYSETEKEAPWQIQETAPPSTWPHSGRVEFRDYCLRYREDLDLVLKHINVTIEGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGVNIAKIGLHNLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWMALELAHLKGF-VSALPDKLNHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDNLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVLDKGEVRECGAPSELLQQ-RGIFYSMAKDAGLV 1528          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Mouse
Match: Abcc3 (ATP-binding cassette, sub-family C (CFTR/MRP), member 3 [Source:MGI Symbol;Acc:MGI:1923658])

HSP 1 Score: 1182.16 bits (3057), Expect = 0.000e+0
Identity = 661/1537 (43.01%), Postives = 943/1537 (61.35%), Query Frame = 2
Query:  422 VCMSILAIMVGLERRCNAVNSGFYFNYWLLHFILCAVRARASGLSLKLKITNRDYSRECFIFINLTFVTLSLVLSCFSEKVSQSEIERLNKKRKFQNVLHVNADDNHVSDRMEMSPNAVDSYKTTEKDILINKTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXXXXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSHDD-TPGIAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSMENLKMDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLP----HFINGFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWPV-GCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNL 5014
            + M +  +++  ER     +SG    +WLL  I   +  R+  LS   +    D  R    +I    V  +L+LSCF EK                                  SP                    N+D   CPE  + F SR+ F+WFT L + GY+ PL++ DLW L+ E+    +V  LL  + K     ++  +   +  T +    G+            L  P   +K+                  P  + AL+++    LL+S  + +I ++L F+ P LL +L++F+SD     +W G+ +A LM +S+ ++T ILHQY+H +F + +R+R+++I  +YRK+L ++ + ++ESTVGE+VNLMS+DAQ+F+++  +I+++WS P Q+I A+  LW  LGPS LAG+ +++L+IP+N  +    +  Q +Q+K  DSRIK+M+EILNGIKVLKLYAWEPSF+  V  IR  EL+ +++ AY  A  +F + C PFLV+L T G++V +   NVLDAEKAFVS++LFNIL+ PL MLP +IS L QASVSLKR+  FL + E++   V     +PG A TI NG F W    P P L ++NI  P+  LVA+VGPVGCGKSS++SALLGE++KLEG V++KGS+AYVPQQAWI N T+++N++FG P +  +YQ+ ++ C L  D ++L   D TEIGEKGINLSGGQ+QRVSLARA YSD+N++LLDDPLSAVDSHV K + D VI   G+L G TR+LVTH ++ L + D IIV+  G VSE G YS L++H G+FANF+  +  DE Q   +   +     E+ LLL+D   T++++  +      ++ + R++  + M +L    E +V N T     K+    L+K       K    LI+EE ++ GNVK++VY  Y +S+G      I LL+      ++G+N+WL  WS+ ++              H    K              + LG+Y   G  Q L+ + S+       I++A  LH+ LL+  +R P S F+T P GRI+NRFS D+  +  +L       +N F  T++  I+V +  T     +++PL+++  F   +QR YV+TSRQLKRLES+ +SPI+SHF ET+ G S IRAY     F   +D KVD N  S Y    SNRWL + +E VGN +V  AALFAVI   +   +N GLVGLSVSYAL +T  LNW++RM S++ESNI++VER++EYS+   EAPW +   +  E WP  G ++F NYS +YR GL+ VLKN+   +   EKVGIVGRTG+GKSS+ L LFRILE ++GEI+IDGL +  +GLHD+R +LTIIPQDP+LFSGTLR NLDPF ++ +E+IW+ LE+S+L TF V+S    L+   +EGG+NLSVGQRQLVCLARALLR++ +LVLDEATAA+DL+TD LIQ TIR +F++CT+LTIAHRLNT++DY+++LVL+ G + E D+P NL+      FY MAK + L
Sbjct:  114 ITMLLATLLIQYERLRGVQSSGVLIIFWLLCVICAIIPFRSKILSALAEGKILDPFRFTTFYIYFALVFCALILSCFKEKPPL------------------------------FSPE-------------------NLDTNPCPEASAGFFSRLSFWWFTRLAILGYRRPLEDRDLWSLSEEDCSHKVVQRLLEAWQK-----QQNQASRSQTATAEPKIPGEDAV---------LLKPRPKSKQ------------------PSFLRALVRTFTSSLLMSACFNLIQNLLGFVNPQLLSILIRFISDPTAPTWW-GFLLAGLMFLSSTMQTLILHQYYHCIFVMALRLRTAIIGVIYRKALVITNSVKRESTVGEMVNLMSVDAQRFMDVSPFINLLWSAPLQVILAIYFLWQILGPSALAGVAVIVLLIPLNGAVSMKMKTYQVKQMKFKDSRIKLMSEILNGIKVLKLYAWEPSFLEQVKGIRQSELQLLRKGAYLQAISTFIWICTPFLVTLITLGVYVYVDESNVLDAEKAFVSLSLFNILKIPLNMLPQLISGLTQASVSLKRIQDFLNQNELDPQCVERKTISPGYAITIHNGTFTWAQDLP-PTLHSLNIQIPKGALVAVVGPVGCGKSSLVSALLGEMEKLEGVVSVKGSVAYVPQQAWIQNCTLQENVLFGQPMNPKRYQQALETCALLADLDVLPGGDQTEIGEKGINLSGGQRQRVSLARAVYSDANIFLLDDPLSAVDSHVAKHIFDQVIGPEGVLAGKTRVLVTHGISFLPQTDFIIVLAGGQVSEMGHYSALLQHDGSFANFLRNYAPDEDQ--EDHEAALQNANEEVLLLEDTLSTHTDLTDNEP----AIYEVRKQFMREMSSLSS--EGEVQNRTM---PKKHTNSLEKEALVTKTKETGALIKEEIAETGNVKLSVYWDYAKSMGLCTTLSICLLYGGQSAAAIGANVWLSAWSNDAE-------------EHGQQNKT------------SVRLGVYAALGILQGLLVMLSAFTMVVGAIQAARLLHEALLHNKIRSPQSFFDTTPSGRILNRFSKDIYVIDEVLAPTILMLLNSFF-TSISTIMVIVASTPLFMVVVLPLAVLYGF---VQRFYVATSRQLKRLESISRSPIFSHFSETVTGTSVIRAYGRIQDFKVLSDTKVDNNQKSSYPYIASNRWLGVHVEFVGNCVVLFAALFAVIGRNS---LNPGLVGLSVSYALQVTMALNWMIRMISDLESNIIAVERVKEYSKTKTEAPWVVESNRAPEGWPTRGMVEFRNYSVRYRPGLELVLKNVTVHVQGGEKVGIVGRTGAGKSSMTLCLFRILEAAEGEIVIDGLNVAHIGLHDLRSQLTIIPQDPILFSGTLRMNLDPFGRYSEEDIWRALELSHLNTF-VSSQPAGLDFQCAEGGDNLSVGQRQLVCLARALLRKSRVLVLDEATAAIDLETDDLIQGTIRTQFEDCTVLTIAHRLNTIMDYNRVLVLDKGVVAEFDSPVNLIA-AGGIFYGMAKDAGL 1522          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Mouse
Match: Abcc3 (ATP-binding cassette, sub-family C (CFTR/MRP), member 3 [Source:MGI Symbol;Acc:MGI:1923658])

HSP 1 Score: 1181.39 bits (3055), Expect = 0.000e+0
Identity = 661/1537 (43.01%), Postives = 943/1537 (61.35%), Query Frame = 2
Query:  422 VCMSILAIMVGLERRCNAVNSGFYFNYWLLHFILCAVRARASGLSLKLKITNRDYSRECFIFINLTFVTLSLVLSCFSEKVSQSEIERLNKKRKFQNVLHVNADDNHVSDRMEMSPNAVDSYKTTEKDILINKTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXXXXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSHDD-TPGIAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSMENLKMDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLP----HFINGFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWPV-GCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNL 5014
            + M +  +++  ER     +SG    +WLL  I   +  R+  LS   +    D  R    +I    V  +L+LSCF EK                                  SP                    N+D   CPE  + F SR+ F+WFT L + GY+ PL++ DLW L+ E+    +V  LL  + K     ++  +   +  T +    G+            L  P   +K+                  P  + AL+++    LL+S  + +I ++L F+ P LL +L++F+SD     +W G+ +A LM +S+ ++T ILHQY+H +F + +R+R+++I  +YRK+L ++ + ++ESTVGE+VNLMS+DAQ+F+++  +I+++WS P Q+I A+  LW  LGPS LAG+ +++L+IP+N  +    +  Q +Q+K  DSRIK+M+EILNGIKVLKLYAWEPSF+  V  IR  EL+ +++ AY  A  +F + C PFLV+L T G++V +   NVLDAEKAFVS++LFNIL+ PL MLP +IS L QASVSLKR+  FL + E++   V     +PG A TI NG F W    P P L ++NI  P+  LVA+VGPVGCGKSS++SALLGE++KLEG V++KGS+AYVPQQAWI N T+++N++FG P +  +YQ+ ++ C L  D ++L   D TEIGEKGINLSGGQ+QRVSLARA YSD+N++LLDDPLSAVDSHV K + D VI   G+L G TR+LVTH ++ L + D IIV+  G VSE G YS L++H G+FANF+  +  DE Q  +    +     E+ LLL+D   T++++  +      ++ + R++  + M +L    E +V N T     K+    L+K       K    LI+EE ++ GNVK++VY  Y +S+G      I LL+      ++G+N+WL  WS+ ++              H    K              + LG+Y   G  Q L+ + S+       I++A  LH+ LL+  +R P S F+T P GRI+NRFS D+  +  +L       +N F  T++  I+V +  T     +++PL+++  F   +QR YV+TSRQLKRLES+ +SPI+SHF ET+ G S IRAY     F   +D KVD N  S Y    SNRWL + +E VGN +V  AALFAVI   +   +N GLVGLSVSYAL +T  LNW++RM S++ESNI++VER++EYS+   EAPW +   +  E WP  G ++F NYS +YR GL+ VLKN+   +   EKVGIVGRTG+GKSS+ L LFRILE ++GEI+IDGL +  +GLHD+R +LTIIPQDP+LFSGTLR NLDPF ++ +E+IW+ LE+S+L TF V+S    L+   +EGG+NLSVGQRQLVCLARALLR++ +LVLDEATAA+DL+TD LIQ TIR +F++CT+LTIAHRLNT++DY+++LVL+ G + E D+P NL+      FY MAK + L
Sbjct:  114 ITMLLATLLIQYERLRGVQSSGVLIIFWLLCVICAIIPFRSKILSALAEGKILDPFRFTTFYIYFALVFCALILSCFKEKPPL------------------------------FSPE-------------------NLDTNPCPEASAGFFSRLSFWWFTRLAILGYRRPLEDRDLWSLSEEDCSHKVVQRLLEAWQK-----QQNQASRSQTATAEPKIPGEDAV---------LLKPRPKSKQ------------------PSFLRALVRTFTSSLLMSACFNLIQNLLGFVNPQLLSILIRFISDPTAPTWW-GFLLAGLMFLSSTMQTLILHQYYHCIFVMALRLRTAIIGVIYRKALVITNSVKRESTVGEMVNLMSVDAQRFMDVSPFINLLWSAPLQVILAIYFLWQILGPSALAGVAVIVLLIPLNGAVSMKMKTYQVKQMKFKDSRIKLMSEILNGIKVLKLYAWEPSFLEQVKGIRQSELQLLRKGAYLQAISTFIWICTPFLVTLITLGVYVYVDESNVLDAEKAFVSLSLFNILKIPLNMLPQLISGLTQASVSLKRIQDFLNQNELDPQCVERKTISPGYAITIHNGTFTWAQDLP-PTLHSLNIQIPKGALVAVVGPVGCGKSSLVSALLGEMEKLEGVVSVKGSVAYVPQQAWIQNCTLQENVLFGQPMNPKRYQQALETCALLADLDVLPGGDQTEIGEKGINLSGGQRQRVSLARAVYSDANIFLLDDPLSAVDSHVAKHIFDQVIGPEGVLAGKTRVLVTHGISFLPQTDFIIVLAGGQVSEMGHYSALLQHDGSFANFLRNYAPDEDQEDHE---ALQNANEEVLLLEDTLSTHTDLTDNEP----AIYEVRKQFMREMSSLSS--EGEVQNRTM---PKKHTNSLEKEALVTKTKETGALIKEEIAETGNVKLSVYWDYAKSMGLCTTLSICLLYGGQSAAAIGANVWLSAWSNDAE-------------EHGQQNKT------------SVRLGVYAALGILQGLLVMLSAFTMVVGAIQAARLLHEALLHNKIRSPQSFFDTTPSGRILNRFSKDIYVIDEVLAPTILMLLNSFF-TSISTIMVIVASTPLFMVVVLPLAVLYGF---VQRFYVATSRQLKRLESISRSPIFSHFSETVTGTSVIRAYGRIQDFKVLSDTKVDNNQKSSYPYIASNRWLGVHVEFVGNCVVLFAALFAVIGRNS---LNPGLVGLSVSYALQVTMALNWMIRMISDLESNIIAVERVKEYSKTKTEAPWVVESNRAPEGWPTRGMVEFRNYSVRYRPGLELVLKNVTVHVQGGEKVGIVGRTGAGKSSMTLCLFRILEAAEGEIVIDGLNVAHIGLHDLRSQLTIIPQDPILFSGTLRMNLDPFGRYSEEDIWRALELSHLNTF-VSSQPAGLDFQCAEGGDNLSVGQRQLVCLARALLRKSRVLVLDEATAAIDLETDDLIQGTIRTQFEDCTVLTIAHRLNTIMDYNRVLVLDKGVVAEFDSPVNLIA-AGGIFYGMAKDAGL 1521          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Mouse
Match: Abcc2 (ATP-binding cassette, sub-family C (CFTR/MRP), member 2 [Source:MGI Symbol;Acc:MGI:1352447])

HSP 1 Score: 1085.86 bits (2807), Expect = 0.000e+0
Identity = 674/1653 (40.77%), Postives = 964/1653 (58.32%), Query Frame = 2
Query:  113 NKTCYNMSTDWASEWNSPSPDIPTCFQFFDAPIYLLGYLILCFPYIIHLI-RKKVNERPFFKLTIIKLALIVCLMVLQI----LEIIYNAAKKNNIPYAYTISNCSFLVCMSILAIMVGLERRCNAVNSGFYFNYWLLHFILCAVRARASGLSLKLKITNRDYSRECFIFINLTFVTLSLVLSCFSEKVSQSEIERLNKKRKFQNVLHVNADDNHVSDRMEMSPNAVDSYKTTEKDILINKTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVP----ILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXXXXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSHDDTPGIAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIAT---HLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSMENLKMDLEKDVANITKLED----NKRCQEELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWP-VGCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMV--ISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNL 5014
            N T +N+S        SP  D+P CF+        LG+L L  P+ ++ I R +       K  + K   +VCL++L      L +  +  +    P  YT                          N   Y   WLL  ++                    + R+C I  N  F+++  +LS             L    +FQ ++     D+     M  S     SY      ++++    + D    P   +SFLS + F W+   ++KGYK PL  ED+W +    +  S+      I+ ++  K     +RR  KS +  + +  + G   K+ +  +   L    D+ K+     A  D           L+ AL K+ +  +L S + K+ HDIL FL P LLK L+ FV D +  + W GY  A LM    ++++F L  YF   F +GM VR+++I++VY+K+L LS  +R++ T+GE VNLMS+D+QK +++ +YIH++WS   QI  ++  LW ELGPS+LAG+ +M+L++PVN V+    RKIQ Q +K  D R+K+MNEIL+GIK+LK +AWEPSF   V  IR KEL+ + R +     + F  +  P LVS+ TF ++VL+   NVL+AEKAF SITLFNILRFPL MLPMVIS++IQASVS+ RL  +L  ++++  A+ H      A       F WD    E  ++++N+      LVA+VG VG GKSS++SA+LGE++ + G++ +KGSIAYVPQQAWI N TI+DNI+FG  YD  KYQR+I+AC L  D E+L   D  EIGEKGINLSGGQK RVSLARA Y D+++Y+LDDPLSAVD+HVGK + + V+   G+L+G TRILVTH +  L + D I+V+  G + E+G+YSDL+   G FA    T   H   E +AT + +       E++     L  T  EI    A++      S  +             K + +  K++     NK+  EE+ K         G KLI++E  + G VK ++Y+ YL+++G+W    I++ +V      +G+NLWL  W+  S+         K+    NS              QRD+ +G++G  G  Q +  L SSL+  +A   ++ +LH+ LL  +LR PMS F+T P GRI+NRF+ D++ V   LP  +  +L+     +   +M+ +  P  II +  +   Y+ +Q  YV+TSRQL+RL+SV KSPIYSHF ET+ G+  IRA+    +F+ +++ ++D N    ++   SNRWLAI LE VGN IVF +AL  VI   + TG   G V   +S AL+ITQTLNWLVRM+SEVE+NIV+VERI EY  +  EAPW +++KKP  +WP  G I+F NY  +YR  LD VLK I   I   EKVG+VGRTG+GKSSL   LFRILE + G+I+IDG+ I  +GLHD+RGRLTIIPQDP+LFSG LR NLDPFNK+ DEEIW+ LE+++LK+FV      QL ++  ++EGG+NLS+GQRQL+CL RA+LR++ ILVLDEATAAVDL+TD LIQ TIR EF +CT++TIAHRL+T++D D+I+VL++G+I+E  +P  LL N    FY MAK + +
Sbjct:    6 NSTFWNLSL-----LKSPEADLPLCFEQTVLVWIPLGFLWLLAPWQLYRIYRSRTKRFAITKFYLAKQVFVVCLLILAAIDLSLALTEDTGQATIPPVKYT--------------------------NPILYLCTWLLVLVI-------------------QHCRQCCIQKNSWFLSMFWILSL------------LCGIFQFQTLIRALLQDS--KSNMTYSCLFFVSYGFQIVILILSAFSESSDSTHAPSATASFLSSVTFSWYDSTVLKGYKHPLTIEDVWDIEENLKAKSLTSKFKTIMTKDLQKARQALQRRLKKSQQ--SPEGTSHGLTKKQSQSQDVLVL---EDSKKKKKKSEATKDFP------KSWLVKALFKTFYVVILKSFILKLAHDILLFLNPQLLKFLIGFVKDPDS-YPWVGYIYAILMFSVTLIQSFFLQCYFQFCFVLGMTVRTTIIASVYKKALTLSNLARRQYTIGETVNLMSVDSQKLMDVTNYIHLLWSSVLQIALSIFFLWRELGPSILAGVGLMVLLVPVNGVLATKIRKIQVQNMKNKDKRLKIMNEILSGIKILKYFAWEPSFKEQVNSIRKKELRNLLRFSQLQTILIFILHLTPTLVSVITFSVYVLVDSQNVLNAEKAFTSITLFNILRFPLAMLPMVISSVIQASVSVDRLEQYLGSDDLDLSAIRHVCHFDKAVQFSEASFTWDRDL-EATIQDVNLDIKPGQLVAVVGTVGSGKSSLISAMLGEMENVHGHITIKGSIAYVPQQAWIQNGTIKDNILFGSEYDEKKYQRVIEACALLPDLEMLPGGDMAEIGEKGINLSGGQKHRVSLARATYQDADIYILDDPLSAVDTHVGKHIFNKVVGPNGLLSGKTRILVTHGIHFLPQVDEIVVLGKGTILEKGSYSDLMDKKGVFAKNWKTFMKHSGPEGEATVDND------SEEEDGDCGLIPTVEEIPDDAASLTMRRENSLRRTLSRSSRSGSRRGKSLKSSLKIKSVNALNKK--EEVVK---------GQKLIKKEFVETGKVKFSIYLKYLQAVGWWSLLFIVIFYVLNYVAFIGTNLWLSAWTSDSE---------KQNGTDNSP------------SQRDMRIGVFGALGIAQGIFLLSSSLWSIYACRNASKTLHRQLLTNILRAPMSFFDTTPTGRIVNRFAGDISTVDDTLPQTLRSWLLCFFGIVSTLVMICMATPIFIIIIIPLSILYVSVQVFYVATSRQLRRLDSVTKSPIYSHFSETVSGLPVIRAFEHQQRFLANSEKQIDTNQKCVFSWITSNRWLAIRLELVGNLIVFCSALLLVIYKNSLTGDTVGFV---LSNALNITQTLNWLVRMTSEVETNIVAVERINEYINVDNEAPW-VTDKKPPADWPKKGEIQFNNYQVRYRPELDLVLKGITCNIKSTEKVGVVGRTGAGKSSLTNCLFRILESAGGQIIIDGIDIASIGLHDLRGRLTIIPQDPILFSGNLRMNLDPFNKYSDEEIWRALELAHLKSFV---AGLQLGLLHEVTEGGDNLSIGQRQLLCLGRAVLRKSKILVLDEATAAVDLETDSLIQTTIRNEFSQCTVITIAHRLHTIMDSDKIMVLDSGKIVEYGSPEELLSN-MGPFYLMAKEAGI 1535          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Mouse
Match: Abcc6 (ATP-binding cassette, sub-family C (CFTR/MRP), member 6 [Source:MGI Symbol;Acc:MGI:1351634])

HSP 1 Score: 778.859 bits (2010), Expect = 0.000e+0
Identity = 493/1398 (35.26%), Postives = 753/1398 (53.86%), Query Frame = 2
Query:  839 LKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXXXXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSHDDTPGIAA---TIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFI--ATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSMENLKMDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWPVGC-IKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNL 5014
            L  CPE  +SF S+ +F+W + L+ +GYK  L  +DLW L  E     +V  L R +            +S   L   K +S                  P+      P+ ++             L+ A+ +      LL  L  +I D   F  P LL L L+F+ D      W G+ +A LM  +A ++T    Q+ +    + MR+R+++   VYRK L LS+ SRK S  G++VNL+S+D Q+  E I Y++ +W     I    + LW  LGPS L  + + L ++P+N  I       Q +Q++   SR ++ + +L  ++ +K + WE +F+  +  IR +EL  +K +    +    +F  + FLV+L  F +  L++ DN +DAEKAFV++T+ +IL      LP  +  ++QA VS  RL  FL  EE++ + +   ++   +    ++ NG F W   +P P L  IN+T P+  L+A+VGPVG GKSS+LSALLGE+ K+EG V+++GS+AYVPQ+AW+ N ++ +N+ F    D    Q+++ AC L  D         T IGE+G+NLSGGQKQR+SLARA Y  + +YLLDDPL+A+D+HV + +   VI  +G+L G TRILVTH L +L + DRI+V+ NG ++E G+Y DL++  GA    +  A   A    A  + +        +     D  R       + A  +   S S  ++  S+++       +   +T  ED+ R                            G VK  +Y++YLR++G  L    + LF+  Q  S     WL  W+D   +                      D R++    R     ++G+ G  QA+    S         +++  L + LL  V R P+  FE  PVG ++NRFS + + V   +P  +   L      + V + VT+  P  I+ +  ++  Y   Q +YV+TS QL+RLES   S + SH  ET QG   +RA+     F   +D  +D+N    +   V++RWLA  LE +GN +VF+AA  AV+S  +   ++AGLVG SVS AL +TQTL W+VR  +++E+++V+VER+++Y+++P EAPW +        WP G  I+F ++  ++R  L   ++ ++  I+  EKVGIVGRTG+GKSSL   L R+ E ++G I IDG+PI  +GLH +R R+TIIPQDPVLF G+LR NLD   +H DE IW  LE   LK F V S   QL+   +  G++LSVGQ+QL+CLARALLR+T IL+LDEATA+VD  T++ +Q  + R F +CT+L IAHRL +V+D  ++LV++ G++ E  +P  LL   +  FY +A  S L
Sbjct:  206 LNPCPEAEASFPSKAMFWWASGLLWRGYKKLLGPKDLWSLGRENSSEELVSQLEREW-----------RRSCNGLPGHKGHSS--------------VGAPETEAFLQPERSQRGP----------LLRAIWRVFRSTFLLGTLSLVISDAFRFAVPKLLSLFLEFMGD-RNSSAWTGWLLAVLMFAAACLQTLFEQQHMYRAKVLQMRLRTAITGLVYRKVLVLSSGSRKSSAAGDVVNLVSVDIQRLAESIIYLNGLWLLFLWIFVCFVYLWQLLGPSALTAVAVFLSLLPLNFFITKKRGFHQEEQMRQKASRARLTSSMLRTVRTIKSHGWEHAFLERLLHIRGQELSALKTSTLLFSVSLVSFQVSTFLVALVVFAVHTLVAEDNAMDAEKAFVTLTVLSILNKAQAFLPFSVHCIVQARVSFDRLAAFLCLEEVDPNGMIASNSRRSSKDRISVHNGTFAWSQESP-PCLHGINLTVPQGCLLAVVGPVGAGKSSLLSALLGELLKVEGSVSIEGSVAYVPQEAWVQNTSVVENVCFRQELDLPWLQKVLDACALGSDVASFPAGVHTPIGEQGMNLSGGQKQRLSLARAVYKKAAIYLLDDPLAALDAHVSQQVFKQVIGPSGLLQGTTRILVTHTLHVLPQADRILVLANGTIAEMGSYQDLLQRNGALVGLLDGARQPAGTHDAATSDDLGGFPGGGRPTCRPDRPRP------TEAAPVKGRSTSEVQMEASLDD------PEATGLTAEEDSVR---------------------------YGRVKTTIYLSYLRAVGTPLCTYTLFLFLCQQVASFSQGYWLSLWADDPVV----------------------DGRQMHAALRGW---VFGLLGCLQAIGLFASMAAVFLGGARASGLLFRSLLWDVARSPIGFFERTPVGNLLNRFSKETDTVDVDIPDKLRSLLTYAFGLLEVGLAVTMATPLAIVAILPLMVLYAGFQSLYVATSCQLRRLESARYSSVCSHMAETFQGSLVVRAFRAQASFTAQHDALMDENQRVSFPKLVADRWLATNLELLGNGLVFVAATCAVLSKAH---LSAGLVGFSVSAALQVTQTLQWVVRSWTDLENSMVAVERVQDYARIPKEAPWRLPTCAAQPLWPCGGQIEFRDFGLRHRPELPLAVQGVSLKIHAGEKVGIVGRTGAGKSSLAWGLLRLQEAAEGNIWIDGVPITHVGLHTLRSRITIIPQDPVLFPGSLRMNLDLLQEHTDEGIWAALETVQLKAF-VTSLPGQLQYECAGQGDDLSVGQKQLLCLARALLRKTQILILDEATASVDPGTEMQMQAALERWFTQCTVLLIAHRLRSVMDCARVLVMDEGQVAESGSPAQLLAQ-KGLFYRLAHESGL 1497          
BLAST of Multidrug resistance-associated protein 1 vs. UniProt/SwissProt
Match: sp|Q864R9|MRP1_MACFA (Multidrug resistance-associated protein 1 OS=Macaca fascicularis OX=9541 GN=ABCC1 PE=1 SV=1)

HSP 1 Score: 1285.78 bits (3326), Expect = 0.000e+0
Identity = 730/1647 (44.32%), Postives = 1026/1647 (62.30%), Query Frame = 2
Query:  140 DWASEWNSPSPDIPTCFQ---FFDAPIYLLGYLILCFP-YIIHLIRKKVNERPFFKLTII---KLALIVCLMVLQILEIIYNAAKKNN---IPYAYTISNCSFLVCMSILAIMVGLERRCNAVNSGFYFNYWLLHFILCAVRARASGLSLKLK-ITNRDYSRECFIFINLTFVTLSLVLSCFSEKVSQSEIERLNKKRKFQNVLHVNADDNHVSDRMEMSPNAVDSYKTTEKDILINKTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXX-XXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSH----DDTPGIAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSMENLKMDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNGN-KLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFIN---GFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWP-VGCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNLI 5017
            DW   W + +PD   CFQ       P +   YL  CFP Y ++L R   ++R + ++T++   K AL   L ++   ++ Y+  +++    +   + +S     + M +   ++ LERR    +SG    +WL+  +LCA+    S +   LK     D  R+   ++  + V + LVLSCFS           ++   F   +H                                      D   CPE  +SFLSRI F+W T LIV+GY+ PL+  DLW LN E+    +VP+L++N+ K  A  +++  K   ++ + K+ +                 P D++K    +  E    K  +++++P L   L K+  PY L+S  +K IHD++ F GP +LKLL+ FV+D++    W+GYF  AL+ ++A ++T +LHQYFHI F  GMR+++++I AVYRK+L ++ A+RK STVGEIVNLMS+DAQ+F++L +YI+MIWS P Q+I AL LLW  LGP +LAG+ +M+LM+PVNAV+   T+  Q   +K  D+RIK+MNEILNGIKVLKLYAWE +F + V  IR +ELK +K++AY  A  +FT+ C PFLV+L TF ++V I ++NVLDA+KAFVS+ LFNILRFPL +LPMVIS+++QASVSLKRL  FL  EE+  D++      D     + T++N  F W  + P P L  I  + PE  LVA+VG VGCGKSS+LSALL E+DK+EG+V +KGS+AYVPQQAWI N ++++NI+FG   +   Y+ +I+AC L  D EIL   D TEIGEKG+NLSGGQKQRVSLARA Y ++++YL DDPLSAVD+HVGK + +NVI   G+L   TRILVTH+++ L + D IIVM+ G +SE G+Y +L+   GAFA F+ T+ + E +     N            +  +     E  Q    M+ + S  ++        L+  L    +    +        EL    K GA+K    KL+E + ++ G VK++VY  Y+++IG +++   I LF+     +L SN WL  W+D   +              N +Q           +   + L +YG  G  Q +     S+  +   I ++  LH  LL+ +LR PMS FE  P G ++NRFS +L+ V +M+P  I    G L   + A +V ++ T     II PL L+   Y  +QR YV++SRQLKRLESV +SP+YSHF ETL GVS IRA+   ++FI  +D KVD+N  +YY + V+NRWLA+ LE VGN IV  AALFAVIS  +   ++AGLVGLSVSY+L +T  LNWLVRMSSE+E+NIV+VER++EYS+   EAPW I E  P  NWP VG ++F NY  +YRE LD VL++IN  IN  EKVGIVGRTG+GKSSL L LFRI E ++GEI+IDG+ I  +GLHD+R ++TIIPQDPVLFSG+LR NLDPF+++ DEE+W  LE+++LK F V++  ++L+   +EGGENLSVGQRQLVCLARALLR+T ILVLDEATAAVDL+TD LIQ TIR +F++CT+LTIAHRLNT++DY +++VL+ GEI E  AP++LL+     FY+MA+ + L+
Sbjct:   17 DWNVTWYTSNPDFTKCFQNTVLVWVPCF---YLWACFPFYFLYLSR---HDRGYIQMTLLNKTKTALGFLLWIVCWADLFYSFWERSRGIFLAPVFLVSPTLLGITMLLATFLIQLERRKGVQSSGIMLTFWLVA-LLCALAILRSKIMTALKEDVQVDLFRDMTFYVYFSLVLIQLVLSCFS-----------DRSPLFSETIH--------------------------------------DPNPCPESSASFLSRITFWWITGLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRKQPVK---VVYSSKDPA----------------QPKDSSKVDANEEVEALIVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPEILKLLINFVNDTKAPD-WQGYFYTALLFVAACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNAARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWRNLGPPILAGVAVMVLMVPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLKKSAYLAAVGTFTWVCTPFLVALCTFAVYVTIDKNNVLDAQKAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRPVKDGGDTNSITVRNATFTWARSDP-PTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVALKGSVAYVPQQAWIQNDSLQENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYCNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASAEQEQDPEDN-----------GVTGVSGPGKEAKQMENGMLVTDSAGKQ--------LQRQLSSSSSYSGDVSRQHNSTAELQ---KDGAKKEETWKLMEADKAQTGQVKLSVYWDYMKAIGLFISFLSIFLFICNHVAALASNYWLSLWTDDPIV--------------NGTQ-----------EHTKVRLSVYGALGISQGIAVFGYSMAVSIGGILASRCLHVDLLHSILRSPMSFFERTPSGNLVNRFSKELDTVDSMIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIPPLGLI---YFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHS---LSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVAVERLKEYSETEKEAPWQIQETAPPSNWPQVGRVEFRNYCLRYREDLDFVLRHINVTINGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGINIARIGLHDLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWTSLELAHLKGF-VSALPDKLDHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVLDKGEIQEYGAPSDLLQQ-RGLFYNMARDAGLV 1531          
BLAST of Multidrug resistance-associated protein 1 vs. UniProt/SwissProt
Match: sp|Q5F364|MRP1_CHICK (Multidrug resistance-associated protein 1 OS=Gallus gallus OX=9031 GN=ABCC1 PE=2 SV=1)

HSP 1 Score: 1284.63 bits (3323), Expect = 0.000e+0
Identity = 739/1654 (44.68%), Postives = 1024/1654 (61.91%), Query Frame = 2
Query:  140 DWASEWNSPSPDIPTCFQFFDAPIYLLGYLILCFP-YIIHLIRKKVNERPFFKLTII---KLALIVCLMVLQILEIIYNAAKKN-NIPYA--YTISNCSFLVCMSILAIMVGLERRCNAVNSGFYFNYWLLHFILCAVRARASGLSLKLKITNRDYSRECFIFINLTFVT------LSLVLSCFSEKVSQSEIERLNKKRKFQNVLHVNADDNHVSDRMEMSPNAVDSYKTTEKDILINKTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXXXXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSHDDTPGIAATI--KNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSMEN--LKMD-----LEKDVAN---ITKLEDNKRCQEELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPW---IIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWPV-GCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNL 5014
            DW   W++ +PD   CFQ          YL +CFP Y ++L   + ++R + +++I+   K AL + L ++   ++ Y+  +++ NI  A  + IS     + M +   ++  ER     +SG    +WL+  +LCA     S + L L   N D   + F ++  TF T      + L+LSCF E           K   F   ++                                      D K CPE+ +SFLSRI F+W T L+++G++ PL+ +DLW LN E+    IVP L +N+ K  A  KR+      ML + K                      D+N   + +         +   +  L   L K+  PY L+S L+K  HD+L F GP +LKLL+ FV++    + W+GYF   L+ + A ++T ILHQYFHI F  GMR++++++  +YRK+L ++ ++RK STVGEIVNLMS+DAQ+F++L +YI+MIWS P Q+I AL LLW  LGPSVLAG+ +M+L++P+NAV+   T+  Q  Q+K  D+RIK+MNEILNGIKVLKLYAWE +F   V EIR KELK +K++AY  A  +FT+ CAPFLV+L+TF ++V ++++N+LDA+KAFVS+ LFNILRFPL +LPMVIS++++ASVSLKRL  FL  EE++ D++          +I  KN  F W  T P P L +IN T PE  L+A+VG VGCGKSS+LSALLGE+DK EGYV +KGSIAYVPQQAWI NAT+ DNIIFG   +  +Y+R+I+AC L  D EIL   D TEIGEKG+NLSGGQKQRVSLARA Y +++ YL DDPLSAVD+HVGK + + VI   GIL   TR+LVTH +  L + D I+VM +G +SE G+Y +L++  GAFA F+                                RTY+   QS  +  +S    +E   K +EN  L  D     + + ++N    ++     + Q    +  KP A+KN  KL E +T+K G VK  VY  Y+++IG +++   + LF+     SL SN WL  W+D   +              N +Q+             ++ LG+YG  G  Q +     S+  +   I ++  LH  LL+ VLR PMS FE  P G +++RFS +++ + + +P  I  F+ +T   I   I++ +  P    +I PL L+   Y+L+QR YV+TSRQLKRLESV +SP+YSHF ETL GVS IRA+    +FI+ ND KVD+N  +YY + V+NRWLA+ LE VGN IV  AALFAVI+      ++ GL+GLSVSY+L IT  LNWLVRM+S++E+NIV+VER++EY++M  EA W I E  P   WP  G ++F  +  +YRE LD VLKNIN  IN  EKVGIVGRTG+GKSSL L LFRI E ++GEI+IDG+ I ++GLHD+R ++TIIPQDP+LFSG+LR NLDPF++H DE+IW+ LE+++LK F V+S  ++L    SEGGENLSVGQRQLVCLARALLR++ ILVLDEATAAVDL+TD LIQ TI+ +F+ECT+LTIAHRLNT++DY ++LVL+ GE++E D+P+NLL+  +  FYSMAK S L
Sbjct:   17 DWNLTWHTENPDFTQCFQNTVLVWVPCIYLWVCFPAYFLYL---RSHDRGYIQMSILNKAKTALGLILWIVCWADLFYSFWERSQNIFRAPFFLISPTVLGITMLLATFLIQHERLKGVQSSGVMMIFWLIS-LLCATVIFRSKIMLAL---NTDTEVDAFRYV--TFCTYFILLLVQLILSCFPE-----------KPPLFSEAVN--------------------------------------DPKPCPEFSASFLSRITFWWITGLMIQGHRRPLEAKDLWSLNKEDTSEEIVPGLAKNWAKEWAKTKRQPLN---MLYSSKKQQ----------------KSSDSNGEVMEEAEALIIKPSQRSSEASLSKVLYKTFGPYFLMSFLFKAAHDLLMFTGPEILKLLINFVNNKSAPN-WQGYFYTGLLFVCACLQTLILHQYFHICFVTGMRLKTAIVGVIYRKALVITNSARKTSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWRNLGPSVLAGVAVMILLVPINAVMAMKTKTYQVAQMKSKDNRIKLMNEILNGIKVLKLYAWELAFREKVLEIRQKELKVLKKSAYLAAMGTFTWVCAPFLVALSTFAVYVKVNKNNILDAQKAFVSLALFNILRFPLNILPMVISSIVEASVSLKRLRVFLSHEELDPDSIIRGPITNAEGSIVVKNATFSWSKTDP-PSLNSINFTVPEGSLIAVVGQVGCGKSSLLSALLGEMDKKEGYVVVKGSIAYVPQQAWIQNATLEDNIIFGREMNESRYKRVIEACALLPDLEILPMGDRTEIGEKGVNLSGGQKQRVSLARAVYCNADTYLFDDPLSAVDAHVGKHIFEKVIGPKGILKNKTRVLVTHAVNYLPQMDTILVMTDGEISEMGSYQELLKQDGAFAEFL--------------------------------RTYANAEQSMESSDASSPSGKEG--KPVENGVLVNDATGKLMHRQLSNSSTYSRETGKSQHQSSTAELQKPLAEKNSWKLTEADTAKTGRVKATVYWEYMKAIGLYISFLSVFLFMCNHIASLASNYWLSLWTDDPVV--------------NGTQQYT-----------NVRLGVYGALGISQGIAVFGYSMAVSIGGIFASRHLHLDLLHNVLRSPMSFFERTPSGNLVSRFSKEIDTIDSTIPPIIKMFMGSTFNVIGACIIILLATPIAAVVIPPLGLV---YLLVQRFYVATSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQKRFIKQNDMKVDENQKAYYPSIVANRWLAVRLEFVGNCIVLFAALFAVIARNK---LSPGLIGLSVSYSLQITAYLNWLVRMTSDLETNIVAVERVKEYAEMEKEAEWSIEETAPASTWPQEGKVEFRGFGLRYREDLDLVLKNINITINGGEKVGIVGRTGAGKSSLTLGLFRINEAAEGEIIIDGINIAKIGLHDLRFKITIIPQDPILFSGSLRMNLDPFDQHSDEDIWRSLELAHLKNF-VSSLPDKLNHECSEGGENLSVGQRQLVCLARALLRKSKILVLDEATAAVDLETDNLIQSTIKSQFEECTVLTIAHRLNTIMDYTRVLVLDRGEVVECDSPDNLLQ-AKGLFYSMAKDSGL 1524          
BLAST of Multidrug resistance-associated protein 1 vs. UniProt/SwissProt
Match: sp|Q6UR05|MRP1_CANLF (Multidrug resistance-associated protein 1 OS=Canis lupus familiaris OX=9615 GN=ABCC1 PE=1 SV=1)

HSP 1 Score: 1273.84 bits (3295), Expect = 0.000e+0
Identity = 734/1654 (44.38%), Postives = 1015/1654 (61.37%), Query Frame = 2
Query:  140 DWASEWNSPSPDIPTCFQFFDAPIYLLGYLILCFP-YIIHLIRKKVNERPFFKLTII---KLALIVCLMVLQILEIIYNAAKKNN---IPYAYTISNCSFLVCMSILAIMVGLERRCNAVNSGFYFNYWLLHFILCAVRARASGLSLKLKITNR-DYSRECFIFINLTFVTLSLVLSCFSEKVSQSEIERLNKKRKFQNVLHVNADDNHVSDRMEMSPNAVDSYKTTEKDILINKTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXXXXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSH----DDTPGIAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLS--KSREKIYKSMENLKM-------DLEKDVANITKLE-DNKRCQEELDKFLKPGAQ-KNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNP---WIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWP-VGCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSG-NEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNLI 5017
            +W   WN+ +PD   CFQ          YL LCFP Y ++L R   ++R + ++T +   K AL   L ++   ++ Y+  +++    +   + +S     + M +   ++ LERR    +SG    +WL+  +LCA+    S +   LK     D  R+   +I  + V + LVLSCFS           ++   F   +H                                      DL  CPE  +SFLSR+ F+W T L+V+GY+ PL++ DLW LN E+    +VP+L++N+ K  A +KR+  K      +     G    ++ E  +  +   P   +                  +P L   L K+  PY L+S L+K +HD++ F GP +LKLL+ FV+D +    W+GY   AL+ I A ++T +LHQYFHI F  GMR+++++I AVYRK+L ++ ++RK STVGEIVNLMS+DAQ+F++L +YI+MIWS P Q+I AL LLW  LGPSVLAG+ +M+LM+P+NAV+   T+  Q   +K  D+RIK+MNEILNGIKVLKLYAWE +F + V  IR +ELK +K++AY  A  +FT+ C PFLV+L+TF ++V + ++N+LDA+KAFVS+ LFNILRFPL +LPMVIS+++QASVSLKRL  FL  EE+  D++      D     + T+KN  F W  + P P L  I  + PE  LVA+VG VGCGKSS+LSALL E+DK+EG+V +KGS+AYVPQQAWI N ++R+NI+FG       Y+ +I+AC L  D EIL   D TEIGEKG+NLSGGQKQRVSLARA Y DS++YL DDPLSAVD+HVGK + +NVI   G+L   TR+LVTH+++ L + D IIVM  G +SE G+Y +L+   GAFA F+                                RTY+  +Q  A     L+   S  K  K MEN  +        L++ ++N +    D  R      +  K G + ++  KL+E + ++ G VK++VY  Y+++IG +++   I LF+     SL SN WL  W+D   +              N +Q           +   + L +YG  G  Q +     S+  +   I ++  LH  LL  VLR PMS FE  P G ++NRFS +L+ V +M+P  I  F+ +    I   I++ +  P    II PL L+   Y  +QR YV++SRQLKRLESV +SP+YSHF ETL GVS IRA+   ++FI  +D KVD+N  +YY + V+NRWLA+ LE VGN IV  AALF+VIS  +   ++AGLVGLSVSY+L +T  LNWLVRMSSE+E+NIV+VER++EYS+   EAPW I E  P   WP VG ++F +Y  +YRE LD VLK+IN  IN  EKVGIVGRTG+GKSSL L LFRI E ++GEI+ID + I ++GLHD+R ++TIIPQDPVLFSG+LR NLDPF+++ DEE+W  LE+++LK FV  SG  ++L    +EGGENLSVGQRQLVCLARALLR+T ILVLDEATAAVDL+TD LIQ TIR +F +CT+LTIAHRLNT++DY +++VL+ GEI E   P++LL+     FYSMAK + L+
Sbjct:   17 EWDVSWNTSNPDFTKCFQNTVLVWVPCCYLWLCFPFYFLYLSR---HDRGYIQMTYLNKTKTALGFVLWIVCWADLFYSFWERSWGKILAPVFLVSPTLLGITMLLATFLIQLERRKGVQSSGIMLTFWLIA-LLCALAILRSKIMTALKEDAEIDVFRDVTFYIYFSLVLIQLVLSCFS-----------DRPPLFSETIH--------------------------------------DLNPCPESSASFLSRVTFWWITGLMVRGYRQPLESTDLWSLNKEDTSEQVVPVLVKNWKKECAKSKRQQRKITYSSKDPAKPKGGSQVDVNEEAEVLIVKTPQKER------------------EPSLFKVLYKTFGPYFLMSFLFKALHDLMMFAGPEILKLLINFVNDKKAPD-WQGYLYTALLFICACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWLNLGPSVLAGVAVMILMVPLNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLKKSAYLAAVGTFTWVCTPFLVALSTFAVYVTVDKNNILDAQKAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRPVKDGGGANSITVKNATFTWARSDP-PTLSGITFSIPEGSLVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQNDSLRENILFGRQLQERYYKAVIEACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYCDSDIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRLLVTHSISYLPQVDVIIVMTGGKISEMGSYQELLARDGAFAEFL--------------------------------RTYASGDQEQAEQDDGLTGVSSPGKEVKQMENGMLVTDVAGKQLQRQLSNSSSYSGDVSRHHTSTAELQKAGPKNEDAWKLVEADKAQTGQVKLSVYWDYMKAIGLFISFLSIFLFLCNHVASLVSNYWLSLWTDDPIV--------------NGTQ-----------EHTKIRLSVYGALGISQGITVFGYSMAVSIGGIFASRRLHVDLLQNVLRSPMSFFERTPSGNLVNRFSKELDTVDSMIPQVIKMFMGSLFNVIGACIIILLATPIASIIIPPLGLI---YFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIRQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFSVISRHS---LSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVAVERLKEYSETEKEAPWQIQEMAPPSTWPQVGRVEFRDYGLRYRENLDLVLKHINITINGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDDINIAKIGLHDLRVKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWTSLELAHLKDFV--SGLPDKLNQECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFDDCTVLTIAHRLNTIMDYTRVIVLDKGEIRECGQPSDLLQQ-RGLFYSMAKDAGLV 1531          
BLAST of Multidrug resistance-associated protein 1 vs. UniProt/SwissProt
Match: sp|O35379|MRP1_MOUSE (Multidrug resistance-associated protein 1 OS=Mus musculus OX=10090 GN=Abcc1 PE=1 SV=1)

HSP 1 Score: 1273.46 bits (3294), Expect = 0.000e+0
Identity = 724/1650 (43.88%), Postives = 1009/1650 (61.15%), Query Frame = 2
Query:  140 DWASEWNSPSPDIPTCFQFFDAPIYLLGYLILCFP-YIIHLIRKKVNERPFFKLTII---KLALIVCLMVLQILEIIYNAAKKNN----IPYAYTISNCSFLVCMSILAIMVGLERRCNAVNSGFYFNYWLLHFILCAVRARASGLSLKLKITNRDYSRECFIFINLTFVTLSLVLSCFSEKVSQSEIERLNKKRKFQNVLHVNADDNHVSDRMEMSPNAVDSYKTTEKDILINKTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNN-SGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXXXXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAV---SHDDTPGIAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSMEN-------LKMDLEKDVANITKLE-DNKRCQEELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFIN---GFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWP-VGCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNLI 5017
            DW   W++ +PD   CFQ          YL  CFP Y  +L R   ++R + ++T +   K AL   L ++   ++ Y+  +++      P    +S     + M +   ++ LERR    +SG    +WL+  +      R+  +S   K  + D  R+   ++  T V + LVLSCFS           +    F   +H                                      D   CPE  +SFLSRI F+W T ++V GY+ PL++ DLW LN E+    +VP+L+ N+ K    ++++  +       D +   G    ++ E  +  +   P  ++                  +P L   L K+  PY L+S LYK +HD++ F GP +L+L++ FV+D E    W+GYF  AL+ +SA ++T  LHQYFHI F  GMR++++++ AVYRK+L ++ A+RK STVGEIVNLMS+DAQ+F++L +YI+MIWS P Q+I AL  LW  LGPSVLAG+ +M+LM+P+NAV+   T+  Q   +K  D+RIK+MNEILNGIKVLKLYAWE +F + V  IR +ELK +K++AY  A  +FT+ C PFLV+L+TF +FV +   N+LDA+KAFVS+ LFNILRFPL +LPMVIS+++QASVSLKRL  FL  EE+  D++   S     G + T+KN  F W    P P L  I  + PE  LVA+VG VGCGKSS+LSALL E+DK+EG+V +KGS+AYVPQQAWI N ++R+NI+FG P     Y+ +++AC L  D EIL   D TEIGEKG+NLSGGQKQRVSLARA YS+S++YL DDPLSAVD+HVGK + + V+   G+L   TRILVTH ++ L + D IIVM+ G +SE G+Y +L+   GAFA F+                                RTY+   Q  A+   S+S S ++  K +EN       +   L++ ++N +    D  +    + +  K GA++   KL+E + ++ G V+++VY  Y+++IG ++    I LF+     +L SN WL  W+D   +              N +Q             R+  L +YG  G  Q       S+  +   I ++  LH  LL  VLR PMS FE  P G ++NRFS +L+ V +M+P  I    G L + + A+++ ++ T     II PL L+   Y  +QR YV++SRQLKRLESV +SP+YSHF ETL GVS IRA+   ++FI  +D KVD+N  +YY + V+NRWLA+ LE VGN IV  AALFAVIS  +   ++AGLVGLSVSY+L IT  LNWLVRMSSE+E+NIV+VER++EYS+   EAPW I E  P   WP  G ++F +Y  +YRE LD VLK+IN  I   EKVGIVGRTG+GKSSL L LFRI E ++GEI+IDG+ I ++GLH++R ++TIIPQDPVLFSG+LR NLDPF+++ DEE+W  LE+++LK F V++  ++L    +EGGENLSVGQRQLVCLARALLR+T ILVLDEATAAVDL+TD LIQ TIR +F++CT+LTIAHRLNT++DY +++VL+ GE+ E  AP+ LL+     FYSMAK + L+
Sbjct:   17 DWNVTWHTSNPDFTKCFQNTVLTWVPCFYLWSCFPLYFFYLSR---HDRGYIQMTHLNKTKTALGFFLWIICWADLFYSFWERSQGVLRAP-VLLVSPTLLGITMLLATFLIQLERRKGVQSSGIMLTFWLVALLCALAILRSKIISALKKDAHVDVFRDSTFYLYFTLVLVQLVLSCFS-----------DCSPLFSETVH--------------------------------------DRNPCPESSASFLSRITFWWITGMMVHGYRQPLESSDLWSLNKEDTSEEVVPVLVNNWKKECDKSRKQPVRIVYAPPKDPSKPKGSSQLDVNEEVEALIVKSPHKDR------------------EPSLFKVLYKTFGPYFLMSFLYKALHDLMMFAGPKILELIINFVNDREAPD-WQGYFYTALLFVSACLQTLALHQYFHICFVSGMRIKTAVVGAVYRKALLITNAARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYFLWLSLGPSVLAGVAVMILMVPLNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFQDKVMSIRQEELKVLKKSAYLAAVGTFTWVCTPFLVALSTFAVFVTVDERNILDAKKAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRSIKSGEGNSITVKNATFTWARGEP-PTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVTLKGSVAYVPQQAWIQNDSLRENILFGHPLQENYYKAVMEACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNSDIYLFDDPLSAVDAHVGKHIFEKVVGPMGLLKNKTRILVTHGISYLPQVDVIIVMSGGKISEMGSYQELLDRDGAFAEFL--------------------------------RTYANAEQDLASEDDSVSGSGKE-SKPVENGMLVTDTVGKHLQRHLSNSSSHSGDTSQQHSSIAELQKAGAKEETWKLMEADKAQTGQVQLSVYWNYMKAIGLFITFLSIFLFLCNHVSALASNYWLSLWTDDPPVV-------------NGTQA-----------NRNFRLSVYGALGILQGAAIFGYSMAVSIGGIFASRRLHLDLLYNVLRSPMSFFERTPSGNLVNRFSKELDTVDSMIPQVIKMFMGSLFSVIGAVIIILLATPIAAVIIPPLGLV---YFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHS---LSAGLVGLSVSYSLQITAYLNWLVRMSSEMETNIVAVERLKEYSETEKEAPWQIQETAPPSTWPHSGRVEFRDYCLRYREDLDLVLKHINVTIEGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGVNIAKIGLHNLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWMALELAHLKGF-VSALPDKLNHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDNLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVLDKGEVRECGAPSELLQQ-RGIFYSMAKDAGLV 1528          
BLAST of Multidrug resistance-associated protein 1 vs. UniProt/SwissProt
Match: sp|P33527|MRP1_HUMAN (Multidrug resistance-associated protein 1 OS=Homo sapiens OX=9606 GN=ABCC1 PE=1 SV=3)

HSP 1 Score: 1272.3 bits (3291), Expect = 0.000e+0
Identity = 727/1646 (44.17%), Postives = 1029/1646 (62.52%), Query Frame = 2
Query:  140 DWASEWNSPSPDIPTCFQ---FFDAPIYLLGYLILCFP-YIIHLIRKKVNERPFFKLTII---KLALIVCLMVLQILEIIYNAAKKNN---IPYAYTISNCSFLVCMSILAIMVGLERRCNAVNSGFYFNYWLLHFILCAVRARASGLSLKLKITNR-DYSRECFIFINLTFVTLSLVLSCFSEKVSQSEIERLNKKRKFQNVLHVNADDNHVSDRMEMSPNAVDSYKTTEKDILINKTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXX-XXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSH---DDTPGI-AATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSMENLKMDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFIN---GFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWP-VGCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNLI 5017
            DW   WN+ +PD   CFQ       P +   YL  CFP Y ++L R   ++R + ++T +   K AL   L ++   ++ Y+  +++    +   + +S     + M +   ++ LERR    +SG    +WL+  + CA+    S +   LK   + D  R+   ++  + + + LVLSCFS           ++   F   +H                                      D   CPE  +SFLSRI F+W T LIV+GY+ PL+  DLW LN E+    +VP+L++N+ K  A  +++  K   ++ + K+ +                 P +++K    +  E    K  +++++P L   L K+  PY L+S  +K IHD++ F GP +LKLL++FV+D++    W+GYF   L+ ++A ++T +LHQYFHI F  GMR+++++I AVYRK+L ++ ++RK STVGEIVNLMS+DAQ+F++L +YI+MIWS P Q+I AL LLW  LGPSVLAG+ +M+LM+PVNAV+   T+  Q   +K  D+RIK+MNEILNGIKVLKLYAWE +F + V  IR +ELK +K++AY +A  +FT+ C PFLV+L TF ++V I  +N+LDA+ AFVS+ LFNILRFPL +LPMVIS+++QASVSLKRL  FL  EE+  D++      D  G  + T++N  F W  + P P L  I  + PE  LVA+VG VGCGKSS+LSALL E+DK+EG+V +KGS+AYVPQQAWI N ++R+NI+FG   +   Y+ +I+AC L  D EIL   D TEIGEKG+NLSGGQKQRVSLARA YS++++YL DDPLSAVD+HVGK + +NVI   G+L   TRILVTH+++ L + D IIVM+ G +SE G+Y +L+   GAFA F+ T+ + E +    +N            +  +     E  Q    M+ + S  ++        L+  L    +    +  +     EL K      ++   KL+E + ++ G VK++VY  Y+++IG +++   I LF+     +L SN WL  W+D   +              N +Q           +   + L +YG  G  Q +     S+  +   I ++  LH  LL+ +LR PMS FE  P G ++NRFS +L+ V +M+P  I    G L   + A +V ++ T     II PL L+   Y  +QR YV++SRQLKRLESV +SP+YSHF ETL GVS IRA+   ++FI  +D KVD+N  +YY + V+NRWLA+ LE VGN IV  AALFAVIS  +   ++AGLVGLSVSY+L +T  LNWLVRMSSE+E+NIV+VER++EYS+   EAPW I E  P  +WP VG ++F NY  +YRE LD VL++IN  IN  EKVGIVGRTG+GKSSL L LFRI E ++GEI+IDG+ I ++GLHD+R ++TIIPQDPVLFSG+LR NLDPF+++ DEE+W  LE+++LK F V++  ++L+   +EGGENLSVGQRQLVCLARALLR+T ILVLDEATAAVDL+TD LIQ TIR +F++CT+LTIAHRLNT++DY +++VL+ GEI E  AP++LL+     FYSMAK + L+
Sbjct:   17 DWNVTWNTSNPDFTKCFQNTVLVWVPCF---YLWACFPFYFLYLSR---HDRGYIQMTPLNKTKTALGFLLWIVCWADLFYSFWERSRGIFLAPVFLVSPTLLGITMLLATFLIQLERRKGVQSSGIMLTFWLVALV-CALAILRSKIMTALKEDAQVDLFRDITFYVYFSLLLIQLVLSCFS-----------DRSPLFSETIH--------------------------------------DPNPCPESSASFLSRITFWWITGLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRKQPVK---VVYSSKDPA----------------QPKESSKVDANEEVEALIVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPQILKLLIKFVNDTKAPD-WQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWLNLGPSVLAGVAVMVLMVPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLKKSAYLSAVGTFTWVCTPFLVALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRPVKDGGGTNSITVRNATFTWARSDP-PTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEEN-----------GVTGVSGPGKEAKQMENGMLVTDSAGKQ--------LQRQLSSSSSYSGDISRHHNSTAELQK--AEAKKEETWKLMEADKAQTGQVKLSVYWDYMKAIGLFISFLSIFLFMCNHVSALASNYWLSLWTDDPIV--------------NGTQ-----------EHTKVRLSVYGALGISQGIAVFGYSMAVSIGGILASRCLHVDLLHSILRSPMSFFERTPSGNLVNRFSKELDTVDSMIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIPPLGLI---YFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHS---LSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVAVERLKEYSETEKEAPWQIQETAPPSSWPQVGRVEFRNYCLRYREDLDFVLRHINVTINGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGINIAKIGLHDLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWTSLELAHLKDF-VSALPDKLDHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVLDKGEIQEYGAPSDLLQQ-RGLFYSMAKDAGLV 1531          
BLAST of Multidrug resistance-associated protein 1 vs. TrEMBL
Match: I2CX20 (Multidrug resistance-associated protein 1 isoform 1 OS=Macaca mulatta OX=9544 GN=ABCC1 PE=2 SV=1)

HSP 1 Score: 1286.55 bits (3328), Expect = 0.000e+0
Identity = 730/1647 (44.32%), Postives = 1026/1647 (62.30%), Query Frame = 2
Query:  140 DWASEWNSPSPDIPTCFQ---FFDAPIYLLGYLILCFP-YIIHLIRKKVNERPFFKLTII---KLALIVCLMVLQILEIIYNAAKKNN---IPYAYTISNCSFLVCMSILAIMVGLERRCNAVNSGFYFNYWLLHFILCAVRARASGLSLKLK-ITNRDYSRECFIFINLTFVTLSLVLSCFSEKVSQSEIERLNKKRKFQNVLHVNADDNHVSDRMEMSPNAVDSYKTTEKDILINKTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXX-XXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSH----DDTPGIAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSMENLKMDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNGN-KLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFIN---GFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWP-VGCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNLI 5017
            DW   W + +PD   CFQ       P +   YL  CFP Y ++L R   ++R + ++T++   K AL   L ++   ++ Y+  +++    +   + +S     + M +   ++ LERR    +SG    +WL+  +LCA+    S +   LK     D  R+   +I  + V + LVLSCFS           ++   F   +H                                      D   CPE  +SFLSRI F+W T LIV+GY+ PL+  DLW LN E+    +VP+L++N+ K  A  +++  K   ++ + K+ +                 P D++K    +  E    K  +++++P L   L K+  PY L+S  +K IHD++ F GP +LKLL+ FV+D++    W+GYF  AL+ ++A ++T +LHQYFHI F  GMR+++++I AVYRK+L ++ A+RK STVGEIVNLMS+DAQ+F++L +YI+MIWS P Q+I AL LLW  LGP +LAG+ +M+LM+PVNAV+   T+  Q   +K  D+RIK+MNEILNGIKVLKLYAWE +F + V  IR +ELK +K++AY  A  +FT+ C PFLV+L TF ++V I ++N+LDA+KAFVS+ LFNILRFPL +LPMVIS+++QASVSLKRL  FL  EE+  D++      D     + T++N  F W  + P P L  I  + PE  LVA+VG VGCGKSS+LSALL E+DK+EG+V +KGS+AYVPQQAWI N ++++NI+FG   +   Y+ +I+AC L  D EIL   D TEIGEKG+NLSGGQKQRVSLARA Y ++++YL DDPLSAVD+HVGK + +NVI   G+L   TRILVTH+++ L + D IIVM+ G +SE G+Y +L+   GAFA F+ T+ + E +     N            +  +     E  Q    M+ + S  ++        L+  L    +    +        EL    K GA+K    KL+E + ++ G VK++VY  Y+++IG +++   I LF+     +L SN WL  W+D   +              N +Q           +   + L +YG  G  Q +     S+  +   I ++  LH  LL+ +LR PMS FE  P G ++NRFS +L+ V +M+P  I    G L   + A +V ++ T     II PL L+   Y  +QR YV++SRQLKRLESV +SP+YSHF ETL GVS IRA+   ++FI  +D KVD+N  +YY + V+NRWLA+ LE VGN IV  AALFAVIS  +   ++AGLVGLSVSY+L +T  LNWLVRMSSE+E+NIV+VER++EYS+   EAPW I E  P  NWP VG ++F NY  +YRE LD VL++IN  IN  EKVGIVGRTG+GKSSL L LFRI E ++GEI+IDG+ I  +GLHD+R ++TIIPQDPVLFSG+LR NLDPF+++ DEE+W  LE+++LK F V++  ++L+   +EGGENLSVGQRQLVCLARALLR+T ILVLDEATAAVDL+TD LIQ TIR +F++CT+LTIAHRLNT++DY +++VL+ GEI E  AP++LL+     FY+MA+ + L+
Sbjct:   17 DWNVTWYTSNPDFTKCFQNTVLVWVPCF---YLWACFPFYFLYLSR---HDRGYIQMTLLNKTKTALGFLLWIVCWADLFYSFWERSRGIFLAPVFLVSPTLLGITMLLATFLIQLERRKGVQSSGIMLTFWLVA-LLCALAILRSKIMTALKEDVQVDLFRDITFYIYFSLVLIQLVLSCFS-----------DRSPLFSETIH--------------------------------------DPNPCPESSASFLSRITFWWITGLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRKQPVK---VVYSSKDPA----------------QPKDSSKVDANEEVEALIVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPEILKLLINFVNDTKAPD-WQGYFYTALLFVAACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNAARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWRNLGPPILAGVAVMVLMVPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLKKSAYLAAVGTFTWVCTPFLVALCTFAVYVTIDKNNILDAQKAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRPVKDGGDTNSVTVRNATFTWARSDP-PTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQNDSLQENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYCNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASAEQEQDPEDN-----------GVTGISGPGKEAKQMENGMLVTDSAGKQ--------LQRQLSSSSSYSGDVSRQHNSTAELQ---KDGAKKEETWKLMEADKAQTGQVKLSVYWDYMKAIGLFISFLSIFLFICNHVAALASNYWLSLWTDDPIV--------------NGTQ-----------EHTKVRLSVYGALGISQGIAVFGYSMAVSIGGILASRCLHVDLLHSILRSPMSFFERTPSGNLVNRFSKELDTVDSMIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIPPLGLI---YFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHS---LSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVAVERLKEYSETEKEAPWQIQETAPPSNWPQVGRVEFRNYCLRYREDLDFVLRHINVTINGGEKVGIVGRTGAGKSSLTLGLFRISESAEGEIIIDGINIARIGLHDLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWTSLELAHLKGF-VSALPDKLDHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVLDKGEIQEYGAPSDLLQQ-RGLFYNMARDAGLV 1531          
BLAST of Multidrug resistance-associated protein 1 vs. TrEMBL
Match: A0A0D9R6N7 (ATP binding cassette subfamily C member 1 OS=Chlorocebus sabaeus OX=60711 GN=ABCC1 PE=4 SV=1)

HSP 1 Score: 1286.17 bits (3327), Expect = 0.000e+0
Identity = 729/1651 (44.16%), Postives = 1028/1651 (62.27%), Query Frame = 2
Query:  140 DWASEWNSPSPDIPTCFQ---FFDAPIYLLGYLILCFP-YIIHLIRKKVNERPFFKLTII---KLALIVCLMVLQILEIIYNAAKKNN---IPYAYTISNCSFLVCMSILAIMVGLERRCNAVNSGFYFNYWLLHFILCAVRARASGLSLKLKITNR-DYSRECFIFINLTFVTLSLVLSCFSEKVSQSEIERLNKKRKFQNVLHVNADDNHVSDRMEMSPNAVDSYKTTEKDILINKTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXX-XXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSH----DDTPGIAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSM---ENLKMDLEKDVANITKLE-DNKRCQEELDKFLKPGAQKNGN-KLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFIN---GFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWP-VGCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNLI 5017
            DW   W + +PD   CFQ       P +   YL  CFP Y ++L R   ++R + ++T++   K AL   L ++   ++ Y+  +++    +   + +S     + M +   ++ LERR    +SG    +WL+  +LCA+    S +   LK   + D  R+   ++  + V + LVLSCFS           ++   F   +H                                      D   CPE  +SFLSRI F+W T LIV+GY+ PL+  DLW LN E+    +VP+L++N+ K  A  +++  K   ++ + K+ +                 P D++K    +  E    K  +++++P L   L K+  PY L+S  +K IHD++ F GP +LKLL+ FV+D++    W+GYF   L+ ++A ++T +LHQYFHI F  GMR+++++I AVYRK+L ++ A+RK STVGEIVNLMS+DAQ+F++L +YI+MIWS P Q+I AL LLW  LGP +LAG+ +M+LM+PVNAV+   T+  Q   +K  D+RIK+MNEILNGIKVLKLYAWE +F + V  IR +ELK +K++AY  A  +FT+ C PFLV+L TF ++V I ++N+LDA+KAFVS+ LFNILRFPL +LPMVIS+++QASVSLKRL  FL  EE+  D++      D     + T++N  F W  + P P L  I  + PE  LVA+VG VGCGKSS+LSALL E+DK+EG+V +KGS+AYVPQQAWI N ++++NI+FG   +   Y+ +I+AC L  D EIL   D TEIGEKG+NLSGGQKQRVSLARA Y ++++YL DDPLSAVD+HVGK + +NVI   G+L   TRILVTH+++ L + D IIVM+ G +SE G+Y +L+   GAFA F+ T+ + E +     N                              IS   K  +++   M   +N    L++ +++ +    D  R      +  K GA+K    KL+E + ++ G VK++VY  Y+++IG +++   I LF+     +L SN WL  W+D   +              N +Q           +   + L +YG  G  Q +     S+  +   I ++  LH  LL+ +LR PMS FE  P G ++NRFS +L+ V +M+P  I    G L   + A +V ++ T     II PL L+   Y  +QR YV++SRQLKRLESV +SP+YSHF ETL GVS IRA+   ++FI  +D KVD+N  +YY + V+NRWLA+ LE VGN IV  AALFAVIS  +   ++AGLVGLSVSY+L +T  LNWLVRMSSE+E+NIV+VER++EYS+   EAPW I E  P  NWP VG ++F NY  +YRE LD VL++IN  IN  EKVGIVGRTG+GKSSL L LFRI E ++GEI+IDG+ I  +GLHD+R ++TIIPQDPVLFSG+LR NLDPF+++ DEE+W  LE+++LK F V++  ++L+   +EGGENLSVGQRQLVCLARALLR+T ILVLDEATAAVDL+TD LIQ TIR +F++CT+LTIAHRLNT++DY +++VL+ GEI E  AP++LL+     FY+MAK + L+
Sbjct:   17 DWNVTWYTSNPDFTKCFQNTVLVWVPCF---YLWACFPFYFLYLSR---HDRGYIQMTLLNKTKTALGFLLWIVCWADLFYSFWERSRGIFLAPVFLVSPTLLGITMLLATFLIQLERRKGVQSSGIMLTFWLVA-LLCALAILRSKIMTALKEDAQVDLFRDITFYVYFSLVLIQLVLSCFS-----------DRSPLFSETIH--------------------------------------DPNPCPESSASFLSRITFWWITGLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRKQPVK---VVYSSKDPA----------------QPKDSSKVDANEEVEALIVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPEILKLLINFVNDTKAPD-WQGYFYTVLLFVAACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNAARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWQNLGPPILAGVAVMVLMVPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLKKSAYLAAVGTFTWVCTPFLVALCTFAVYVTIDKNNILDAQKAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRPVKDGRDTNSITVRNATFTWARSDP-PTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQNDSLQENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYCNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASAEQEQDPEDN--------------------------GVTGISGPGKEAKQMENGMLVTDNAGKQLQRQLSSSSSYSGDVSRQHNSTAELQKDGAKKEETWKLMEADKAQTGQVKLSVYWDYMKAIGLFISFLSIFLFICNHVAALASNYWLSLWTDDPIV--------------NGTQ-----------EHTKVRLSVYGALGISQGIAVFGYSMAVSIGGILASRCLHVDLLHSILRSPMSFFERTPSGNLVNRFSKELDTVDSMIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIPPLGLI---YFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHS---LSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVAVERLKEYSETEKEAPWQIQETAPPSNWPQVGRVEFRNYCLRYREDLDFVLRHINVTINGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGINIARIGLHDLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWTSLELAHLKGF-VSALPDKLDHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVLDKGEIQEYGAPSDLLQQ-RGLFYNMAKDAGLV 1531          
BLAST of Multidrug resistance-associated protein 1 vs. TrEMBL
Match: A0A096NLW5 (ATP binding cassette subfamily C member 1 OS=Papio anubis OX=9555 GN=ABCC1 PE=4 SV=2)

HSP 1 Score: 1285.4 bits (3325), Expect = 0.000e+0
Identity = 732/1651 (44.34%), Postives = 1028/1651 (62.27%), Query Frame = 2
Query:  134 STDWASEWNSPSPDIPTCFQ---FFDAPIYLLGYLILCFP-YIIHLIRKKVNERPFFKLTII---KLALIVCLMVLQILEIIYNAAKKNN---IPYAYTISNCSFLVCMSILAIMVGLERRCNAVNSGFYFNYWLLHFILCAVRARASGLSLKLKITNR-DYSRECFIFINLTFVTLSLVLSCFSEKVSQSEIERLNKKRKFQNVLHVNADDNHVSDRMEMSPNAVDSYKTTEKDILINKTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXX-XXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSH------DDTPGIAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSMENLKMDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNGN-KLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFIN---GFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWP-VGCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNLI 5017
            S DW   W + +PD   CFQ       P +   YL  CFP Y ++L R   ++R + ++T++   K AL   L ++   ++ Y+  +++    +   + +S     + M +   ++ LERR    +SG    +WL+  +LCA+    S +   LK   + D  R+   ++  + V + LVLSCFS++              F   +H                                      D   CPE  +SFLSRI F+W T LIV+GY+ PL+  DLW LN E+    +VP+L++N+ K  A  +++  K   ++ + K+ +                 P D++K    +  E    K  +++++P L   L K+  PY L+S  +K IHD++ F GP +LKLL+ FV+D++    W+GYF  AL+ ++A ++T +LHQYFHI F  GMR+++++I AVYRK+L ++ A+RK STVGEIVNLMS+DAQ+F++L +YI+MIWS P Q+I AL LLW  LGP +LAG+ +M+LM+PVNAV+   T+  Q   +K  D+RIK+MNEILNGIKVLKLYAWE +F + V  IR +ELK +K++AY  A  +FT+ C PFLV+L TF ++V I ++N+LDA+KAFVS+ LFNILRFPL +LPMVIS+++QASVSLKRL  FL  EE+  D++         DT  I  T++N  F W  + P P L  I  + PE  LVA+VG VGCGKSS+LSALL E+DK+EG+V +KGS+AYVPQQAWI N ++++NI+FG   +   Y+ +I+AC L  D EIL   D TEIGEKG+NLSGGQKQRVSLARA Y ++++YL DDPLSAVD+HVGK + +NVI   G+L   TRILVTH+++ L + D IIVM+ G +SE G+Y +L+   GAFA F+ T+ + E +     N            +  +     E  Q    M+ + S  ++        L+  L    +    +        EL    K GA+K    KL+E + ++ G VK++VY  Y+++IG +++   I LF+     +L SN WL  W+D   +              N +Q           +   + L +YG  G  Q +     S+  +   I ++  LH  LL+ +LR PMS FE  P G ++NRFS +L+ V +M+P  I    G L   + A +V ++ T     II PL L+   Y  +QR YV++SRQLKRLESV +SP+YSHF ETL GVS IRA+   ++FI  +D KVD N  +YY + V+NRWLA+ LE VGN IV  AALFAVIS  +   ++AGLVGLSVSY+L +T  LNWLVRMSSE+E+NIV+VER++EYS+   EAPW I E  P  NWP VG ++F NY  +YRE LD VL++IN  IN  EKVGIVGRTG+GKSSL L LFRI E ++GEI+IDG+ I  +GLHD+R ++TIIPQDPVLFSG+LR NLDPF+++ DEE+W  LE+++LK F V++  ++L+   +EGGENLSVGQRQLVCLARALLR+T ILVLDEATAAVDL+TD LIQ TIR +F++CT+LTIAHRLNT++DY +++VL+ GEI E  AP++LL+     FY+MA+ + L+
Sbjct:   12 SPDWNVTWYTSNPDFTKCFQNTVLVWVPCF---YLWACFPFYFLYLSR---HDRGYIQMTLLNKTKTALGFLLWIVCWADLFYSFWERSRGIFLAPVFLVSPTLLGITMLLATFLIQLERRKGVQSSGIMLTFWLVA-LLCALAILRSKIMTALKEDAQVDLFRDITFYVYFSLVLIQLVLSCFSDR-----------SPLFSETIH--------------------------------------DPNPCPESSASFLSRITFWWITGLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRKQPVK---VVYSSKDPA----------------QPKDSSKVDANEEVEALIVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPEILKLLINFVNDTKAPD-WQGYFYTALLFVAACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNAARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWRNLGPPILAGVAVMVLMVPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLKKSAYLAAVGTFTWVCTPFLVALCTFAVYVTIDKNNILDAQKAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRPVKDGGDTNSI--TVRNATFTWARSDP-PTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQNDSLQENILFGCHLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYCNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASAEQEQDPEDN-----------GVTGISGPGKEAKQMENGMLVTDSAGKQ--------LQRQLSSSSSYSGDVSRQHNSTAELQ---KDGAKKEETWKLMEADKAQTGQVKLSVYWDYMKAIGLFISFLSIFLFICNHVAALASNYWLSLWTDDPIV--------------NGTQ-----------EHTKVRLSVYGALGISQGIAVFGYSMAVSIGGILASRYLHVDLLHSILRSPMSFFERTPSGNLVNRFSKELDTVDSMIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIPPLGLI---YFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDANQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHS---LSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVAVERLKEYSETEKEAPWQIQETAPPSNWPQVGRVEFRNYCLRYREDLDFVLRHINVTINGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGINIARIGLHDLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWTSLELAHLKGF-VSALPDKLDHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVLDKGEIQEYGAPSDLLQQ-RGLFYNMARDAGLV 1528          
BLAST of Multidrug resistance-associated protein 1 vs. TrEMBL
Match: A0A2K5NES6 (ATP binding cassette subfamily C member 1 OS=Cercocebus atys OX=9531 GN=ABCC1 PE=4 SV=1)

HSP 1 Score: 1285.4 bits (3325), Expect = 0.000e+0
Identity = 730/1649 (44.27%), Postives = 1028/1649 (62.34%), Query Frame = 2
Query:  134 STDWASEWNSPSPDIPTCFQ---FFDAPIYLLGYLILCFP-YIIHLIRKKVNERPFFKLTII---KLALIVCLMVLQILEIIYNAAKKNN---IPYAYTISNCSFLVCMSILAIMVGLERRCNAVNSGFYFNYWLLHFILCAVRARASGLSLKLKITNR-DYSRECFIFINLTFVTLSLVLSCFSEKVSQSEIERLNKKRKFQNVLHVNADDNHVSDRMEMSPNAVDSYKTTEKDILINKTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXX-XXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSH----DDTPGIAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSMENLKMDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNGN-KLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFIN---GFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWP-VGCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNLI 5017
            S DW   W + +PD   CFQ       P +   YL  CFP Y ++L R   ++R + ++T++   K AL   L ++   ++ Y+  +++    +   + +S     + M +   ++ LERR    +SG    +WL+  +LCA+    S +   LK   + D  R+   ++  + V + LVLSCFS           ++   F   +H                                      D   CPE  +SFLSRI F+W T LIV+GY+ PL+  DLW LN E+    +VP+L++N+ K  A  +++  K   ++ + K+ +                 P D++K    +  E    K  +++++P L   L K+  PY L+S  +K IHD++ F GP +LKLL+ FV+D++    W+GYF  AL+ ++A ++T +LHQYFHI F  GMR+++++I AVYRK+L ++ A+RK STVGEIVNLMS+DAQ+F++L +YI+MIWS P Q+I AL LLW  LGP +LAG+ +M+LM+PVNAV+   T+  Q   +K  D+RIK+MNEILNGIKVLKLYAWE +F + V  IR +ELK +K++AY  A  +FT+ C PFLV+L TF ++V I ++N+LDA+KAFVS+ LFNILRFPL +LPMVIS+++QASVSLKRL  FL  EE+  D++      D     + T++N  F W  + P P L  I  + PE  LVA+VG VGCGKSS+LSALL E+DK+EG+V +KGS+AYVPQQAWI N ++++NI+FG   +   Y+ +I+AC L  D EIL   D TEIGEKG+NLSGGQKQRVSLARA Y ++++YL DDPLSAVD+HVGK + +NVI   G+L   TRILVTH+++ L + D IIVM+ G +SE G+Y +L+   GAFA F+ T+ + E +     N            +  +     E  Q    M+ + S  ++        L+  L    +    +        EL    K GA+K    KL+E + ++ G VK++VY  Y+++IG +++   I LF+     +L SN WL  W+D   +              N +Q           +   + L +YG  G  Q +     S+  +   I ++  LH  LL+ +LR PMS FE  P G ++NRFS +L+ V +M+P  I    G L   + A +V ++ T     II PL L+   Y  +QR YV++SRQLKRLESV +SP+YSHF ETL GVS IRA+   ++FI  +D KVD+N  +YY + V+NRWLA+ LE VGN IV  AALFAVIS  +   ++AGLVGLSVSY+L +T  LNWLVRMSSE+E+NIV+VER++EYS+   EAPW I E  P  NWP VG ++F NY  +YRE LD VL++IN  IN  EKVGIVGRTG+GKSSL L LFRI E ++GEI+IDG+ I  +GLHD+R ++TIIPQDPVLFSG+LR NLDPF+++ DEE+W  LE+++LK F V++  ++L+   +EGGENLSVGQRQLVCLARALLR+T ILVLDEATAAVDL+TD LIQ TIR +F++CT+LTIAHRLNT++DY +++VL+ GEI E  AP++LL+     FY+MA+ + L+
Sbjct:   12 SPDWNVTWYTSNPDFTKCFQNTVLVWVPCF---YLWACFPFYFLYLSR---HDRGYIQMTLLNKTKTALGFLLWIVCWADLFYSFWERSRGIFLAPVFLVSPTLLGITMLLATFLIQLERRKGVQSSGIMLTFWLVA-LLCALAILRSKIMTALKEDAQVDLFRDITFYVYFSLVLIQLVLSCFS-----------DRSPLFSETIH--------------------------------------DPNPCPESSASFLSRITFWWITGLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRKQPVK---VVYSSKDPA----------------QPKDSSKVDANEEVEALIVKSPRKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPEILKLLINFVNDTKAPD-WQGYFYTALLFVAACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNAARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWRNLGPPILAGVAVMVLMVPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLKKSAYLAAVGTFTWVCTPFLVALCTFAVYVTIDKNNILDAQKAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRPVKDGGDTNSITVRNATFTWARSDP-PTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQNDSLQENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYCNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASAEQEQDPEDN-----------GVTGISGPGKEAKQMENGMLVTDSAGKQ--------LQRQLSSSSSYSGDVSRQHNSTAELQ---KDGAKKEETWKLMEADKAQTGQVKLSVYWDYMKAIGLFISFLSIFLFICNHVAALASNYWLSLWTDDPIV--------------NGTQ-----------EHTKVRLSVYGALGISQGIAVFGYSMAVSIGGILASRCLHVDLLHSILRSPMSFFERTPSGNLVNRFSKELDTVDSMIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIPPLGLI---YFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHS---LSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVAVERLKEYSETEKEAPWQIQETAPPSNWPQVGRVEFRNYCLRYREDLDFVLRHINVTINGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGINIARIGLHDLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWTSLELAHLKGF-VSALPDKLDHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVLDKGEIQEYGAPSDLLQQ-RGLFYNMARDAGLV 1528          
BLAST of Multidrug resistance-associated protein 1 vs. TrEMBL
Match: F6WW02 (ATP binding cassette subfamily C member 1 OS=Macaca mulatta OX=9544 GN=ABCC1 PE=4 SV=3)

HSP 1 Score: 1285.4 bits (3325), Expect = 0.000e+0
Identity = 729/1647 (44.26%), Postives = 1026/1647 (62.30%), Query Frame = 2
Query:  140 DWASEWNSPSPDIPTCFQ---FFDAPIYLLGYLILCFP-YIIHLIRKKVNERPFFKLTII---KLALIVCLMVLQILEIIYNAAKKNN---IPYAYTISNCSFLVCMSILAIMVGLERRCNAVNSGFYFNYWLLHFILCAVRARASGLSLKLK-ITNRDYSRECFIFINLTFVTLSLVLSCFSEKVSQSEIERLNKKRKFQNVLHVNADDNHVSDRMEMSPNAVDSYKTTEKDILINKTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXX-XXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSH----DDTPGIAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSMENLKMDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNGN-KLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFIN---GFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWP-VGCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNLI 5017
            DW   W + +PD   CFQ       P +   YL  CFP Y ++L R   ++R + ++T++   K AL   L ++   ++ Y+  +++    +   + +S     + M +   ++ LERR    +SG    +WL+  +LCA+    S +   LK     D  R+   ++  + V + LVLSCFS           ++   F   +H                                      D   CPE  +SFLSRI F+W T LIV+GY+ PL+  DLW LN E+    +VP+L++N+ K  A  +++  K   ++ + K+ +                 P D++K    +  E    K  +++++P L   L K+  PY L+S  +K IHD++ F GP +LKLL+ FV+D++    W+GYF  AL+ ++A ++T +LHQYFHI F  GMR+++++I AVYRK+L ++ A+RK STVGEIVNLMS+DAQ+F++L +YI+MIWS P Q+I AL LLW  LGP +LAG+ +M+LM+PVNAV+   T+  Q   +K  D+RIK+MNEILNGIKVLKLYAWE +F + V  IR +ELK +K++AY  A  +FT+ C PFLV+L TF ++V I ++N+LDA+KAFVS+ LFNILRFPL +LPMVIS+++QASVSLKRL  FL  EE+  D++      D     + T++N  F W  + P P L  I  + PE  LVA+VG VGCGKSS+LSALL E+DK+EG+V +KGS+AYVPQQAWI N ++++NI+FG   +   Y+ +I+AC L  D EIL   D TEIGEKG+NLSGGQKQRVSLARA Y ++++YL DDPLSAVD+HVGK + +NVI   G+L   TRILVTH+++ L + D IIVM+ G +SE G+Y +L+   GAFA F+ T+ + E +     N            +  +     E  Q    M+ + S  ++        L+  L    +    +        EL    K GA+K    KL+E + ++ G VK++VY  Y+++IG +++   I LF+     +L SN WL  W+D   +              N +Q           +   + L +YG  G  Q +     S+  +   I ++  LH  LL+ +LR PMS FE  P G ++NRFS +L+ V +M+P  I    G L   + A +V ++ T     II PL L+   Y  +QR YV++SRQLKRLESV +SP+YSHF ETL GVS IRA+   ++FI  +D KVD+N  +YY + V+NRWLA+ LE VGN IV  AALFAVIS  +   ++AGLVGLSVSY+L +T  LNWLVRMSSE+E+NIV+VER++EYS+   EAPW I E  P  NWP VG ++F NY  +YRE LD VL++IN  IN  EKVGIVGRTG+GKSSL L LFRI E ++GEI+IDG+ I  +GLHD+R ++TIIPQDPVLFSG+LR NLDPF+++ DEE+W  LE+++LK F V++  ++L+   +EGGENLSVGQRQLVCLARALLR+T ILVLDEATAAVDL+TD LIQ TIR +F++CT+LTIAHRLNT++DY +++VL+ GEI E  AP++LL+     FY+MA+ + L+
Sbjct:   17 DWNVTWYTSNPDFTKCFQNTVLVWVPCF---YLWACFPFYFLYLSR---HDRGYIQMTLLNKTKTALGFLLWIVCWADLFYSFWERSRGIFLAPVFLVSPTLLGITMLLATFLIQLERRKGVQSSGIMLTFWLVA-LLCALAILRSKIMTALKEDVQVDLFRDITFYVYFSLVLIQLVLSCFS-----------DRSPLFSETIH--------------------------------------DPNPCPESSASFLSRITFWWITGLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRKQPVK---VVYSSKDPA----------------QPKDSSKVDANEEVEALIVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPEILKLLINFVNDTKAPD-WQGYFYTALLFVAACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNAARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWRNLGPPILAGVAVMVLMVPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLKKSAYLAAVGTFTWVCTPFLVALCTFAVYVTIDKNNILDAQKAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRPVKDGGDTNSVTVRNATFTWARSDP-PTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQNDSLQENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYCNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASAEQEQDPEDN-----------GVTGISGPGKEAKQMENGMLVTDSAGKQ--------LQRQLSSSSSYSGDVSRQHNSTAELQ---KDGAKKEETWKLMEADKAQTGQVKLSVYWDYMKAIGLFISFLSIFLFICNHVAALASNYWLSLWTDDPIV--------------NGTQ-----------EHTKVRLSVYGALGISQGIAVFGYSMAVSIGGILASRCLHVDLLHSILRSPMSFFERTPSGNLVNRFSKELDTVDSMIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIPPLGLI---YFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHS---LSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVAVERLKEYSETEKEAPWQIQETAPPSNWPQVGRVEFRNYCLRYREDLDFVLRHINVTINGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGINIARIGLHDLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWTSLELAHLKGF-VSALPDKLDHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVLDKGEIQEYGAPSDLLQQ-RGLFYNMARDAGLV 1531          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Cavefish
Match: abcc3 (ATP binding cassette subfamily C member 3 [Source:NCBI gene;Acc:103023748])

HSP 1 Score: 1258.82 bits (3256), Expect = 0.000e+0
Identity = 707/1631 (43.35%), Postives = 1008/1631 (61.80%), Query Frame = 2
Query:  170 PDIPTCFQFFDAPIYLLGYLILCFPYIIHLIRKKVNERPFFKLTIIKLALIVCLMVLQI-----LEIIYNAAKKNNIPYAYTISNCSFLVCMSILAIMVGLERRCNAVNSGFYFNYWLLHFILCAVRARASGLSLKLKITNRDYSRECFIFINLTFVTLSLVLSCFSEKVSQSEIERLNKKRKFQNVLHVNADDNHVSDRMEMSPNAVDSYKTTEKDILINKTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXXXXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSHDDTPG-IAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSMENLKMDLEKDVANITKLEDNKRCQEELDKFLKPG------AQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPW---IIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWPV-GCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNL 5014
            PD+P CFQ          YL L  P  ++L   K N R +  ++I+     V   +L I     L   ++  K+ ++P  Y I+     + M +   ++  ER     +SG  F +W+L  +LCA+    S +    K  N D  R    ++    + + L+L CF+EK                                   P    S  T              D   CPE  + FLSR+ F+WFT + +KGYK PL+ +DLW LN ++    +VP LLR ++   +  +  +   +      K  +   + E+   E E L S    +K+  PQ              P  + +L+K+  PY L+   +K++ D++ F+ P LL++L++F  ++    +W G+ +A +M   A+++T ILHQ+F   F  GMR+R+++I A+YRKSL ++  +++ STVGE+VNLMS+DAQ+F++L ++++M+WS P QII AL  LW  LGPSVLAG+ +M+L+IP NAVI   TR  Q +Q++  D+RIK+MNEILNGIKVLKLYAWE SF   V +IR KEL  +++ AY +A  +  +  APFLV+LTTF ++V + ++NVLDA+KAFVS++LFNILRFPL MLP VIS+L+QASVSLKR+  FL  +E++ D V     P   A T+ NG F W    P P L++IN+  P+  L+A+VG VGCGKSS+++ALLGE++KLEG+++++GS+AYVPQQAWI NAT+RDNI+FG PY   KY+ +++AC L  D E+L   D TEIGEKGINLSGGQ+QRVSLARA YS+++VYL+DDPLSAVD+HV K + D+VI   G L G TRILVTH ++ L + D I+V+  GMVSE G+Y DL++  GAFA F+  +  +++   +       + EE          T    N+   N      ++R +  + +  +  DLE      TK    +RC E      +PG       +    KLI+ ET++ G VK  VY  Y +++G  L+  I  L+ +    ++G+N+WL +W++ S+ +              ++Q+++            + +G+Y   G  Q ++ +FSS   A   I++A  LH+ LL+     P + F+T P+GRIINRFS D+  +   LP  I  FL T   ++   I++    P    +I+PL+L+   Y  +QR YV+TSRQLKRLESV +SPIYSHF ET+ G S IRAY     F+  +D KVD+N  SYY   VSNRWL I +E +GN IV  AA+FAV+  +N   ++ GLVGLSVSYAL +T +LNW+VRM+S++ESNIV+VER++EYS+ PPEAPW++ +KKP  +WP  G ++F +YS +YREGLD VL+NI+  +   EK+GIVGRTG+GKSS+ L LFR+LE + GEI IDG+ I E+GLHD+R +LTIIPQ+PVLFSGTLR NLDPF K+ D+++W  L +S+L  FV N    +L +  SEGGENLSVGQRQL+CLARALLR+T IL+LDEATAA+DL+TD LIQ TIR +F++CT+ TIAHRLNT++DY +ILVL+ G+I E D P NL+   +  FYSMAK + L
Sbjct:   22 PDLPECFQLSVLAWIPCFYLWLVSP--LYLFYLKRNNRGYIMMSILNRVKTVFGFILWIVCWTDLFASFHEIKEKDVPPIYFITPLIVGMTMLLATFIIQFERLRGVQSSGVLFIFWMLS-VLCAIVPFRSKILHANKGENVDKLRFTTFYMYFGLILVELILCCFNEK-----------------------------------PPLFSSVVT--------------DPNPCPESTAGFLSRMTFWWFTSMAIKGYKSPLETKDLWSLNKQDSSELVVPKLLREWEGEKSKAQSIEQDVNGQAVYSKAGAETNHVEVNPEEVEVLLS----SKKDTPQ--------------PSFLRSLLKAFGPYFLIGSAFKLLQDLITFINPQLLRMLIEFTKETGVPSWW-GFALAFMMFGCALLQTLILHQHFQYCFVTGMRLRTAIIGAIYRKSLVITNEAKRSSTVGEVVNLMSVDAQRFMDLTTFLNMLWSAPLQIILALFFLWQTLGPSVLAGVAVMVLLIPFNAVIAMKTRAYQVEQMQYKDARIKLMNEILNGIKVLKLYAWEVSFKEKVLQIRQKELNVLRKTAYLSALSTMAWTSAPFLVALTTFAVYVSVDKNNVLDADKAFVSLSLFNILRFPLNMLPQVISSLVQASVSLKRIQAFLSHDELDPDNVDKKPAPSDHAVTVVNGKFSWAKKDP-PALQHINVMVPQGSLLAVVGHVGCGKSSLVAALLGEMEKLEGHISIRGSVAYVPQQAWIQNATLRDNILFGRPYVEQKYRCVLEACALTPDLEVLPGGDLTEIGEKGINLSGGQRQRVSLARALYSEADVYLMDDPLSAVDAHVAKHIFDHVIGPEGALRGKTRILVTHGISFLPQVDNILVLVEGMVSEMGSYQDLLKQNGAFAEFLRNYSLEDIIEEDEVTEVLIDEEESFPDDALSNHTDMVDNEPAVN------EARRQFMRQISIMSNDLENPK---TKSIRKRRCSER-----RPGEPPQEKKEPKVEKLIQAETAETGRVKFKVYWEYAKAVGPILSLFICFLYASQSAAAIGANIWLSQWTNDSRDSV-------------TAQEKV-----------HMRVGVYASLGITQGILVMFSSFTLAMGKIQAARKLHQGLLDNKFHTPQAFFDTTPLGRIINRFSKDIYVIDEALPSTILMFLGTFFASVATMIVIVSSTPIFAVVIVPLALV---YFFVQRFYVATSRQLKRLESVSRSPIYSHFSETITGTSVIRAYGRNSAFVLMSDMKVDENQKSYYPGIVSNRWLGIRIEFIGNCIVLFAAVFAVLEKEN---LSPGLVGLSVSYALQVTMSLNWMVRMTSDLESNIVAVERVKEYSETPPEAPWEVEDKKPPTDWPSEGNVEFADYSVRYREGLDLVLRNISLRVKGGEKIGIVGRTGAGKSSMTLCLFRLLEAAGGEITIDGVKIKEIGLHDLRSKLTIIPQEPVLFSGTLRMNLDPFEKYSDDDMWNALTLSHLHKFVSNQ-PAKLALECSEGGENLSVGQRQLICLARALLRKTRILILDEATAAIDLETDDLIQSTIRTQFEDCTVFTIAHRLNTIMDYTRILVLDKGQIAEFDTPVNLIAQ-KGIFYSMAKDAGL 1534          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Cavefish
Match: abcc3 (ATP binding cassette subfamily C member 3 [Source:NCBI gene;Acc:103023748])

HSP 1 Score: 1254.97 bits (3246), Expect = 0.000e+0
Identity = 700/1629 (42.97%), Postives = 1012/1629 (62.12%), Query Frame = 2
Query:  170 PDIPTCFQFFDAPIYLLGYLILCFPYIIHLIRKKVNERPFFKLTIIKLALIVCLMVLQI-----LEIIYNAAKKNNIPYAYTISNCSFLVCMSILAIMVGLERRCNAVNSGFYFNYWLLHFILCAVRARASGLSLKLKITNRDYSRECFIFINLTFVTLSLVLSCFSEKVSQSEIERLNKKRKFQNVLHVNADDNHVSDRMEMSPNAVDSYKTTEKDILINKTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXXXXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSHDDTPG-IAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSMENLKMDLEKDVANITKLEDNKRCQEELDKFLKPG------AQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXX-XXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWPV-GCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNL 5014
            PD+P CFQ          YL L  P  ++L   K N R +  ++I+     V   +L I     L   ++  K+ ++P  Y I+     + M +   ++  ER     +SG  F +W+L  +LCA+    S +    K  N D  R    ++    + + L+L CF+EK                                   P    S  T              D   CPE  + FLSR+ F+WFT + +KGYK PL+ +DLW LN ++    +VP LLR ++   +  +  +   +      K  +   + E+   E E L S    +K+  PQ              P  + +L+K+  PY L+   +K++ D++ F+ P LL++L++F  ++    +W G+ +A +M   A+++T ILHQ+F   F  GMR+R+++I A+YRKSL ++  +++ STVGE+VNLMS+DAQ+F++L ++++M+WS P QII AL  LW  LGPSVLAG+ +M+L+IP NAVI   TR  Q +Q++  D+RIK+MNEILNGIKVLKLYAWE SF   V +IR KEL  +++ AY +A  +  +  APFLV+LTTF ++V + ++NVLDA+KAFVS++LFNILRFPL MLP VIS+L+QASVSLKR+  FL  +E++ D V     P   A T+ NG F W    P P L++IN+  P+  L+A+VG VGCGKSS+++ALLGE++KLEG+++++GS+AYVPQQAWI NAT+RDNI+FG PY   KY+ +++AC L  D E+L   D TEIGEKGINLSGGQ+QRVSLARA YS+++VYL+DDPLSAVD+HV K + D+VI   G L G TRILVTH ++ L + D I+V+  GMVSE G+Y DL++  GAFA F+  +  +++   +       + EE          T    N+   N      ++R +  + +  +  DLE      TK    +RC E      +PG       +    KLI+ ET++ G VK  VY  Y +++G  L+  I  L+ +    ++G+N+WL +W++ S+ +              ++Q+++            + +G+Y   G  Q ++ L + L   A++++K+A + H  +L+ VLR P + FE  P GR++NRFS D++ + +++P  I+ ++ T    + V ++ +   P  +I +  ++ FY  +QR YV+TSRQLKRLESV +SPIYSHF ET+ G S IRAY     F+  +D KVD+N  SYY   VSNRWL I +E +GN IV  AA+FAV+  +N   ++ GLVGLSVSYAL +T +LNW+VRM+S++ESNIV+VER++EYS+ PPEAPW++ +KKP  +WP  G ++F +YS +YREGLD VL+NI+  +   EK+GIVGRTG+GKSS+ L LFR+LE + GEI IDG+ I E+GLHD+R +LTIIPQ+PVLFSGTLR NLDPF K+ D+++W  L +S+L  FV N    +L +  SEGGENLSVGQRQL+CLARALLR+T IL+LDEATAA+DL+TD LIQ TIR +F++CT+ TIAHRLNT++DY +ILVL+ G+I E D P NL+   +  FYSMAK + L
Sbjct:   22 PDLPECFQLSVLAWIPCFYLWLVSP--LYLFYLKRNNRGYIMMSILNRVKTVFGFILWIVCWTDLFASFHEIKEKDVPPIYFITPLIVGMTMLLATFIIQFERLRGVQSSGVLFIFWMLS-VLCAIVPFRSKILHANKGENVDKLRFTTFYMYFGLILVELILCCFNEK-----------------------------------PPLFSSVVT--------------DPNPCPESTAGFLSRMTFWWFTSMAIKGYKSPLETKDLWSLNKQDSSELVVPKLLREWEGEKSKAQSIEQDVNGQAVYSKAGAETNHVEVNPEEVEVLLS----SKKDTPQ--------------PSFLRSLLKAFGPYFLIGSAFKLLQDLITFINPQLLRMLIEFTKETGVPSWW-GFALAFMMFGCALLQTLILHQHFQYCFVTGMRLRTAIIGAIYRKSLVITNEAKRSSTVGEVVNLMSVDAQRFMDLTTFLNMLWSAPLQIILALFFLWQTLGPSVLAGVAVMVLLIPFNAVIAMKTRAYQVEQMQYKDARIKLMNEILNGIKVLKLYAWEVSFKEKVLQIRQKELNVLRKTAYLSALSTMAWTSAPFLVALTTFAVYVSVDKNNVLDADKAFVSLSLFNILRFPLNMLPQVISSLVQASVSLKRIQAFLSHDELDPDNVDKKPAPSDHAVTVVNGKFSWAKKDP-PALQHINVMVPQGSLLAVVGHVGCGKSSLVAALLGEMEKLEGHISIRGSVAYVPQQAWIQNATLRDNILFGRPYVEQKYRCVLEACALTPDLEVLPGGDLTEIGEKGINLSGGQRQRVSLARALYSEADVYLMDDPLSAVDAHVAKHIFDHVIGPEGALRGKTRILVTHGISFLPQVDNILVLVEGMVSEMGSYQDLLKQNGAFAEFLRNYSLEDIIEEDEVTEVLIDEEESFPDDALSNHTDMVDNEPAVN------EARRQFMRQISIMSNDLENPK---TKSIRKRRCSER-----RPGEPPQEKKEPKVEKLIQAETAETGRVKFKVYWEYAKAVGPILSLFICFLYASQSAAAIGANIWLSQWTNDSRDSV-------------TAQEKVH-----------MRVGVYASLGITQGVLILANCLLCRAYSMLKAAHATHLTMLHAVLRAPQAFFEATPSGRLLNRFSKDVDTIDSLIPDNIDIWMRTFWYTVNVLLVCSALTPMFLIVIVPLMMFYWWVQRFYVATSRQLKRLESVSRSPIYSHFSETITGTSVIRAYGRNSAFVLMSDMKVDENQKSYYPGIVSNRWLGIRIEFIGNCIVLFAAVFAVLEKEN---LSPGLVGLSVSYALQVTMSLNWMVRMTSDLESNIVAVERVKEYSETPPEAPWEVEDKKPPTDWPSEGNVEFADYSVRYREGLDLVLRNISLRVKGGEKIGIVGRTGAGKSSMTLCLFRLLEAAGGEITIDGVKIKEIGLHDLRSKLTIIPQEPVLFSGTLRMNLDPFEKYSDDDMWNALTLSHLHKFVSNQ-PAKLALECSEGGENLSVGQRQLICLARALLRKTRILILDEATAAIDLETDDLIQSTIRTQFEDCTVFTIAHRLNTIMDYTRILVLDKGQIAEFDTPVNLIAQ-KGIFYSMAKDAGL 1535          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Cavefish
Match: abcc1 (ATP binding cassette subfamily C member 1 [Source:NCBI gene;Acc:103043969])

HSP 1 Score: 1234.94 bits (3194), Expect = 0.000e+0
Identity = 667/1400 (47.64%), Postives = 913/1400 (65.21%), Query Frame = 2
Query:  836 DLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXXXXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSHDDTPGIAATIK--NGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSMENLKMDLEKDVANITKLEDNKRCQ--EELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWP-VGCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSG-NEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNLI 5017
            D   CPE  +SFLSRI F+W T L+V+GYK PL+ +DLW LN E+R  ++VP L+R +D   +  KR D   DK + + K  S                     + R + ++        ++  DP L  AL ++  PY L+S +YKIIHD+L F+GP +L+LL+QFV+DS+    W GYF  AL+ +    +T IL +YFH+ F  GMR+R++++ AVYRK+L ++ A+R+ STVGEIVNLMS+DAQ+F++LI+YI+MIWS P Q+I AL  LW  LGPSVLAG+ +M+LM+PVNAVI   T+  Q  Q+K  D+RIK+MNE+LNGIKVLKLYAWE +F + V+ IR  EL+ +K+AAY  A  +FT+ CAPFLV+L+TF ++VL+   NVLDA+KAFVS+ LFNILRFPL MLPMVIS+++QASVS+KRL  FL  EE+++++V      G A +I+  +G F W S    P LK IN+  PE  LVA+VG VG GKSS+LSALLGE+ K EG V++KGS+AYVPQQAWI NAT+R+NI+FG       YQ++++AC L  D EIL   D TEIGEKG+NLSGGQKQRVSLARA Y D +VYLLDDPLSAVD+HVGK + + VI   G+L G TR+LVTH L+ L + D I+VM +G ++E G+Y++L+   GAFA+F+                                RTY+   Q        ++  +EK+ ++   +     +  +++      K  Q  E  D   K     +  KL E + +  G VK+AV+  Y+++IG +L+   ILLF+     SLGSN WL  W+D   I              N +Q             R++ LG+YG  G  Q +     S+  +   I ++  LH+ +L  VLR PMS FE  P G ++NRF+ + + + +++P  I  F+ +    +    ++ I  P + I +  +   Y  +QR YV++SRQLKRLESV +SP+Y+HF ETL G S IRA+    +FI  +D +VD N  +Y+ + V+NRWLA+ LE VGN IV  AALFAV++  N   ++ G++GLS+SYAL +T +LNWLVRMSSEVE+NIV+VER++EY     EA W + +      WP  G I+  N+  +YRE L+  + +I  II   EKVGIVGRTG+GKSSL L LFRI+E + GEI IDG+ I  LGLHD+R R+TIIPQDPVLFSG+LR NLDPF+ + DE++W+ LE+++LK FV  SG  ++L    SEGGENLS+GQRQLVCLARALLR+T ILVLDEATAAVDL+TD LIQ TIR +F++CT+LTIAHRLNT++DY ++LVL+ G++ E D+P +L+   +  FY MAK S L+
Sbjct:  204 DSNPCPEAGASFLSRISFWWITGLMVQGYKRPLEEKDLWSLNAEDRSHTVVPQLVRRWDHECSKGKRTD---DKTMYSPKRPS----------------MAEKKDGRPVEESEILLIKAPQKSGDPSLFLALCRTFGPYFLVSSIYKIIHDVLMFVGPEILRLLIQFVNDSDAPS-WHGYFYTALLFVCTCFQTLILQKYFHVCFVTGMRLRTAIVGAVYRKALVITNAARRTSTVGEIVNLMSVDAQRFMDLITYINMIWSAPLQVILALYFLWQNLGPSVLAGVAVMVLMVPVNAVIAMKTKTYQVAQMKSKDNRIKLMNEVLNGIKVLKLYAWELAFKDKVSTIRESELRVLKKAAYLGAISTFTWVCAPFLVALSTFAVYVLVDEHNVLDAQKAFVSLALFNILRFPLNMLPMVISSMVQASVSMKRLRVFLSHEELDENSVDRRAITGSADSIRIGDGAFSW-SKEDRPALKRINVRIPEGALVAVVGHVGSGKSSLLSALLGEMHKQEGDVSIKGSVAYVPQQAWIQNATLRENIMFGQEKKESWYQKVLEACALLPDLEILPGGDTTEIGEKGVNLSGGQKQRVSLARAVYCDCSVYLLDDPLSAVDAHVGKHIFEKVIGPQGVLQGRTRVLVTHGLSFLPQADLILVMVDGEITETGSYTELLNRQGAFADFL--------------------------------RTYANAEQDGEP--DGMTGKKEKLQRNTTFVHFFPRQSQSSLNTPGAAKPQQKAESNDTQAKKTKSPDAAKLTEADKANTGRVKLAVFWEYMKAIGVFLSFISILLFLAHHVSSLGSNYWLSLWTDDPVI--------------NGTQP-----------SREMRLGVYGALGLSQGIAVFCYSISVSIGGILASRYLHETMLYNVLRSPMSFFERTPSGNLVNRFAKETDTIDSVIPSIIKMFMGSMFNVLGSCAVILIATPLVAIIIPPLGLLYFFVQRFYVASSRQLKRLESVSRSPVYTHFNETLLGTSVIRAFGEQQRFIGESDRRVDHNQKAYFPSIVANRWLAVRLEFVGNCIVTFAALFAVMARAN---LSPGIMGLSISYALQVTASLNWLVRMSSEVETNIVAVERVKEYEDTEKEAEWKLEQSSVPAGWPTAGHIEVRNFGLRYREDLELAIHDITVIIEGGEKVGIVGRTGAGKSSLTLGLFRIIEAAQGEICIDGVNIANLGLHDLRSRITIIPQDPVLFSGSLRMNLDPFDGYSDEDVWRALELAHLKNFV--SGLPDKLNHECSEGGENLSLGQRQLVCLARALLRKTKILVLDEATAAVDLETDNLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVLVLDKGKMAEFDSPASLIAK-KGIFYKMAKDSGLV 1517          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Cavefish
Match: abcc1 (ATP binding cassette subfamily C member 1 [Source:NCBI gene;Acc:103043969])

HSP 1 Score: 1234.94 bits (3194), Expect = 0.000e+0
Identity = 665/1398 (47.57%), Postives = 907/1398 (64.88%), Query Frame = 2
Query:  836 DLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXXXXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSHDDTPGIAATIK--NGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSMENLKMDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWP-VGCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSG-NEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNLI 5017
            D   CPE  +SFLSRI F+W T L+V+GYK PL+ +DLW LN E+R  ++VP L+R +D   +  KR D   DK + + K  S                     + R + ++        ++  DP L  AL ++  PY L+S +YKIIHD+L F+GP +L+LL+QFV+DS+    W GYF  AL+ +    +T IL +YFH+ F  GMR+R++++ AVYRK+L ++ A+R+ STVGEIVNLMS+DAQ+F++LI+YI+MIWS P Q+I AL  LW  LGPSVLAG+ +M+LM+PVNAVI   T+  Q  Q+K  D+RIK+MNE+LNGIKVLKLYAWE +F + V+ IR  EL+ +K+AAY  A  +FT+ CAPFLV+L+TF ++VL+   NVLDA+KAFVS+ LFNILRFPL MLPMVIS+++QASVS+KRL  FL  EE+++++V      G A +I+  +G F W S    P LK IN+  PE  LVA+VG VG GKSS+LSALLGE+ K EG V++KGS+AYVPQQAWI NAT+R+NI+FG       YQ++++AC L  D EIL   D TEIGEKG+NLSGGQKQRVSLARA Y D +VYLLDDPLSAVD+HVGK + + VI   G+L G TR+LVTH L+ L + D I+VM +G ++E G+Y++L+   GAFA+F+                                RTY+   Q       +    R+ +        +   +   N       ++  E  D   K     +  KL E + +  G VK+AV+  Y+++IG +L+   ILLF+     SLGSN WL  W+D   I              N +Q             R++ LG+YG  G  Q +     S+  +   I ++  LH+ +L  VLR PMS FE  P G ++NRF+ + + + +++P  I  F+ +    +    ++ I  P + I +  +   Y  +QR YV++SRQLKRLESV +SP+Y+HF ETL G S IRA+    +FI  +D +VD N  +Y+ + V+NRWLA+ LE VGN IV  AALFAV++  N   ++ G++GLS+SYAL +T +LNWLVRMSSEVE+NIV+VER++EY     EA W + +      WP  G I+  N+  +YRE L+  + +I  II   EKVGIVGRTG+GKSSL L LFRI+E + GEI IDG+ I  LGLHD+R R+TIIPQDPVLFSG+LR NLDPF+ + DE++W+ LE+++LK FV  SG  ++L    SEGGENLS+GQRQLVCLARALLR+T ILVLDEATAAVDL+TD LIQ TIR +F++CT+LTIAHRLNT++DY ++LVL+ G++ E D+P +L+   +  FY MAK S L+
Sbjct:  204 DSNPCPEAGASFLSRISFWWITGLMVQGYKRPLEEKDLWSLNAEDRSHTVVPQLVRRWDHECSKGKRTD---DKTMYSPKRPS----------------MAEKKDGRPVEESEILLIKAPQKSGDPSLFLALCRTFGPYFLVSSIYKIIHDVLMFVGPEILRLLIQFVNDSDAPS-WHGYFYTALLFVCTCFQTLILQKYFHVCFVTGMRLRTAIVGAVYRKALVITNAARRTSTVGEIVNLMSVDAQRFMDLITYINMIWSAPLQVILALYFLWQNLGPSVLAGVAVMVLMVPVNAVIAMKTKTYQVAQMKSKDNRIKLMNEVLNGIKVLKLYAWELAFKDKVSTIRESELRVLKKAAYLGAISTFTWVCAPFLVALSTFAVYVLVDEHNVLDAQKAFVSLALFNILRFPLNMLPMVISSMVQASVSMKRLRVFLSHEELDENSVDRRAITGSADSIRIGDGAFSW-SKEDRPALKRINVRIPEGALVAVVGHVGSGKSSLLSALLGEMHKQEGDVSIKGSVAYVPQQAWIQNATLRENIMFGQEKKESWYQKVLEACALLPDLEILPGGDTTEIGEKGVNLSGGQKQRVSLARAVYCDCSVYLLDDPLSAVDAHVGKHIFEKVIGPQGVLQGRTRVLVTHGLSFLPQADLILVMVDGEITETGSYTELLNRQGAFADFL--------------------------------RTYANAEQDGEPDGMTDGAPRKTLENGGPAAVLRQSQSSLNTPGAAKPQQKAESNDTQAKKTKSPDAAKLTEADKANTGRVKLAVFWEYMKAIGVFLSFISILLFLAHHVSSLGSNYWLSLWTDDPVI--------------NGTQP-----------SREMRLGVYGALGLSQGIAVFCYSISVSIGGILASRYLHETMLYNVLRSPMSFFERTPSGNLVNRFAKETDTIDSVIPSIIKMFMGSMFNVLGSCAVILIATPLVAIIIPPLGLLYFFVQRFYVASSRQLKRLESVSRSPVYTHFNETLLGTSVIRAFGEQQRFIGESDRRVDHNQKAYFPSIVANRWLAVRLEFVGNCIVTFAALFAVMARAN---LSPGIMGLSISYALQVTASLNWLVRMSSEVETNIVAVERVKEYEDTEKEAEWKLEQSSVPAGWPTAGHIEVRNFGLRYREDLELAIHDITVIIEGGEKVGIVGRTGAGKSSLTLGLFRIIEAAQGEICIDGVNIANLGLHDLRSRITIIPQDPVLFSGSLRMNLDPFDGYSDEDVWRALELAHLKNFV--SGLPDKLNHECSEGGENLSLGQRQLVCLARALLRKTKILVLDEATAAVDLETDNLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVLVLDKGKMAEFDSPASLIAK-KGIFYKMAKDSGLV 1517          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Cavefish
Match: abcc3 (ATP binding cassette subfamily C member 3 [Source:NCBI gene;Acc:103023748])

HSP 1 Score: 1234.55 bits (3193), Expect = 0.000e+0
Identity = 658/1400 (47.00%), Postives = 929/1400 (66.36%), Query Frame = 2
Query:  848 CPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXXXXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSHDDTPG-IAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSMENLKMDLEKDVANITKLEDNKRCQEELDKFLKPG------AQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPW---IIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWPV-GCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNL 5014
            CPE  + FLSR+ F+WFT + +KGYK PL+ +DLW LN ++    +VP LLR ++   +  +  +   +      K  +   + E+   E E L S    +K+  PQ              P  + +L+K+  PY L+   +K++ D++ F+ P LL++L++F  ++    +W G+ +A +M   A+++T ILHQ+F   F  GMR+R+++I A+YRKSL ++  +++ STVGE+VNLMS+DAQ+F++L ++++M+WS P QII AL  LW  LGPSVLAG+ +M+L+IP NAVI   TR  Q +Q++  D+RIK+MNEILNGIKVLKLYAWE SF   V +IR KEL  +++ AY +A  +  +  APFLV+LTTF ++V + ++NVLDA+KAFVS++LFNILRFPL MLP VIS+L+QASVSLKR+  FL  +E++ D V     P   A T+ NG F W    P P L++IN+  P+  L+A+VG VGCGKSS+++ALLGE++KLEG+++++GS+AYVPQQAWI NAT+RDNI+FG PY   KY+ +++AC L  D E+L   D TEIGEKGINLSGGQ+QRVSLARA YS+++VYL+DDPLSAVD+HV K + D+VI   G L G TRILVTH ++ L + D I+V+  GMVSE G+Y DL++  GAFA F+  +  +++   +       + EE          T    N+   N      ++R +  + +  +  DLE      TK    +RC E      +PG       +    KLI+ ET++ G VK  VY  Y +++G  L+  I  L+ +    ++G+N+WL +W++ S+ +              ++Q+++            + +G+Y   G  Q ++ +FSS   A   I++A  LH+ LL+     P + F+T P+GRIINRFS D+  +   LP  I  FL T   ++   I++    P    +I+PL+L+   Y  +QR YV+TSRQLKRLESV +SPIYSHF ET+ G S IRAY     F+  +D KVD+N  SYY   VSNRWL I +E +GN IV  AA+FAV+  +N   ++ GLVGLSVSYAL +T +LNW+VRM+S++ESNIV+VER++EYS+ PPEAPW++ +KKP  +WP  G ++F +YS +YREGLD VL+NI+  +   EK+GIVGRTG+GKSS+ L LFR+LE + GEI IDG+ I E+GLHD+R +LTIIPQ+PVLFSGTLR NLDPF K+ D+++W  L +S+L  FV N    +L +  SEGGENLSVGQRQL+CLARALLR+T IL+LDEATAA+DL+TD LIQ TIR +F++CT+ TIAHRLNT++DY +ILVL+ G+I E D P NL+   +  FYSMAK + L
Sbjct:  159 CPESTAGFLSRMTFWWFTSMAIKGYKSPLETKDLWSLNKQDSSELVVPKLLREWEGEKSKAQSIEQDVNGQAVYSKAGAETNHVEVNPEEVEVLLS----SKKDTPQ--------------PSFLRSLLKAFGPYFLIGSAFKLLQDLITFINPQLLRMLIEFTKETGVPSWW-GFALAFMMFGCALLQTLILHQHFQYCFVTGMRLRTAIIGAIYRKSLVITNEAKRSSTVGEVVNLMSVDAQRFMDLTTFLNMLWSAPLQIILALFFLWQTLGPSVLAGVAVMVLLIPFNAVIAMKTRAYQVEQMQYKDARIKLMNEILNGIKVLKLYAWEVSFKEKVLQIRQKELNVLRKTAYLSALSTMAWTSAPFLVALTTFAVYVSVDKNNVLDADKAFVSLSLFNILRFPLNMLPQVISSLVQASVSLKRIQAFLSHDELDPDNVDKKPAPSDHAVTVVNGKFSWAKKDP-PALQHINVMVPQGSLLAVVGHVGCGKSSLVAALLGEMEKLEGHISIRGSVAYVPQQAWIQNATLRDNILFGRPYVEQKYRCVLEACALTPDLEVLPGGDLTEIGEKGINLSGGQRQRVSLARALYSEADVYLMDDPLSAVDAHVAKHIFDHVIGPEGALRGKTRILVTHGISFLPQVDNILVLVEGMVSEMGSYQDLLKQNGAFAEFLRNYSLEDIIEEDEVTEVLIDEEESFPDDALSNHTDMVDNEPAVN------EARRQFMRQISIMSNDLENPK---TKSIRKRRCSER-----RPGEPPQEKKEPKVEKLIQAETAETGRVKFKVYWEYAKAVGPILSLFICFLYASQSAAAIGANIWLSQWTNDSRDSV-------------TAQEKV-----------HMRVGVYASLGITQGILVMFSSFTLAMGKIQAARKLHQGLLDNKFHTPQAFFDTTPLGRIINRFSKDIYVIDEALPSTILMFLGTFFASVATMIVIVSSTPIFAVVIVPLALV---YFFVQRFYVATSRQLKRLESVSRSPIYSHFSETITGTSVIRAYGRNSAFVLMSDMKVDENQKSYYPGIVSNRWLGIRIEFIGNCIVLFAAVFAVLEKEN---LSPGLVGLSVSYALQVTMSLNWMVRMTSDLESNIVAVERVKEYSETPPEAPWEVEDKKPPTDWPSEGNVEFADYSVRYREGLDLVLRNISLRVKGGEKIGIVGRTGAGKSSMTLCLFRLLEAAGGEITIDGVKIKEIGLHDLRSKLTIIPQEPVLFSGTLRMNLDPFEKYSDDDMWNALTLSHLHKFVSNQ-PAKLALECSEGGENLSVGQRQLICLARALLRKTRILILDEATAAIDLETDDLIQSTIRTQFEDCTVFTIAHRLNTIMDYTRILVLDKGQIAEFDTPVNLIAQ-KGIFYSMAKDAGL 1492          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Sea Lamprey
Match: abcc3 (ATP-binding cassette, sub-family C (CFTR/MRP), member 3 [Source:ZFIN;Acc:ZDB-GENE-050517-16])

HSP 1 Score: 1065.06 bits (2753), Expect = 0.000e+0
Identity = 594/1414 (42.01%), Postives = 865/1414 (61.17%), Query Frame = 2
Query:  818 KTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSI---PQNAXXXXXXXXXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSHDDTPG----IAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATH----LADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSMENLKMDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWL-AIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWPV-GCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNL-KTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNLI 5017
             TD + D   CPE  +SF+SR+ F WFT + V GY+  LK  DLW L  ++ CS +VP L   + K  A   +R + S                          ++P +  K       Q+    T+      +P L+ A+  +  P  L+  +YK++ DIL+F  P+LL  L++FV D+  R  W GY +A LM + A+  + + HQ+FH  F  G+R+RS+L   +YRK+L ++ A+R     GE+  LMS+D Q   ++ + ++ +WS P  I  A+  LW  LGPSVLAG+ +MLL+IP NA I    R +QAQ IK  D R++ ++E L+G++++K+YAWE  F + +  +R  EL  + RAAY++   +FT+ C+PFLV+L +FG++VL+   +VLDAE+AFVS+ LFN+LR+PL  LP ++S L  ASVSL+RL  FL  EE++  AV  D +P        +I+ G F W    P P+L +I++  P   L+A+VG VG GKSS+++ALLGE++KL G V +KG +AYV QQAWI N ++RDN++FG P D   Y+ +++AC LE+D   L   D TEIGEKGINLSGGQ+QRVSLARA YS ++V+LLDDPLSAVD+HVGK + + VI  +G+L G TR+LVTH L+ L   DRI+V+  G VSE G+YS+L+    AF+  +  H     A E    +  +     ++ +     ++  T S I    A+M   +++ R  +   M  L             +    R  +E          + G+ L++ E+ + G++K++V + YLR++G  L+   +LLF       LG+N+WL  W+ +  +              N +Q+                LG+Y   G  Q+++ L   L      +++A SLH  LL+  L  P+S ++  P+GRIINRFS D+  +  +LP     FL     +I   +++ I  P  ++    ++  Y  +QR YV+TSRQLKRLES V+SP++SHFGE++ G +++RA+   ++F+ + D  VD    + Y + VS R + A+ LE +G  +V  AA+FAV+S  +   + AG VGLSVSYA+ +T  ++W+VRMSSEVESNIV+VER++EYS+ PPEA W++   +P  +WP  G ++F +YST+YREGLD VL+NI+  I   EKVGIVGRTG+GKSSL L L R++E + G I IDG+ I  +GLHD+R R+TIIPQDPVLF G+LR NLDPF  H D E+W+ LE ++L +T     G  Q E   +EGGEN SVGQRQL CLARALLRRT +LVLDEATAAVD++TD LIQ TIR  F  CT+LTIAHRL+TVLD  +++VL +G+I+E D+P+ LL   +S F+ MA+ + ++
Sbjct:  180 STDSD-DPNLCPEVGASFISRLTFCWFTRMAVNGYRRGLKMSDLWSLRHKDSCSFVVPHLQAVWRKEQARIAQRSAVSQ-------------------------STPAETRKLHTTEKSQSGGAGTEGGATGQEPSLIRAMALAFGPRYLVGSVYKLLQDILSFASPLLLSHLIRFVGDNS-RPTWHGYALAGLMFLCAIATSMLAHQHFHAGFVTGIRLRSALTGLLYRKALMITQAARLSCAGGELTTLMSVDVQHMADITNNLNFVWSAPLHICLAMYFLWQHLGPSVLAGVAVMLLLIPFNAFIALNIRTLQAQIIKKRDERVRTLSEALSGVRIIKMYAWEGRFRDVILRVREHELAVLGRAAYFSMLSAFTWLCSPFLVALASFGVYVLVDEHHVLDAERAFVSLALFNLLRYPLNQLPQLMSELAMASVSLRRLRNFLSLEELDPHAV--DRSPSHLRESCVSIEGGTFTWSWDEP-PILHDISLAVPRGCLLAVVGTVGSGKSSLMAALLGELNKLGGSVAVKGQVAYVAQQAWIQN-SLRDNVLFGRPLDETWYREVLQACALEQDLLALPAGDNTEIGEKGINLSGGQRQRVSLARAIYSKASVFLLDDPLSAVDAHVGKHIFERVIGPSGLLAGQTRVLVTHGLSFLPHVDRIVVLTAGRVSESGSYSELMLSGEAFSELLRIHGQGDGAGEDSPASQDDGPHVIIDLRSPGPDEVLSTCSNI----ADMEPVMTEPRRML---MRQLGSQEASGSGTTQGVSTETRGHKE---------TQPGSTLMQPESMETGHMKLSVVLHYLRAVGAPLSTLALLLFCANYTTMLGTNVWLSEWAGEPVV--------------NGTQRNT-----------GYRLGVYSALGAVQSVLSLVMVLMVFKGCLRAAGSLHLALLDNKLHSPISFYDVTPLGRIINRFSKDVFMIDEVLPPTFLMFLGALCNSIFTILIIVISTPVFVVAAIPLVVIYFFVQRFYVATSRQLKRLESTVRSPVFSHFGESVAGAATLRAFRQEERFVIAGDRAVDALQRTSYPSIVSQRRVGAVWLEFLGACVVLFAAMFAVLSRDS---LKAGTVGLSVSYAMQVTVVMSWMVRMSSEVESNIVAVERVKEYSETPPEADWEVESCRPPADWPSQGHVEFRDYSTRYREGLDLVLRNISCDIKGGEKVGIVGRTGAGKSSLTLCLLRMVEAASGAIAIDGVDISRIGLHDLRSRITIIPQDPVLFGGSLRDNLDPFGHHSDAEVWEALEFAHLGETARALPGGIQHE--CAEGGENFSVGQRQLACLARALLRRTRVLVLDEATAAVDVETDALIQGTIRTHFHACTVLTIAHRLHTVLDCTRVMVLSSGQIVEFDSPDVLLSRKDSAFHKMARDAGIV 1516          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006454.1 (pep scaffold:Pmarinus_7.0:GL483531:32:7621:1 gene:ENSPMAG00000005809.1 transcript:ENSPMAT00000006454.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 386.341 bits (991), Expect = 1.047e-119
Identity = 217/488 (44.47%), Postives = 313/488 (64.14%), Query Frame = 2
Query: 3557 HKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPWI---IIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQ-MPPEAPWDISEKKPDENWPV-GCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSG-KSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGN--EQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSM 4996
            H  L   VLR  M++F+T P GR++NRFS D++ V   +P     F+   +  +    ++    PW    +IPL ++      I RV++   R+LKRL+++  SP  SH   +LQG+ +I AYS  D+F+      +D N    +  + + RWLA+ L+ +  +++   AL  V  L +G  I A   GL++SYA+ +T T  + +R++SE E+   SVERI+ Y + +  EAP  + EK     WP  G + F +   +YREGL  VLK +   I PRE VGIVGRTGSG KSSL + LFR++E   G I IDG+PI ++GL D+R RL+IIPQ+PVLF GT+R NLDP   + DE+IW+ LE +++K    N G   ++LE  + E GEN SVG+RQL+C+ARA+LR + IL+LDEATAA+D +TD LIQETIRR F +CT+LTIAHRLNTVL  D+I+V++ G+++E D+P+ LL+N  S+F +M
Sbjct:   12 HDSLFLKVLRSSMTVFDTTPTGRLLNRFSRDMDEVDVRMPFQAELFIQNVILVLFCLGVIAAVFPWFLLAVIPLCVLFLIINKISRVFI---RELKRLDNISHSPFMSHVAASLQGLPTIHAYSKSDEFLHRYQELLDTNQACLFLFSCAVRWLAVRLDIISVALITTTALMMV--LMHGQ-IPAAYAGLAISYAIQLTGTFQFTIRLASETEARFTSVERIQHYIEALEEEAPDHVPEKPLAAEWPQHGSVSFQDVEMRYREGLPLVLKRVTANIKPRENVGIVGRTGSGCKSSLGVCLFRLVELCGGSISIDGVPIGDIGLGDLRSRLSIIPQEPVLFIGTIRTNLDPLGLYTDEQIWEALERTHMKD---NIGQLPQKLETEVVENGENFSVGERQLLCVARAILRHSKILLLDEATAAIDTETDTLIQETIRRAFGDCTMLTIAHRLNTVLSCDRIMVMDQGQVVEFDSPSTLLENRASRFAAM 490          

HSP 2 Score: 75.8702 bits (185), Expect = 3.686e-14
Identity = 127/533 (23.83%), Postives = 224/533 (42.03%), Query Frame = 2
Query: 1460 MRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQ---IIAALILLWYELGPSVLAGLV--IMLLMIPVNAV--IGNITRKIQAQQIKVTD--SRIKMMNEI---LNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAP---------FLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSHDDTPGIAA--------TIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCG-KSSILSALLGEIDKLEGYVNMKG-------------SIAYVPQQAWIINATIRDNI-IFGLPYDACKYQRIIKACCLERDFEILNDADF-----TEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNN 2911
            +R  S L  +++ K LR S      +  G ++N  S D  +       + M    PFQ    I  +IL+ + LG  V+A +    +L +IP+  +  I N   ++  +++K  D  S    M+ +   L G+  +  Y+    F++   E+ +            N A  F F+CA            V+L T    +++     + A  A ++I+    L         + S       S++R+  ++  E + ++A  H     +AA        + ++   ++    P  VLK +      R  V IVG  G G KSS+   L   ++   G +++ G              ++ +PQ+  +   TIR N+   GL  D    ++I +A  LER     N         TE+ E G N S G++Q + +ARA    S + LLD+  +A+D+     + + +  + G     T + + H L  +  CDRI+VM+ G V E  + S L+ +    + F A  +A E Q T +
Sbjct:    5 LRASSRLHDSLFLKVLRSSMTVFDTTPTGRLLNRFSRDMDEV-----DVRM----PFQAELFIQNVILVLFCLG--VIAAVFPWFLLAVIPLCVLFLIINKISRVFIRELKRLDNISHSPFMSHVAASLQGLPTIHAYSKSDEFLHRYQELLDT-----------NQACLFLFSCAVRWLAVRLDIISVALITTTALMMVLMHGQIPAAYAGLAISYAIQLTGTFQFTIRLASETEARFTSVERIQHYI--EALEEEAPDHVPEKPLAAEWPQHGSVSFQDVEMRYREGLP-LVLKRVTANIKPRENVGIVGRTGSGCKSSLGVCLFRLVELCGGSISIDGVPIGDIGLGDLRSRLSIIPQEPVLFIGTIRTNLDPLGLYTD----EQIWEA--LERTHMKDNIGQLPQKLETEVVENGENFSVGERQLLCVARAILRHSKILLLDEATAAIDTETDTLIQETIRRAFG---DCTMLTIAHRLNTVLSCDRIMVMDQGQVVEFDSPSTLLENRA--SRFAAMMVAGEGQVTRS 501          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007076.1 (pep scaffold:Pmarinus_7.0:GL480539:10051:22495:1 gene:ENSPMAG00000006379.1 transcript:ENSPMAT00000007076.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 381.719 bits (979), Expect = 1.536e-117
Identity = 217/489 (44.38%), Postives = 304/489 (62.17%), Query Frame = 2
Query: 3557 HKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPE-APWDISEKKPDENWPVG-CIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNLI 5017
            H  LL+ VL+ P+S F+  P GRI+NRFSSDL  V   LP  +N F+      +   +++    PW+ + L  +   Y  +Q+ Y  TSR+LKRL SV  SPIYSHF E+L G++ I+A+   D+F   N+ +++ N    +A      WL + L+ +G  IV   A  AV+   +  G++ GLVGL+++YAL I   L+ LV   ++ E+ +VSVER++EY  +  E A    +   PD  WP G  + F      YR GL   L  I+F IN  EKVGIVGRTGSGKS+L   LFRI++   G I ID   I +L L  +R  L IIPQDP LFS T+R NLDP   + D E+W+VLE  +LK+FV++ G  Q E  ++E G + S GQRQL+CLARA+L +  IL +DEATA+VD DTDVL+Q+TIR EF   T+LTIAHR NT+LD D++LVL+ G ++E  +P++LL++P S    +   S+L+
Sbjct:   55 HVTLLHKVLQAPVSFFDATPTGRIMNRFSSDLFTVDDSLPFIMNIFMAQLFGLVGAIVVMCYGLPWMALVLLPLAGVYYCVQKYYRFTSRELKRLGSVTLSPIYSHFAESLSGLAIIKAFRATDRFTRENEARLELNQRCQFAAVAVMHWLDVRLQMMGVVIVVSLAALAVLE-HHLRGVDPGLVGLAIAYALGINGRLSGLVSSFTQTETQMVSVERVQEYRGIASEEAHRHPTHVSPD--WPQGGALTFDKVFLTYRPGLPFALNGISFCINSWEKVGIVGRTGSGKSTLFSVLFRIVDVQHGAIYIDNQDISKLALKQLRSNLAIIPQDPFLFSDTVRNNLDPKGSYQDHELWEVLEKCHLKSFVLDQGGLQAE--VAERGRDFSCGQRQLLCLARAMLFKAKILCIDEATASVDQDTDVLLQKTIRSEFVNSTVLTIAHRPNTILDSDRVLVLQGGRVLEFASPHDLLQDPRSALSRLLSKSHLL 538          

HSP 2 Score: 69.3218 bits (168), Expect = 5.320e-12
Identity = 63/261 (24.14%), Postives = 116/261 (44.44%), Query Frame = 2
Query: 2114 VSLKRLTTF--LRREEINKDA--VSHDDTPGIAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYV-------------NMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIR 2845
            VS++R+  +  +  EE ++    VS D   G A T       +    P   L  I+        V IVG  G GKS++ S L   +D   G +              ++ ++A +PQ  ++ + T+R+N+     Y   +   +++ C L + F +       E+ E+G + S GQ+Q + LARA    + +  +D+  ++VD      L+   I S  +   +T + + H    +   DR++V+  G V E  +  DL++
Sbjct:  267 VSVERVQEYRGIASEEAHRHPTHVSPDWPQGGALTFDKVFLTYRPGLPF-ALNGISFCINSWEKVGIVGRTGSGKSTLFSVLFRIVDVQHGAIYIDNQDISKLALKQLRSNLAIIPQDPFLFSDTVRNNLDPKGSYQDHELWEVLEKCHL-KSFVLDQGGLQAEVAERGRDFSCGQRQLLCLARAMLFKAKILCIDEATASVDQDT-DVLLQKTIRSEFV--NSTVLTIAHRPNTILDSDRVLVLQGGRVLEFASPHDLLQ 522          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001536.1 (pep scaffold:Pmarinus_7.0:GL479104:2125:31869:1 gene:ENSPMAG00000001392.1 transcript:ENSPMAT00000001536.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 336.265 bits (861), Expect = 8.838e-102
Identity = 183/486 (37.65%), Postives = 303/486 (62.35%), Query Frame = 2
Query: 3557 HKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWD--ISEKKPDENWP-VGCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKS 5005
            H  +L  ++  PM  F+T P+G I+NRFS+D N +   +P  +   + + L  +    ++    P  +I L  +   Y  IQ+ +   SR L+ L+   + P++SHF ET++G+++IRA+    +F +      D N  SY   + +NRWL + L+ +G  IV +A++ ++    N T +++  VGL ++YAL ++  LNW+VR  +++E  + +++R+    Q+  E+ +D  +S+ +  +NWP  G IK    S +Y   L  VLK++N  I P +KVGI GRTGSGKSSL LA FR+++  +G I+ID + I ++ LH +R RL+II QDP+LFSG++R NLDP    GD  +W+ L+++ LK  VV +    L+ +++E GEN SVGQRQL CLARA +R+T+I ++DEATA++D+ T+ ++Q+ +   F   T++ IAHR++T+L  D ++VL+ G ++E D P+ LL + +S F S  ++
Sbjct:   36 HNNMLKRIVLAPMRYFDTTPLGHILNRFSADTNIMDQQIPTTLESLMRSALLCLSALGIIAYVTPIFLIALVPLAIAYYFIQKYFRVASRDLQELDDSTQLPLFSHFSETVEGITTIRAFRHEVRFRQRLLELTDANNISYLFLSAANRWLEVRLDYIGACIVLIASVASITDSWNNT-LSSARVGLCLTYALMVSNYLNWVVRNLADIEVQMGAIKRVNNLLQIETES-YDGLLSQAQVPDNWPQSGEIKIEELSVRYDSTLKPVLKHVNAHIQPSQKVGICGRTGSGKSSLSLAFFRMVDTFEGRIIIDNIDIAKIPLHTLRSRLSIILQDPILFSGSIRFNLDPEAACGDGVLWEALDIAQLK-HVVKALPGGLDAMVTENGENFSVGQRQLFCLARAFVRKTSIFIMDEATASIDMATESILQKVVMTAFANRTVVIIAHRVHTILTADLVMVLKRGSVLEYDTPSTLLAH-DSMFASFVRA 517          

HSP 2 Score: 73.9442 bits (180), Expect = 1.519e-13
Identity = 62/235 (26.38%), Postives = 110/235 (46.81%), Query Frame = 2
Query: 2225 KWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYV-------------NMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILN------DADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFI 2872
            ++DST  +PVLK++N        V I G  G GKSS+  A    +D  EG +              ++  ++ + Q   + + +IR N+    P  AC    + +A  + +   ++       DA  TE GE   N S GQ+Q   LARA    ++++++D+  +++D  +  + I   +  T   N  T +++ H +  +   D ++V+  G V E  T S L+ H   FA+F+
Sbjct:  291 RYDSTL-KPVLKHVNAHIQPSQKVGICGRTGSGKSSLSLAFFRMVDTFEGRIIIDNIDIAKIPLHTLRSRLSIILQDPILFSGSIRFNLD---PEAACGDGVLWEALDIAQLKHVVKALPGGLDAMVTENGE---NFSVGQRQLFCLARAFVRKTSIFIMDEATASID--MATESILQKVVMTAFAN-RTVVIIAHRVHTILTADLVMVLKRGSVLEYDTPSTLLAHDSMFASFV 515          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005186.1 (pep scaffold:Pmarinus_7.0:GL480017:11317:29304:1 gene:ENSPMAG00000004711.1 transcript:ENSPMAT00000005186.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 318.546 bits (815), Expect = 1.687e-95
Identity = 203/535 (37.94%), Postives = 298/535 (55.70%), Query Frame = 2
Query: 1265 GLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSHD-DTP-GIAATIKNGI--------------FKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYV---NMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMV 2812
            GL  +I  +L  LGP++L+ LL F+ + +E      Y+IA L   +     F  +Q+ + + KI + VR++L++ VYRKSLR+  +S  E + GEIVN MS D  + +      H  WS P Q+  +L+LL+ ++G + LAG+ + +L++P+N +I N         +   D R+K+M EIL GI+ +KL+ WE SF   V   R+ ELK +    Y +A   + +   P L+S+ TF  +V  S  N L A K F ++ L N+L  PL   P V++ LI+A +SL+RL TFL   E  +  +S     P G AA + N +              F++D+    P L       P   LV +VG VG GKSS+L+A+ G++ +  G V    ++       Q+ WI + T+RDNI+FG  YD  KY  II+AC L  D + L + D TE+GE G+ LSGGQK R++LAR  YSD  V LLDDPL+AVD  V   L    I+  GIL   TRIL TH    L+  D +I+++NG+V
Sbjct:    9 GLLYLIAIVLGLLGPVILQYLLSFMENRQEPASHGYYYIAGLFGTTFFGAFFN-NQFSYRINKIALCVRAALVTTVYRKSLRVGASSLSEFSTGEIVNYMSTDTDRIVNFCPSFHSFWSLPLQVAVSLLLLYQQVGVAFLAGIAVAILLVPLNKLIANKIGGFSQAMMHHKDGRVKLMTEILFGIRAIKLHCWEESFSRKVNGFRSDELKGLLGMKYLDALCVYLWAVTPVLISILTFVTYV--SLGNALTATKVFTAVALINMLITPLNAFPWVLNGLIEARISLRRLETFLSLPEKQRGCISASLRVPSGHAAQLFNKVAVSLPCCGHFPVPNFQFDTKRHLPQL-------PLGQLVGVVGKVGSGKSSLLAAITGDLFRCSGGVLVKRLEEGFGLFTQETWIQHGTVRDNILFGSRYDEDKYLSIIRACALSEDLKALANGDRTEVGENGVTLSGGQKARIALARVAYSDKPVCLLDDPLAAVDCDVAAHLFSKCIN--GILQKRTRILCTHRTQYLAAADLVILLDNGIV 531          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Yeast
Match: BPT1 (ABC type transmembrane transporter of MRP/CFTR family; found in vacuolar membrane, involved in the transport of unconjugated bilirubin and in heavy metal detoxification via glutathione conjugates, along with Ycf1p [Source:SGD;Acc:S000003938])

HSP 1 Score: 790.415 bits (2040), Expect = 0.000e+0
Identity = 511/1324 (38.60%), Postives = 765/1324 (57.78%), Query Frame = 2
Query: 1217 LMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHY--WKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNK-ELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAV-----SHDDTPGIAATIKNGIFKWDS--------------TTPEPV-------LKNINITFPER-HLVAIVGPVGCGKSSILSALLGEIDKLEG--------YVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNV-ISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQAT-NNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKS-MENLKMDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLF---VTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXX-XXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWPV-GCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVV---------NSGNEQ-------LEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAK 5002
            L  A+ KS    + ++ LY+   D+L+ + P  L++ +  ++      Y    G FIA  + + ++V  F+ +Q++  +F+ G+ +R SL S VY+KSLRL+ A R E + G+I+NLMS+D  +          I   P QII  L  L++ LG +V+ GLV M +M+P+NA +    +K+   Q+K  D RIK + E+LN IK +KLYAWE   +  +  +RN  ELK  ++    +  I F +NC P +V+ +TFG+F L S D+ L     F S++LFNIL   +  +P +I+ +I+ SVS++RL +FL  +EI+   +     S D+    A  + N  F W S              T  E +       LKNI+    +R  LV +VG VG GKS+ L A+LG++  + G         +    S+AY  Q++WI+NA++R+NI+FG  +D   Y   IKAC L  D +IL D D T +GEKGI+LSGGQK R+SLARA YS +++YLLDD LSAVD+ V K++I+ V I  T +L   T IL T+ ++IL     I  + NG + E+G Y D++      +      L +E  +  +N N S          +Q   R+ SE+++     ++      E + +S +E +K +  +  A++  L        +LD  +K  AQK        E ++ G VK  +Y+AY+++ G     G++L F   + T+ F L  N WL  WS+ ++               N S +++            + +G+Y + G   A      S+          +  LH+ +   V+R PM+ FET PVGRIINRFSSD++AV + L +  + F  + L  +V  I+V    PW ++    ++  YI  Q  Y+  SR+LKRL S+  SPI S   E+L G S I AY   ++FI  N  K+  N+   +    +NRWL++ L+T+G +IV   A+ A+ ++     +++G+VGL +SY+L +T +L W+VR +  +E+NIVSVERI EY ++PPEA     EK+PDENWP  G I+F NYSTKYRE LD VL NIN  I P EKVGIVGRTG+GKS+L LALFRILE ++G+I+IDG+ I ++GL D+R  L IIPQD   F GT++ NLDPFN++ ++E+ + +E ++LK  +          +  NE+       L++ I+E G NLSVGQRQL+CLARALL R+ ILVLDEATA+VD++TD +IQ+TIRREFK+ TILTIAHR++TVLD D+I+VL+ G + E D+P+ LL +  S FYS+ +
Sbjct:  280 LWRAIWKSFGRTISVAMLYETTSDLLSVVQPQFLRIFIDGLNPETSSKYPPLNGVFIALTLFVISVVSVFLTNQFYIGIFEAGLGIRGSLASLVYQKSLRLTLAERNEKSTGDILNLMSVDVLRIQRFFENAQTIIGAPIQIIVVLTSLYWLLGKAVIGGLVTMAIMMPINAFLSRKVKKLSKTQMKYKDMRIKTITELLNAIKSIKLYAWEEPMMARLNHVRNDMELKNFRKIGIVSNLIYFAWNCVPLMVTCSTFGLFSLFS-DSPLSPAIVFPSLSLFNILNSAIYSVPSMINTIIETSVSMERLKSFLLSDEIDDSFIERIDPSADERALPAIEMNNITFLWKSKEVLTSSQSGDNLRTDEESIIGSSQIALKNIDHFEAKRGDLVCVVGRVGAGKSTFLKAILGQLPCMSGSRDSIPPKLIIRSSSVAYCSQESWIMNASVRENILFGHKFDQDYYDLTIKACQLLPDLKILPDGDETLVGEKGISLSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEYVLIGKTALLKNKTIILTTNTVSILKHSQMIYALENGEIVEQGNYEDVMNRKNNTSKL--KKLLEEFDSPIDNGNES---------DVQTEHRSESEVDEPLQLKVTESETEDEVVTESELELIKANSRR--ASLATLRPRPFVGAQLDS-VKKTAQK-------AEKTEVGRVKTKIYLAYIKACG---VLGVVLFFLFMILTRVFDLAENFWLKYWSESNE--------------KNGSNERVW-----------MFVGVYSLIGVASAAFNNLRSIMMLLYCSIRGSKKLHESMAKSVIRSPMTFFETTPVGRIINRFSSDMDAVDSNLQYIFSFFFKSILTYLVTVILVGYNMPWFLVFNMFLVVIYIYYQTFYIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQYNVDFVFNFRSTNRWLSVRLQTIGATIVLATAILALATMNTKRQLSSGMVGLLMSYSLEVTGSLTWIVRTTVTIETNIVSVERIVEYCELPPEAQSINPEKRPDENWPSKGGIEFKNYSTKYRENLDPVLNNINVKIEPCEKVGIVGRTGAGKSTLSLALFRILEPTEGKIIIDGIDISDIGLFDLRSHLAIIPQDAQAFEGTVKTNLDPFNRYSEDELKRAVEQAHLKPHLEKMLHSKPRGDDSNEEDGNVNDILDVKINENGSNLSVGQRQLLCLARALLNRSKILVLDEATASVDMETDKIIQDTIRREFKDRTILTIAHRIDTVLDSDKIIVLDQGSVREFDSPSKLLSDKTSIFYSLCE 1553          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Yeast
Match: YBT1 (Transporter of the ATP-binding cassette (ABC) family; involved in bile acid transport; negative regulator of vacuole fusion; regulates release of lumenal Ca2+ stores; similar to mammalian bile transporters; YBT1 has a paralog, VMR1, that arose from the whole genome duplication [Source:SGD;Acc:S000003971])

HSP 1 Score: 714.916 bits (1844), Expect = 0.000e+0
Identity = 468/1342 (34.87%), Postives = 736/1342 (54.84%), Query Frame = 2
Query: 1250 YLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRK---------------------EST----VGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSHDDTPGIAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYV----------------NMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAI-LSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSMENLKMDLEKDVA---NITKLEDNKRCQEELDKFLKPGAQKNGN-KLIEEETSKEGNVKMAVYMAYLRSIGFW-LAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIA----------ANLSKELKELIA-HNSSQKQIDDLRKIIRDQRD--LNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWPV-GCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNL-------KTFVVNSGNE-------------QLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNLI*ILFD 5032
            YL+L   +  +  +L+F+  +LLK +L++V D         +F   +M +  ++      Q      ++ +R++S +IS +Y K+LR   ++ K                     EST    +G I+NLM+IDA K  E+  Y+H         + AL LL+  LG + + G++I++ M+P+N  +      +Q + + VTD+RI+ +NE    I+++K ++WE +F   +  IR  EL  +   +   +  SF +   P +V+  +F  ++ + +  VL    AF +++LF +LR PL  L  ++S ++Q+ VSL R+  FL   +  K      D  G     +N    WD    +  LK++NI F    L  ++GP G GK+S+L ALLGE+  L G V                    SIAY  Q AW++N T+++NI+F  P++  +Y+ +++AC L+RDFEIL   D TEIGEKGI LSGGQKQRVSLARA YS++   LLDD LSAVDSH    + DN I+   ++   T ILV+HN+A+ L   + ++++ +G V ++G   D+++  G F         DEL  ++                       S  N S+AN+ +  S S       + NL    E+ V+   N +  E  K     L K L+  A++  + KLI+EET +EG V + VY  YL+  G W + + +  LF+  Q   +G + W+  W+  + IA          A +SK+   LI    SSQ  +                L +Y + GF QAL+    ++    A I ++  +  ++LN VL   +  F+  P GRI+NRFS D+ A+   L  +I G   + ++ +   I++T   P  +    ++   Y  +   Y++ SR+LKR ES+ +SPIY HF ETL GV++IRA+    +F++ N +K+D+N   ++   V+NRWLA  ++ +G+ ++F A LF + ++ N   +++G+ G+S++YA+S T+   WLVR+ SEVE N+ SVER++EY ++  E P++  ++ P   WP  G I+  + S +Y   L  V+KN++F ++ + K+GIVGRTG+GKS+++ ALFR LE   G I ID + I  + L  +R  +TIIPQDP LFSGT++ NLDP+++  D +I++ L+  NL       +     + NE              L   ISEGG NLS GQRQL+CLAR+LLR   I++LDEATA++D  +D  IQETIR+EF+  TILTIAHRL +V+DYD+ILV++ GE+ E D P +LL N +S FYSM + S  + IL +
Sbjct:  353 YLVLQCFWAFLGSVLSFIPTVLLKRILEYVEDQSSAPSNLAWFYVTVMFVGRILVAICQAQALFFGRRVCIRMKSIIISEIYTKALRRKISTNKTKPSNEDPQEINDQKSINGDEESTSSANLGAIINLMAIDAFKVSEICGYLHSFLEAFVMTVVALALLYRLLGFAAIVGVLIIVAMLPLNYKLAKYIGDLQKKNLAVTDNRIQKLNEAFQAIRIIKYFSWEENFEKDINTIRENELSLLLMRSIVWSISSFLWFVTPTIVTAASFAYYIYV-QGEVLTTPVAFTALSLFTLLRDPLDRLSDMLSFVVQSKVSLDRVQDFLNENDTKKYDQLTIDPNGNRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYLLNGKVVVPALEPRQELIVDANGTTNSIAYCSQAAWLLNDTVKNNILFNSPFNEARYKAVVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSAVDSHTASWIYDNCITGP-LMEDRTCILVSHNIALTLRNAELVVLLEDGRVKDQGDPIDMLQK-GLFGE-------DELVKSS---------------------ILSRAN-SSANLAAKSSTS-------LSNLPAVKEQQVSVNNNSSHFEAKK-----LQKSLRTEAERTEDGKLIKEETKEEGVVGLDVYKWYLKIFGGWKIVSFLASLFLIAQLLYIGQSWWVRAWASHNVIAKIIPRAQRAIAFISKKASHLIDWRGSSQISMASAENQPSSGHSTMYYLVLYLIIGFAQALLGAGKTILNFVAGINASRKIFNMILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILITFITPQFLSVAIVVSILYYFVGYFYMAGSRELKRFESISRSPIYQHFSETLVGVTTIRAFGDEGRFMQENLHKIDENNKPFFYLWVANRWLAFRIDMIGSLVIFGAGLFILFNINN---LDSGMAGISLTYAISFTEGALWLVRLYSEVEMNMNSVERVKEYMEIEQE-PYNEHKEIPPPQWPQDGKIEVNDLSLRYAPNLPRVIKNVSFSVDAQSKIGIVGRTGAGKSTIITALFRFLEPETGHIKIDNIDISGVDLQRLRRSITIIPQDPTLFSGTIKTNLDPYDEFSDRQIFEALKRVNLISEEQLQQGATRETSNEASSTNSENVNKFLDLSSEISEGGSNLSQGQRQLMCLARSLLRSPKIILLDEATASIDYSSDAKIQETIRKEFQGSTILTIAHRLRSVIDYDKILVMDAGEVKEYDHPYSLLLNKQSAFYSMCEHSGELDILIE 1646          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Yeast
Match: VMR1 (Vacuolar membrane protein; involved in multiple drug resistance and metal sensitivity; ATP-binding cassette (ABC) family member involved in drug transport; potential Cdc28p substrate; induced under respiratory conditions; VMR1 has a paralog, YBT1, that arose from the whole genome duplication [Source:SGD;Acc:S000001027])

HSP 1 Score: 650.973 bits (1678), Expect = 0.000e+0
Identity = 453/1325 (34.19%), Postives = 705/1325 (53.21%), Query Frame = 2
Query: 1226 ALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERH--------YWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLR--LSTASRKES-------TVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLR---REEINKDAVSHDDTPGIAATIKNGIFKW---DSTTPEPVLKNINITFPERHLVAIVGPVGCGKSS----------------ILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAI-LSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKS-REKIYKSMENLKMDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIG-FWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKI---AANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKK----PDENWPV-GCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTF-----VVNSGNE---------QLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSS 5008
            AL +S   YLL+  L+ +++ I+  L  IL+K  L+ V +             Y  G FI  L +  A+  +    Q   +  KI +R+R+ LI  +Y K LR  L T+ +  S        +G I+NL+SID+ K  EL +Y+++       II  + LL+  LG S  AG+ I+L+M P+N ++ N+  K Q Q +K TD RI  +NE L  I+++K +AWE + IN +  IR KEL+ + + +   +  SF +   P LV+  TF +   +  ++ L+A  AF +++LF +L+ PL  L  ++S + Q+ VSLKR++ FLR    E+ N+  +S D         KN    W   DS      L  +NI F    L  I+G  G GKS+                I+ +L  + D +     +  S AY  Q AW++N T+++NIIF   Y+  +Y ++I AC L+RD EIL   D TEIGEKGI LSGGQKQR+SLARA YS +   LLDD LSAVDSH    + +N I+   ++   T ILVTHN+++ L      IV+ NG V  +GT ++L +  G F                                     +   IN+ NAN + +  K+  +KI    EN+  D     AN                        N  +LIEEE    G +   VY  YL+  G F     +  L++T Q   +  + W+  W + + +   A   + +   L     S K         +      L +Y + G  QA++  F ++    + ++++  +   LL+ VL   +  F+  PVGRI+NRFS D+  V   L  ++   +   +Q   +  ++T+  P  +    ++   Y  + + Y++ SR+LKRL+S+ KSPI+ HF ETL GV +IRA+    +FI  N NK+D+N  +++  +V+ +W +  ++ +G  IV  +  F ++++ N   I++GL G+S++YA+  T    WLVR+ S  E N+ SVER++EYS +  E      E +     + +WP  G I+  N S +Y   L  V++N++F ++P+ K+GIVGRTG+GKS+++ ALFR+LE   G I IDG  I ++ L  +R  +TIIPQDP+LF+GT++ N+DP++++ +++I+K L   NL +      V+NS             L   I+EGG NLS G+RQL+ +AR+LLR   I++LDEAT+++D D+D LIQ  IR EF + TILTIAHRL +V+DYD+I+V++ GE+ E D P+ LLK+    FYSM + S
Sbjct:  329 ALFESFKTYLLIGMLWVLVNSIVNLLPTILMKRFLEIVDNPNRSSSCMNLAWLYIIGMFICRLTL--AICNS----QGQFVSDKICLRIRAILIGEIYAKGLRRRLFTSPKTSSDSDSISANLGTIINLISIDSFKVSELANYLYVTVQAVIMIIVVVGLLFNFLGVSAFAGISIILVMFPLNFLLANLLGKFQKQTLKCTDQRISKLNECLQNIRIVKYFAWERNIINEIKSIRQKELRSLLKKSLVWSVTSFLWFVTPTLVTGVTFAICTFVQHED-LNAPLAFTTLSLFTLLKTPLDQLSNMLSFINQSKVSLKRISDFLRMDDTEKYNQLTISPDKN---KIEFKNATLTWNENDSDMNAFKLCGLNIKFQIGKLNLILGSTGSGKSALLLGLLGELNLISGSIIVPSLEPKHDLIPDCEGLTNSFAYCSQSAWLLNDTVKNNIIFDNFYNEDRYNKVIDACGLKRDLEILPAGDLTEIGEKGITLSGGQKQRISLARAVYSSAKHVLLDDCLSAVDSHTAVWIYENCITGP-LMKNRTCILVTHNVSLTLRNAHFAIVLENGKVKNQGTITEL-QSKGLFKE-----------------------------KYVQLSSRDSINEKNANRLKAPRKNDSQKIEPVTENINFD-----ANFV----------------------NDGQLIEEEEKSNGAISPDVYKWYLKFFGGFKALTALFALYITAQILFISQSWWIRHWVNDTNVRINAPGFAMDTLPLKGMTDSSKN--------KHNAFYYLTVYFLIGIIQAMLGGFKTMMTFLSGMRASRKIFNNLLDLVLHAQIRFFDVTPVGRIMNRFSKDIEGVDQELIPYLEVTIFCLIQCASIIFLITVITPRFLTVAVIVFVLYFFVGKWYLTASRELKRLDSITKSPIFQHFSETLVGVCTIRAFGDERRFILENMNKIDQNNRAFFYLSVTVKWFSFRVDMIGAFIVLASGSFILLNIAN---IDSGLAGISLTYAILFTDGALWLVRLYSTFEMNMNSVERLKEYSSIEQENYLGHDEGRILLLNEPSWPKDGEIEIENLSLRYAPNLPPVIRNVSFKVDPQSKIGIVGRTGAGKSTIITALFRLLEPITGCIKIDGQDISKIDLVTLRRSITIIPQDPILFAGTIKSNVDPYDEYDEKKIFKALSQVNLISSHEFEEVLNSEERFNSTHNKFLNLHTEIAEGGLNLSQGERQLLFIARSLLREPKIILLDEATSSIDYDSDHLIQGIIRSEFNKSTILTIAHRLRSVIDYDRIIVMDAGEVKEYDRPSELLKDERGIFYSMCRDS 1574          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Yeast
Match: YOR1 (Plasma membrane ATP-binding cassette (ABC) transporter; multidrug transporter mediates export of many different organic anions including oligomycin; homolog of human cystic fibrosis transmembrane receptor (CFTR) [Source:SGD;Acc:S000003513])

HSP 1 Score: 570.081 bits (1468), Expect = 9.496e-176
Identity = 431/1533 (28.11%), Postives = 721/1533 (47.03%), Query Frame = 2
Query:  719 HVNADDNHVSDRMEMSPNA-VDSYKTTEKDILINKTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRN----FDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXXXXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWK-----GYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKEL-KFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDA-VSHDDTPG----IAATIKNGIFKW-------------------------------------------------DSTTPEPV-------LKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSMENL------KMDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRS-IGFWLAAGIIL---LFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXY-SQMPPEAPWDISEKKPDENWP-VGCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVL------EMSNLKTFVVNSGNE----------QLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNLI 5017
            ++N+DD       ++ P   + S+  ++K   + +TD   + K  P ++++ +S + F+W  P++  GYK  ++  DL+ ++      ++     +N    F+K     ++R                                 P+  +  + +NA+             ++ AL+ +      +S ++ I+ +  +   P++ K L++FV +    H        GY I A +M+   V     + +FH     G++ +S L  A  +K    S  +R     G++ + ++ D  +    +S+   +   P  +   ++LL   LGP  L G+ I      ++     +    +      TD+R+ MM E+LN IK++K Y WE ++   + +IR KE+ K  K     N  I+   +  P + SL TF     +++         F S++LF +L   +  LP+ I   I   + L RL + L   E + +  +    +PG    +A  + +  F+W                                                 D   PE +        K++N    +   + I GP+G GKSS+L+A+ G + K +G V + G +  +    WI NA++RDNIIFG P++  KY  +++ C L+ D +IL   D TEIGE+GI LSGGQK R++LAR+ Y   ++YL DD LSAVDS VGK ++D  +  TG+L   TRIL TH L+++ +  R+IV+      + GT                    DEL+A N                           Q+  N++   S++ EK  +  E +      ++  E +V  +T+L   K+   E+ +    G          +E     ++ + +Y  Y+++ +G W    + L   L V T   SL S++WL  W++                             K         +G+Y  F F   +             I ++  L+   +  +L  PMS  +T P+GRI+NRF+ D +++   L   +          + V +M  +  PW  I +  ++  ++LI   Y S+ R++KRLE+V +S +Y++  E L G+ +I+AY   ++F+  +D  ++K   + Y   V  RW+ I L+ V  +I F A +  ++ +     I+A  VG+ ++Y L +   LN ++R  ++ E+++ S ER+  Y +++P EA +   E  P E+WP +G I F N    YR GL  VLKN+N  I   EK+GI GRTG+GKS+++ AL+R+ E + G+ILID + I +LGL D+R +L IIPQDPVLF GT+R+NLDPFN+  D+E+W  L         +L    +   +E           L+  + E G N S+G+RQL+ L RAL+R++ IL+LDEAT++VD +TD  IQ  I  EF +CTIL IAHRL T+++YD+ILVLE GE+ E D P  L    +S F SM   S ++
Sbjct:   66 YLNSDDIEKVTESDIFPQKRLFSFLHSKKIPEVPQTDD--ERKIYPLFHTNIISNMFFWWVLPILRVGYKRTIQPNDLFKMDPRMSIETLYDDFEKNMIYYFEKTRKKYRKRH--------------------------------PEATEEEVMENAKLPKH--------TVLRALLFTFKKQYFMSIVFAILANCTSGFNPMITKRLIEFVEEKAIFHSMHVNKGIGYAIGACLMM--FVNGLTFNHFFHTSQLTGVQAKSILTKAAMKKMFNASNYARHCFPNGKVTSFVTTDLARIEFALSFQPFLAGFPAILAICIVLLIVNLGPIALVGIGIFFGGFFISLFAFKLILGFRIAANIFTDARVTMMREVLNNIKMIKYYTWEDAYEKNIQDIRTKEISKVRKMQLSRNFLIAMAMSL-PSIASLVTFLAMYKVNKGG-RQPGNIFASLSLFQVLSLQMFFLPIAIGTGIDMIIGLGRLQSLLEAPEDDPNQMIEMKPSPGFDPKLALKMTHCSFEWEDYELNDAIEEAKGEAKDEGKKNKKKRKDTWGKPSASTNKAKRLDNMLKDRDGPEDLEKTSFRGFKDLNFDIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKVEVNGDL-LMCGYPWIQNASVRDNIIFGSPFNKEKYDEVVRVCSLKADLDILPAGDMTEIGERGITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECL--TGMLANKTRILATHQLSLIERASRVIVLGTDGQVDIGT-------------------VDELKARN---------------------------QTLINLLQFSSQNSEKEDEEQEAVVAGELGQLKYESEVKELTEL---KKKATEMSQTANSGKIVADGHTSSKEERAVNSISLKIYREYIKAAVGKWGFIALPLYAILVVGTTFCSLFSSVWLSYWTEN----------------------------KFKNRPPSFYMGLYSFFVFAAFIFMNGQFTILCAMGIMASKWLNLRAVKRILHTPMSYIDTTPLGRILNRFTKDTDSLDNELTESLRLMTSQFANIVGVCVMCIVYLPWFAIAIPFLLVIFVLIADHYQSSGREIKRLEAVQRSFVYNNLNEVLGGMDTIKAYRSQERFLAKSDFLINKMNEAGYLVVVLQRWVGIFLDMV--AIAF-ALIITLLCVTRAFPISAASVGVLLTYVLQLPGLLNTILRAMTQTENDMNSAERLVTYATELPLEASYRKPEMTPPESWPSMGEIIFENVDFAYRPGLPIVLKNLNLNIKSGEKIGICGRTGAGKSTIMSALYRLNELTAGKILIDNVDISQLGLFDLRRKLAIIPQDPVLFRGTIRKNLDPFNERTDDELWDALVRGGAIAKDDLPEVKLQKPDENGTHGKMHKFHLDQAVEEEGSNFSLGERQLLALTRALVRQSKILILDEATSSVDYETDGKIQTRIVEEFGDCTILCIAHRLKTIVNYDRILVLEKGEVAEFDTPWTLFSQEDSIFRSMCSRSGIV 1469          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Yeast
Match: YCF1 (Vacuolar glutathione S-conjugate transporter; ABC-C transporter of the ATP-binding cassette family; required for vacuole fusion; forms stable complexes with vacuole fusion machinery; regulates Vam7p recruitment to vacuoles; role in detoxifying metals (Cd, Hg, As); transports GSSG that is not immediately reduced in cytosol to vacuole; transports unconjugated bilirubin, selenodigluthatione, oxidized glutathione; similar to human cystic fibrosis protein CFTR [Source:SGD;Acc:S000002542])

HSP 1 Score: 500.745 bits (1288), Expect = 2.489e-150
Identity = 286/620 (46.13%), Postives = 405/620 (65.32%), Query Frame = 2
Query: 3182 EEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSD-QSKIAAN--LSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPW----IIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWPV-GCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNLI 5017
            + E  ++G VK  +Y+ Y ++         IL  V +   S+  N+WL  WS+  S+  +N   ++ L    A          ++ I+            ++ FC                I ++  LH L+ N VLR PM+ FET P+GRI+NRFS+D+  V  +L    + F V  ++ +   I V     W    IIIPLS+   FYI  Q+ Y+ TSR+L+RL+S+ +SPIYSHF ETL G++++R YS   +F   N  ++D N+ ++Y +  +NRWLA  LE +G+ I+  AA  +V  L+ GT + AG+VGLS+SYAL ITQTLNW+VRM+ EVE+NIVSVERI+EY+ +  EAP  +   +P + WP  G IKF NYST+YR  LD VLK+IN  I P EKVGIVGRTG+GKSSL LALFR++E S+G I+ID + I+E+GL+D+R +L+IIPQD  +F GT+R N+DP N++ DE IW+ LE+S+LK  V++  N+ L+  ++EGG NLSVGQRQL+CLARA+L  + ILVLDEATAAVD++TD ++QETIR  FK+ TILTIAHRLNT++D D+I+VL+NG++ E D+P  LL + +S FYS+   + L+
Sbjct:  925 KREHREQGKVKWNIYLEYAKACNPKSVCVFILFIVISMFLSVMGNVWLKHWSEVNSRYGSNPNAARYLAIYFALGIGSALATLIQTIV------------LWVFC---------------TIHASKYLHNLMTNSVLRAPMTFFETTPIGRILNRFSNDIYKVDALLGRTFSQFFVNAVK-VTFTITVICATTWQFIFIIIPLSV---FYIYYQQYYLRTSRELRRLDSITRSPIYSHFQETLGGLATVRGYSQQKRFSHINQCRIDNNMSAFYPSINANRWLAYRLELIGSIIILGAATLSVFRLKQGT-LTAGMVGLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYADLKSEAPLIVEGHRPPKEWPSQGDIKFNNYSTRYRPELDLVLKHINIHIKPNEKVGIVGRTGAGKSSLTLALFRMIEASEGNIVIDNIAINEIGLYDLRHKLSIIPQDSQVFEGTVRENIDPINQYTDEAIWRALELSHLKEHVLSMSNDGLDAQLTEGGGNLSVGQRQLLCLARAMLVPSKILVLDEATAAVDVETDKVVQETIRTAFKDRTILTIAHRLNTIMDSDRIIVLDNGKVAEFDSPGQLLSDNKSLFYSLCMEAGLV 1512          

HSP 2 Score: 463.766 bits (1192), Expect = 2.719e-137
Identity = 245/574 (42.68%), Postives = 367/574 (63.94%), Query Frame = 2
Query: 1208 DPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDS--------------EERHYWK-----GYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRN-KELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSH----DDTPGIAATI-KNGIFKWDSTTPEPV-LKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHA 2851
            +P L  A+ ++    +LL+  +K IHD+LAF  P LL++L++FV+D               E  H  K     G+ IA  M +    +T +LHQYF  VF  GM ++S+L + +Y+KSL LS  +   S+ G+IVNLMS+D QK  +L  ++++IWSGPFQII  L  L+  LG S+  G++I+++M+P+N+ +  I +K+Q  Q+K  D R ++++EILN IK LKLYAWE  +   + E+RN KELK + +   Y A  SF FN  PFLVS  TF +FV  + D  L  +  F ++TLFN+L FPLM++PMV+++ I+ASVS+ RL TF   EE+  D+V       +   +A  I  +  F W       V LKNIN    + +L  IVG VG GK+++LS +LG++ +++G+  + GS+AYV Q  WI+N T+++NI+FG  YDA  Y++ IKAC L  D  IL D D T +GEKGI+LSGGQK R+SLARA Y+ ++ YLLDDPL+AVD HV + LI++V+   G+L+  T++L T+ ++ LS  D I +++NG ++++GTY ++ + A
Sbjct:  272 NPSLSWAICRTFGSKMLLAAFFKAIHDVLAFTQPQLLRILIKFVTDYNSERQDDHSSLQGFENNHPQKLPIVRGFLIAFAMFLVGFTQTSVLHQYFLNVFNTGMYIKSALTALIYQKSLVLSNEASGLSSTGDIVNLMSVDVQKLQDLTQWLNLIWSGPFQIIICLYSLYKLLGNSMWVGVIILVIMMPLNSFLMRIQKKLQKSQMKYKDERTRVISEILNNIKSLKLYAWEKPYREKLEEVRNNKELKNLTKLGCYMAVTSFQFNIVPFLVSCCTFAVFVY-TEDRALTTDLVFPALTLFNLLSFPLMIIPMVLNSFIEASVSIGRLFTFFTNEELQPDSVQRLPKVKNIGDVAINIGDDATFLWQRKPEYKVALKNINFQAKKGNLTCIVGKVGSGKTALLSCMLGDLFRVKGFATVHGSVAYVSQVPWIMNGTVKENILFGHRYDAEFYEKTIKACALTIDLAILMDGDKTLVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTKTKVLATNKVSALSIADSIALLDNGEITQQGTYDEITKDA 844          

HSP 3 Score: 85.8853 bits (211), Expect = 5.101e-17
Identity = 64/206 (31.07%), Postives = 101/206 (49.03%), Query Frame = 2
Query: 2252 VLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYV-------------NMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCL----ERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSE 2818
            VLK+INI       V IVG  G GKSS+  AL   I+  EG +             +++  ++ +PQ + +   T+R+NI    P +    + I +A  L    E    + ND    ++ E G NLS GQ+Q + LARA    S + +LD+  +AVD    K + + + ++       T + + H L  +   DRIIV++NG V+E
Sbjct: 1288 VLKHINIHIKPNEKVGIVGRTGAGKSSLTLALFRMIEASEGNIVIDNIAINEIGLYDLRHKLSIIPQDSQVFEGTVRENID---PINQYTDEAIWRALELSHLKEHVLSMSNDGLDAQLTEGGGNLSVGQRQLLCLARAMLVPSKILVLDEATAAVDVETDKVVQETIRTA---FKDRTILTIAHRLNTIMDSDRIIVLDNGKVAE 1487          

HSP 4 Score: 63.929 bits (154), Expect = 2.102e-10
Identity = 60/234 (25.64%), Postives = 105/234 (44.87%), Query Frame = 2
Query: 4346 LKNINFIINPREKVGIVGRTGSGKSSLVLA----LFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKT--FVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKEC-----------TILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSM 4996
            LKNINF         IVG+ GSGK++L+      LFR+                  G   V G +  + Q P + +GT++ N+   +++  E   K ++   L     ++  G++ L   + E G +LS GQ+  + LARA+  R +  +LD+  AAVD        E + R   E            T +   ++++ +   D I +L+NGEI +    + + K+ +S  + +
Sbjct:  646 LKNINFQAKKGNLTCIVGKVGSGKTALLSCMLGDLFRVK-----------------GFATVHGSVAYVSQVPWIMNGTVKENILFGHRYDAEFYEKTIKACALTIDLAILMDGDKTL---VGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVD--------EHVARHLIEHVLGPNGLLHTKTKVLATNKVSALSIADSIALLDNGEITQQGTYDEITKDADSPLWKL 851          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Nematostella
Match: EDO36474 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SII0])

HSP 1 Score: 1106.66 bits (2861), Expect = 0.000e+0
Identity = 618/1286 (48.06%), Postives = 842/1286 (65.47%), Query Frame = 2
Query: 1211 PCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSHDDTPG----IAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSMENLKMDL-EKDVAN--------ITKLEDNKRCQEELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPW---IIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWP-VGCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSG-NEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNL 5014
            P LM  L    +P   L+  +K+I D ++F+ P +L+L++ FV  +     W+GY  A +M  +A  ++ +LH YFHIV   G++++++L   +Y K+LRL++ SR +ST G++VNLMS+DAQ+ L++ +YI+++WSGP QI+ AL  L+  +G S++AG+V+M+L+IP N V+   +RK+Q +Q+   DSRI++MNEILNG+KVLKLYAWE SF+  VT IRN+EL  +K A Y NA   FTF CAPFLVSL TF ++VL    N+L A  AFV+I+LFNILRFPL +LP VI + +QA VSLKRLT FL  +E+++  V H   P      A  + +G F WD  T +P L NIN+  P+  LVA+VG VGCGKS++LSALLGE +K+ G V +KGS+AYVPQQAWI NAT+RDN+IFG  +D+ +Y + IK C LE DF+IL   D TEIGE+GINLSGGQKQRV+LARA Y +++VYLLDDPLSAVDSHVGK + D VI   G L   TR+LVTH ++ L + D+I+V+ +G VSE GTY +L+ + GAFA F+ T   +E                         +   E+ +   +++  L    ++    ME     +  +  AN        IT    +  C   +++       +  + +I EE +  G+VK  V+ AY +SIG ++A+ +IL  + ++G  +GS +WL  WS                 A N +              RD+ LG Y  FGF QA   L SS+  AF  ++++ S+H  LL  +   PMS FET P+GR++NRFS DL  V   +P   +GFL T L AI     +T   P    +IIPL ++   Y+LIQR+YV++SRQLKR+ESV KSPIY++F ET+ G S+IRAY    +FI  N  KVD+N  +YY   VSNRWL + LE VGN I+F AALFAV+   +   I + LVG+S++YAL ITQTLN +VR +SE+E+NIVSVER +EY+ M  EA W + + +P + WP  G I+  ++  +YR  L  VLKNI+  I P EK+GIVGRTG+GKS+L LALFRILE + G I++D L I ++GL D+R  LTIIPQDPVLFSGTLR NLDPF+ + DE++W+VLE+S+LK F   SG  E L   I+EGGENLSVGQRQLVCLARALLR++ +LVLDEATAAVDL+TD LIQ TIR EF E T+ TIAHRLNT++DY +ILVL+ G ++E D+P NL+      FY MA+ + L
Sbjct:    2 PSLMKVLFLIFWPQFFLAAFFKLIQDSMSFVQPTILRLMISFVEGNSPS--WEGYMYALIMFAAAAFQSILLHAYFHIVISAGIKIKTALTGLIYSKALRLNSVSRNKSTAGDMVNLMSVDAQRVLDMCTYINLLWSGPLQIVVALYFLYDTMGWSIVAGVVVMVLLIPFNLVVTRFSRKLQLKQMANKDSRIRIMNEILNGMKVLKLYAWEESFMAKVTGIRNQELHHLKNAMYLNAFFGFTFTCAPFLVSLATFAIYVLTG--NILTANNAFVAISLFNILRFPLTVLPNVIISYVQAQVSLKRLTKFLTLDELDETNV-HKKMPSHISNQAIHVDDGSFSWD-VTGQPTLHNINLNIPDGSLVAVVGQVGCGKSTLLSALLGETEKVTGEVYVKGSVAYVPQQAWIQNATLRDNVIFGRNFDSRRYHKTIKVCALETDFDILPAGDMTEIGERGINLSGGQKQRVNLARAVYFNADVYLLDDPLSAVDSHVGKHIFDKVIGPRGKLRKKTRVLVTHGISFLPQVDQIVVLQDGRVSEVGTYKELLANRGAFAEFLKTFAPEEKSGD------------------AALKVLREVPEDEEDILVRLQAIGDEDEMFMEPEPQPIRRRGRANSVVTIGTTITSDTADTDCMTIMEE------DREVDHMIGEEKAATGSVKWVVFWAYAKSIGVFIASIVILFMILSEGALVGSRIWLAAWS-----------------ADNDTSDA----------TRDMYLGGYAAFGFFQAFFVLVSSICLAFGSVRASRSIHDSLLIAIFHAPMSFFETTPLGRVVNRFSKDLYVVDDTVPRSTSGFLRTALSAIGTLFAITYATPLFLSVIIPLGIV---YVLIQRLYVASSRQLKRIESVSKSPIYNNFFETISGTSTIRAYHQQQRFIRGNYYKVDENQLAYYPLVVSNRWLGLRLEFVGNLIIFFAALFAVVGRDS---IESALVGMSITYALQITQTLNMMVRQTSELETNIVSVERTKEYADMETEAEWVVEDSRPPKGWPDKGRIQIEDFDLRYRANLPLVLKNISVDIQPGEKIGIVGRTGAGKSTLTLALFRILESAGGRIVVDDLDISKMGLQDLRSSLTIIPQDPVLFSGTLRFNLDPFDAYSDEDLWEVLEVSHLKAFA--SGLPEGLLHPIAEGGENLSVGQRQLVCLARALLRKSKVLVLDEATAAVDLETDELIQNTIRTEFAERTVFTIAHRLNTIMDYSRILVLDKGFMMEFDSPQNLIAQ-RGIFYGMAQDAGL 1221          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Nematostella
Match: EDO35071 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMJ8])

HSP 1 Score: 843.958 bits (2179), Expect = 0.000e+0
Identity = 498/1096 (45.44%), Postives = 685/1096 (62.50%), Query Frame = 2
Query: 1313 LLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQ---IKVTDSRIKMMNEILNG-IKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSHDDTPG----IAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSMENLKMDLEKDVANITKLEDN----KRCQEELDKFLKPGAQKNGNKLIEEETSK---EGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPW---IIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWP-VGCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQ 4543
            L++L++ FV  +     W+GY  A +M  +A  ++ +LH YFHIV   G++++++L   +Y K+LRL++ SR +ST G++VNLMS+DAQ+ L++ +YI+++WSGP QI+ AL  L+  +G S++AG+V+M+L+IP N V+   +RK+Q  Q   I V+  +  +    L G  KVLKLYAWE SF+  VT IRN+EL  +K A Y NA   FTF CAPFLVSL TF ++VL    N+L A  AFV+I+LFNILRFPL +LP VI + +QA VSLKRLT FL  +E+++  V H   P      A  + +G F WD  T +P L NIN+  PE  LVA+VG VGCGKS++LSALLGE +K+ G V +KGS+AYVPQQAWI NAT+RDN+IFG  +D+ +Y + IK C LE DF+IL   D TEIGE+GINLSGGQKQRV+LARA Y +++VYLLDDPLSAVDSHVGK + D VI   G L   TR+LVTH ++ L + D+I+V+ +G VSE GTY +L+ + GAFA F+ T   +E      +                 Q +  + +Q    M   +++ +E    + +  ++   +         DN    +R       F    AQ    K ++  T        VK  V+  Y +SIG ++A+ +IL  + ++G  +GS +WL  WS                 A N +              RD+ LG Y  FGF QA   L SS+  AF  ++++ S+H  LL  +   PMS FET P+GR++NRFS DL  V   +P   +GFL T L AI     +T   P    +IIPL ++   Y+LIQR+YV++SRQLKR+ESV KSPIY++F ET+ G S+IRAY    +FI  N  KVD+N  +YY   VSNRWL + LE VGN I+F AALFAV+   +   I + LVG+S++YAL ITQTLN +VR +SE+E+NIVSVER +EY+ M  EA W + + +P + WP  G I+  ++  +YR  L  VLKNI+  I P EK+GIVGRTG+GKS+L LALFRILE + G I++D L I  +GL D+R  LTIIPQ
Sbjct:    1 LIRLMISFVEGNSPS--WEGYMYALIMFAAAAFQSILLHAYFHIVISAGIKIKTALTGLIYSKALRLNSVSRNKSTAGDMVNLMSVDAQRVLDMCTYINLLWSGPLQIVVALYFLYDTMGWSIVAGVVVMVLLIPFNLVVTRFSRKLQVCQFILIGVSLCQPPLCRCCLWGSCKVLKLYAWEESFMAKVTGIRNQELHHLKNAMYLNAFFGFTFTCAPFLVSLATFAIYVLTG--NILTANNAFVAISLFNILRFPLTVLPNVIISYVQAQVSLKRLTKFLTLDELDETNV-HKKMPSHISNQAIHVDDGSFSWD-VTGQPTLHNINLNIPEGSLVAVVGQVGCGKSTLLSALLGETEKVTGEVYVKGSVAYVPQQAWIQNATLRDNVIFGRNFDSRRYHKTIKVCALETDFDILPAGDMTEIGERGINLSGGQKQRVNLARAVYFNADVYLLDDPLSAVDSHVGKHIFDKVIGPRGKLRKKTRVLVTHGISFLPQVDQIVVLQDGRVSEVGTYKELLANRGAFAEFLKTFAPEEKSGDAARE----------------QESCPDNSQGARVMSRQIAREQESCPDNSQGTRVMSRQIAREQESCPDNSQGTRRKTLRSRYFTSKVAQLRHAKPMDSITWSPYISFQVKWVVFWTYAKSIGVFIASIVILFMILSEGALVGSRIWLAAWS-----------------ADNDTSDA----------TRDMYLGGYAAFGFFQAFFVLVSSICLAFGSVRASRSIHDSLLIAIFHAPMSFFETTPLGRVVNRFSKDLYVVDDTVPRSTSGFLRTALSAIGTLFAITYATPLFLSVIIPLGIV---YVLIQRLYVASSRQLKRIESVSKSPIYNNFFETISGTSTIRAYHQQQRFIRGNYYKVDENQLAYYPLVVSNRWLGLRLEFVGNLIIFFAALFAVVGRDS---IESALVGMSITYALQITQTLNMMVRQTSELETNIVSVERTKEYADMETEAEWVVEDSRPPKGWPDKGRIQIEDFDLRYRANLPLVLKNISVDIQPGEKIGIVGRTGAGKSTLTLALFRILESAGGRIVVDDLDISRMGLQDLRSSLTIIPQ 1041          

HSP 2 Score: 82.0333 bits (201), Expect = 1.588e-15
Identity = 67/214 (31.31%), Postives = 109/214 (50.93%), Query Frame = 2
Query: 4346 LKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIW-KVLEMSNLKT-FVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETI---RREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKN 4972
            L NIN  I     V +VG+ G GKS+L+ AL    EK  GE+              V+G +  +PQ   + + TLR N+  F ++ D   + K +++  L+T F +    +  E  I E G NLS GQ+Q V LARA+    ++ +LD+  +AVD      I + +   R + ++ T + + H ++ +   DQI+VL++G + E+     LL N
Sbjct:  317 LHNINLNIPEGSLVAVVGQVGCGKSTLLSALLGETEKVTGEVY-------------VKGSVAYVPQQAWIQNATLRDNV-IFGRNFDSRRYHKTIKVCALETDFDILPAGDMTE--IGERGINLSGGQKQRVNLARAVYFNADVYLLDDPLSAVDSHVGKHIFDKVIGPRGKLRKKTRVLVTHGISFLPQVDQIVVLQDGRVSEVGTYKELLAN 514          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Nematostella
Match: EDO41257 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4U1])

HSP 1 Score: 722.62 bits (1864), Expect = 0.000e+0
Identity = 451/1286 (35.07%), Postives = 709/1286 (55.13%), Query Frame = 2
Query: 1211 PCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKI-----GMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKF--LELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPL-MMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSHD----DTPGIAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSMENLKMDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQG-----FSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQN-GTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWP-VGCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSN 5011
            P L+ ALI +        GL+ +  D L  L PILL  L+ +  +       + Y  AA + +  +   FIL   F++ F       GMRVR++  + +Y+K L LS  +   +T G ++NL+S DAQKF  + L  ++H +  GP ++    +LLWY++GP+ LAG+ +++ + P+   +GN    ++ + I   D R+K+MNEI+ G++V+K+Y WE SF   +  +R  ELK+  R AY   A +  F  +  L+  TTF ++VL     VL A K F  ++LFN +R    +  P  I+   ++ VSLKR    L  +E++ + +               +K     W+     P L  ++   P   L+ ++G VG GKSS+L+A+LGE+   EG + ++G +AY  QQAW+ N+T+R NI+FG  YD  +Y  +IKAC L++DFE+L++ D T +GE+G++LSGGQ+ R+SLARA Y+D ++YLLDDPLSAVD++VG+ L    I +   L    RILVTH L  L   D I+V+  G   ++GTY  L R+   F + +A  +    + T N+                     S+ +  +      +SK            ++ +E+ V         KR    +D  +   +      L  EET +EG V    Y AYLRS    L  G+ L+F+           +  ++WL  W+++ ++ +          + N++     DL   +     L   ++G+F  C     L  ++ + +  I ++ +LH  + + ++   M  F+   +GRI+NRFS D+  +   +P  +   L      + +  +V   NP  I  +  +I  +   +  ++ +SR++KR+E + +SP++ HF  TL G+ +IRAY +   F +  +   D +  ++YA      WL   L+ +G  +VF+  LF V+ L     G++AG VGL +SY++ + +     V  S+EVE+ + SVER+ EY+ +PPE    +++  P  +WP  G I F N S  Y + L  VL N+  +I P EKVG+VGRTG+GKSSL+  LFR+ E   G I IDG+ I +LGL D+R +L+IIPQDPVLFSGT+R+NLDPF++H D  +WKVL+   LK  V +    +L+  ++E G N SVGQRQLVCLARA+LR + ILV+DEATA VD  TD LIQETIR +F++CT+LTIAHRL+T++D D+++VL+ G ++E DAP  LLK   + F  + + + 
Sbjct:   55 PSLVRALINAFGKGYAALGLFPLFADGLGILQPILLGYLVTYFVEDSPITKKEAYLYAAGVGLCGL---FIL--LFNVPFAFMKNVYGMRVRAACTALIYKKVLHLSRTALASTTTGNLINLVSADAQKFDWVRLAPFLHYLILGPLEVGVVAVLLWYQIGPAALAGVGLLVCLAPMQVKMGNALMSLRGKAIHWMDERVKIMNEIIAGMRVIKMYTWEDSFAKLIMHLRKNELKWFLRMAYIQGAFASFFFSSAGLIYFTTFLVYVLTG--EVLTAAKVFTCVSLFNSVRIVCALFFPFAITLFNESRVSLKRFEEALLLDEMHSEGLVKSTLRPKAEECGVFVKKASATWNKEIAIPTLDGLSFDVPSGCLLGVIGAVGSGKSSLLNAILGELPLSEGSIRVQGRVAYASQQAWVYNSTLRHNILFGKEYDEHRYNDVIKACALDKDFELLSEGDETLVGERGVSLSGGQRARISLARAVYADGDIYLLDDPLSAVDANVGRHLFQECICT--YLKDKARILVTHQLQFLKDADEIMVLQQGQCIDKGTYQQLSRNDSGFLSLLAEEVE---EETGNE---------------------SDGDDGSTRFGRPVSK------------QLSVEEVV--------RKRAGNVVDSCMSIMSAATTLTLPPEETKQEGAVSRQTYAAYLRSFHD-LGTGVFLIFLFAMCQVRPVMLMFGDVWLANWANREEVYSMTLASWNA--SSNTTSPSRPDLHYYLSVYAAL---VFGLFVLC-----LICTMSYYWFTIVASRNLHNGMFHSLIHTNMHFFDNNSIGRILNRFSKDIGVIDDFMPWMLCDVLQIGFSCLGIMCLVAASNPVSIAIVLPVICLFFYFRNYFMKSSREMKRIEGINRSPLFGHFSTTLLGIDTIRAYGVEATFTDQFNLFHDAHSRAWYAYLAGQAWLTCRLQALG--VVFL--LFIVLGLPALKDGLSAGTVGLILSYSIMLAKLFEPFVEESAEVENIMTSVERVVEYTSLPPEGE-KVTDVIPPPDWPDKGKITFDNMSFSYHQSLPEVLHNVTCVIKPSEKVGVVGRTGAGKSSLLSTLFRLAEPK-GLIDIDGINIRKLGLKDLRSKLSIIPQDPVLFSGTMRKNLDPFSEHPDAGLWKVLDEVQLKQPVEDLPG-KLDEELAEAGSNFSVGQRQLVCLARAILRHSRILVIDEATANVDPRTDALIQETIRDKFQDCTVLTIAHRLHTIMDSDRVMVLDAGRLVEFDAPYKLLKKRNTIFSGLVEQTG 1269          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Nematostella
Match: EDO31647 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXB5])

HSP 1 Score: 594.734 bits (1532), Expect = 0.000e+0
Identity = 360/934 (38.54%), Postives = 528/934 (56.53%), Query Frame = 2
Query: 2249 PVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSMENLKMDLEKDVANITKLEDNKRCQE---ELDKFLKPGAQKNGN-KLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNL-------WLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXY-SQMPPEAPWDISEKKPDENWPV-GCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSN 5011
            P L +I++   +  L+ I G VG GKSS+L  +L ++ K +G V + GSIAYV QQAWI+NAT +DNI+ GLP++  +Y+    AC L +DFEIL + D TEIGE+GINLSGGQKQR+SLARA Y+D ++YLLDDPLSAVD+HVG+ +  + I   G L G + +  TH L  LS+CD+++ MNNG ++E GTY  LI                  Q   N NF+                                     +I++++E++   + + V   T+  +  R            +P + +    +L E E  +EG V+++ Y+ Y++S G   A   + +      F L   L       WL  W D    A N +     +I H               D  +  + +YGV         L  +  F    +K+++ LH L    V+   MS F+  P GRI+NRFS DL+ V   LP  +  F+   L+  +   +V+   P+ +I +  ++ F+ ++   +  + R+LKRL+ + +SPI+SH   T+QG+S++ A+     F     + +D N   ++   VSNRWL++ L+ +   I  + AL  V +   G  +     GL++SYA+ IT    + VRM++E ES   SVERI  Y + +P EAP +I E K  + WP  G I F     +YR GL  VL N+   + P+EK+GIVGRTGSGKSS+ + L+R++E S G I ID + I  LGL D+R +++IIPQDPVLF+GT+R NLDPF K+ DEE+WK LE S+LK  V N    +LE  + E GEN SVG+RQL+C+ARALLR + IL++DEATAA+D +TD  IQ+TIR  F +CT+LTIAHRLNTVL  D+I+V+E G+I+E D P+ L  +PES F  + ++++
Sbjct:  481 PSLFDIDLEVKKGSLIGICGSVGSGKSSLLQCILSQMRKTKGRVGIGGSIAYVSQQAWIMNATAKDNILLGLPFNESRYKAACFACSLTKDFEILPNGDQTEIGERGINLSGGQKQRISLARALYADKDLYLLDDPLSAVDAHVGQHIFKHCIK--GSLWGKSVLFATHQLQYLSQCDQVLYMNNGRIAERGTYIQLI------------------QDKKNPNFT-------------------------------------EIHRNLEHVPRPISQ-VVRRTRFSNCSRGSSLSVRARGAKRPASTQGARAQLTEVEERQEGAVRLSTYVNYMKSAGGMFAQPCVCISFMLVLFMLACLLLQTFVDSWLGYWLD----AGNKTG----IIEHEDG------------DINNYYMMVYGVCALVFLFGLLLKTFMFVKFTLKASSKLHDLCFKKVMSGTMSFFDVTPTGRILNRFSKDLDEVDAQLPWTLESFMQNVLRIFIALGLVSAMFPYFLIAVVPLMIFFFVLNSYFRRSVRELKRLDGITRSPIFSHLTATVQGLSTLHAFDKMADFNARFSSLIDLNTLPFFMYFVSNRWLSVRLDIITVVITTVTALLVVTT--KGV-LTEAFAGLALSYAIRITGLFQFTVRMAAETESRFTSVERINYYITSVPSEAPAEIPETKTKDEWPQEGTIVFNQVKMRYRSGLPLVLDNLTGFVRPQEKIGIVGRTGSGKSSVGVVLWRLVELSGGSIKIDNIDISTLGLQDLRSKISIIPQDPVLFAGTIRFNLDPFRKYSDEELWKALERSHLKDMVSNL-PLKLEAPVVENGENFSVGERQLICMARALLRHSKILMMDEATAAIDSETDAKIQDTIRDAFVDCTVLTIAHRLNTVLTADRIMVMEAGKIVEFDEPSVLSADPESYFSKLLQAAD 1332          

HSP 2 Score: 145.976 bits (367), Expect = 6.062e-35
Identity = 96/357 (26.89%), Postives = 187/357 (52.38%), Query Frame = 2
Query: 1253 LLLSGLYKIIHDILAFLGPI--------------------LLKLLLQFVSDSEERHYWKGYFIAALM--MISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYY---NAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINK--DAVSHDDTPGIAATIKNGIFKWDSTT 2242
            L++  +  +I  ++ FLGP+                     ++ +L++++         GY IA +M  +++ ++R   L   F +  + G R RS + S +Y+K  +L     K  ++GE VNL + DAQ+  E +S       GP  II A+I   Y +GPS L G  ++LL+ P+   +  +  +++ + +++TD R++MM+E+LN IK++K+YAW+ SF + +   R +E   +  A      N +I+      P + ++ +F + +   ++  L + +AF  +T+FN+L F L +LP  +  + +AS +L R+ + ++ EE++   D  S+ +   +A +I++  F WD  +
Sbjct:   67 LIMGMIMFVISQMITFLGPVRFFSNGDTPCLLCSCVFQALFIRYILEYLAKQNTTSL--GYGIALVMGLLLTEILRVAFLSFSFFLNIRTGTRARSMVYSLIYQKLSKLRNVGDK--SIGEFVNLCASDAQRIYEGVSIGCFSLGGPVVIIMAIIYTTYLIGPSALVGCGLVLLVFPIQMKVARLAGQLRGKVVRITDQRVRMMSEVLNCIKLIKMYAWDRSFADNIVAKRTEERNALTSAGLLQGINMSIALII---PTVATVASFSVHIATGQN--LTSAQAFTIMTIFNVLVFSLAVLPFGVRAVAEASTALTRVKSLMQMEELSPFLDKPSNSN---VALSIEHCDFSWDKVS 411          

HSP 3 Score: 58.9214 bits (141), Expect = 1.863e-8
Identity = 59/234 (25.21%), Postives = 106/234 (45.30%), Query Frame = 2
Query: 2174 SHDDTPGIAATIKNGI-FKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSI---------LSALLGEIDKLE----GYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDF--EILNDADF---TEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSE 2818
            + D+ P     + N +  ++ S  P  VL N+      +  + IVG  G GKSS+         LS    +ID ++    G  +++  I+ +PQ   +   TIR N+    P+     + + KA  LER    +++++        + E G N S G++Q + +ARA    S + ++D+  +A+DS     + D +  +       T + + H L  +   DRI+VM  G + E
Sbjct: 1085 TKDEWPQEGTIVFNQVKMRYRSGLPL-VLDNLTGFVRPQEKIGIVGRTGSGKSSVGVVLWRLVELSGGSIKIDNIDISTLGLQDLRSKISIIPQDPVLFAGTIRFNLD---PFRKYSDEELWKA--LERSHLKDMVSNLPLKLEAPVVENGENFSVGERQLICMARALLRHSKILMMDEATAAIDSETDAKIQDTIRDA---FVDCTVLTIAHRLNTVLTADRIMVMEAGKIVE 1309          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Nematostella
Match: EDO46744 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNV9])

HSP 1 Score: 592.423 bits (1526), Expect = 0.000e+0
Identity = 383/1113 (34.41%), Postives = 601/1113 (54.00%), Query Frame = 2
Query: 1697 IMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMML-PMVISNLIQASVSLKRLTTFLRREEINKDAVS---HDDTPGI--AATIKNGIFK-WDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSMENLK-MDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAA-GIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYIL--IQRVY-VSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWP-VGCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSM 4996
            ++ L++P+   + N    ++ Q  +V D R+K+M EI++GI+ +K+YA EP     V+ IR  E+ ++KR +   +  +  F  +P L+S  +F  + L    + L A   F  ++LFN +R  + +L P+ +S+L    V+L+R+   L  EE+          D+ P     + + NGI   W    P+P + N++    +  ++A++G +G GK+S+L A+LGE+   +G + +KG +AY  Q  W+ N+++R+NIIF   +D  +Y  ++ AC L++D  +  D D T +GE+G++LSGGQ+ R+SLARA YSD+++YLLDDPLSAVD H+G  L  N I   G L+   RILVTH    + + D II M+ G     GT+ D +R AG     +  H   E +                           +I  S A+ +              ENL  ++  K   ++   EDN            PG           ET  EG V +A Y+ Y +S+    A+  ++LLFV  Q   +  + WL  W+D  + +   +K + +                     RD  +G+Y    F    + L  S  F    + ++ +LH  + + ++R P+  F+   +GRI+NRFS D + +   LP  +  FL T +  + V ++V   NP   I  ++++  +I+  I+R Y V T+R LKRL+ + +SP+Y HF  TL G+ +IRA+   D  +    + ++ N  + +A    + WL   LE +  S +F++   A+IS    + +  G+VGL ++YA  ++  L   ++  +EVES + +VER+ EY  + PEAP + ++ KP + WP  G + F N    +RE L  VLK+++  I P EKVGIVGRTG+GKSSL+  LFR+ E   G+I IDG+ I +LGL D+R  + IIPQ+P+LFS TLRRN++P   + D EIW VLE   LK +V     + L+  I  G    SVGQRQL+CLARA+L RT ++V+DEATA V+  T  +I   I R F++CT++ IAHRL  V+D D I+VL+ G I E+D P NLL++P S    M
Sbjct:    3 LLFLLVPMQIGMSNFIMNLRNQAAQVMDQRVKVMREIISGIRPIKMYAHEPFTRALVSMIRKAEIGWLKRLSKGKSLFTSIFYSSPALISFLSFMTYALTG--HTLYASSVFTCVSLFNSVRNVMTLLFPVAMSSLNDLRVALRRIQALLLLEELCPKCQGLEQSDERPKEEECSLVANGISAYWSKDLPKPTIDNLSFAVSQGRMLAVIGEIGSGKTSLLQAILGELPLSQGTLKIKGKLAYTSQTPWVFNSSVRNNIIFDNEFDEQRYNDVVHACALDKDISMFYDGDKTLVGERGVSLSGGQRARISLARALYSDADIYLLDDPLSAVDIHIGMHLYKNCI--MGYLSRKARILVTHQFRYVKEADHIIAMSEGECVSRGTF-DQVRLAGIDLVAMCPHKTVEEE-----------------------EEMRDIQASAAHALHH------------ENLSVLNRRKRADSLASSEDNGL----------PG-----------ETKHEGAVAIATYIQYFKSLHSIPASLFVLLLFVIAQTLFMLCDWWLSYWTDLDQDSVKKAKPVPD---------------------RDTMIGVYAGLTFGLFFLTLVRSTVFYELCLVASRNLHSKMFDAMMRAPVCFFDMNSIGRILNRFSKDTSYLDESLPTTLMNFLQTAMTTLGVVVLVGANNP---ISFAIVLPVFIVFTIERFYYVRTARDLKRLDGITRSPLYGHFSTTLLGLDTIRAFGAQDSAVHHFHHHLESNTRALFAYISVSSWLTFRLEIL--SAIFVS-FVALISPLLRSSLTPGVVGLILTYATKLSSVLAKSIKKGTEVESMMTAVERMIEYCDLEPEAPNE-TDTKPPKGWPDKGEVVFKNVYFSHREDLPPVLKDVSVHIKPAEKVGIVGRTGAGKSSLLATLFRMAEPK-GKIEIDGVDITKLGLRDLRTSIAIIPQEPLLFSSTLRRNMNPEQNNDDSEIWGVLEEVQLKNYVAQL-PQGLDTCIDAGSMMFSVGQRQLICLARAILHRTKVVVIDEATANVNSMTSKIIWGAINRRFRDCTLIVIAHRLFPVMDADMIIVLDAGRIRELDTPYNLLQDPHSHLTHM 1024          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Medaka
Match: abcc3 (ATP binding cassette subfamily C member 3 [Source:NCBI gene;Acc:101175305])

HSP 1 Score: 1215.29 bits (3143), Expect = 0.000e+0
Identity = 687/1617 (42.49%), Postives = 984/1617 (60.85%), Query Frame = 2
Query:  227 LILCFPYI-------IHLIRKKVNERPFFKLTIIK--------LALIVCLMVLQILEIIYNAAKKNNIPYAYTISNCSFLVCMSILAIMVGLERRCNAVNSGFYFNYWLLHFILCAVRARASGLSLKLKITNRDYSRECFIFINLTFVTLSLVLSCFSEKVSQSEIERLNKKRKFQNVLHVNADDNHVSDRMEMSPNAVDSYKTTEKDILINKTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXXXXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSHDDTPG-IAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISS---LSKSREKIYKSMENLKMDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWPV-GCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNLI 5017
            ++ C P I       ++L   K N R +  ++I+         L  IVC     +    +   +    P  + I+       M +  +++  ER     +SG  F +W L  +   V  R+  L    +    D  R    ++  + V   L+L CF+                                               E+  L   +D   D   CPE  + FLS + F+WFT L +KGYK+PL+ +DLW L   +   ++VP LL  +       ++ ++K+     + +N SG+       P K    S  D  + + P+  +     +K +  P  + A++K+  PY L+   YK++ D++ F+ P LL LL+ F +  E+   W GY +A LM  +A ++T ILH++F   F  GM VR++LI A+YRK+L ++ A+++ STVGEIVNLMS+DAQ+F++L ++++M+WS P QI+ AL  LW  LGPSVLAG+ +M+++IP+NA I   TR  Q +Q++  D+R+K+MNEILNGIKVLKLYAWE SF   V +IR KEL  +++ AY  A  +  +  APFLV+LT+F +FV +  +NVLDA++AFVS++LFNILRFPL MLP VIS++ QASVSLKR+  FL  +E++ D+V   +TPG  + T+ NG F W    P PVL ++++  P   L+A+VGPVGCGKSS++SALLGE++KLEG V+++GS+AYVPQQAWI NAT+RDNI+FG  Y+  KY  ++ AC L +D E+L   D TEIGEKGINLSGGQ+QRVSLARA YSD++VYLLDDPLSAVD+HV K + D +I   G+L   TRILVTH ++ L + D I+V+  G VSE G++ +L++  GAFA F+  +  +++   +       +  E             E+   + +M+ +   ++++R+   + M  L  D E    N  +    +    +  +   P  +K   KLI+ ET++ G VK  VY+ Y++++G  L+  I+LL+      ++GSN+WL +W++ +              A N +Q+ +            + + +Y   G  Q ++ + SS   A   I +A  LH  LL   L  P S F+T P+GRIINRFS D+  +   LP  +  FL T   ++   I++    P+  + + ++   Y+ +QR YV++SRQLKRLESV +SPIYSHF ET+ G S IRAY   D F+  +D KVD+N  SYY   VSNRWL + +E +GN IV  AALFAVI  +    +N GLVGLSVSYAL +T +LNW+VRM+S++E+NIV+VER++EYS+  PEAPW++ +KKP   WP  G ++F  YS +YR+GLD VLKNI   +   EK+GIVGRTG+GKSS+ L LFR+LE + GEI IDG+ I E+GLHD+R RLTIIPQ+PVLFSGTLR NLDPF+K+ DE++WK LE S+L  FV N    QL+M  +EGGENLSVGQRQLVCLARALLR+T IL+LDEATAA+DL+TD LIQ TIR +F+  T+ TIAHRLNT++DY ++LVL+ G+I E D P NL+      FY MAK + L+
Sbjct:   33 VLACLPCIYLWVVSPVYLFYLKRNNRGYIMVSILNRFKTVFGLLLWIVCWT--DLFYSFHEMQQGQTPPPIFFITPLVLGTTMLLATVLIQYERLHGVQSSGVLFIFWFLSVLCAIVPFRSKILKASGESEVPDKLRFTTFYVYFSLVVCELILCCFN-----------------------------------------------ERPPLF--SDTVTDPNPCPETTAGFLSSMTFWWFTSLALKGYKMPLEAKDLWSLKKRDSSETMVPRLLAEW-------RKEEAKA----RSQQNLSGQAQYAKLPPSKANHLSG-DEAEDNGPKEGDVLLSNQKAQKQPSFLRAILKAFGPYFLIGSAYKLLQDVITFINPQLLSLLISF-TKQEDVPLWWGYTLAFLMFFTAFLQTLILHRHFQYCFVTGMNVRTALIGAIYRKALVITNAAKRSSTVGEIVNLMSVDAQRFMDLTAFLNMLWSAPLQIMLALYFLWENLGPSVLAGVAVMVMLIPLNAFIAMKTRAYQVEQMQHKDARLKLMNEILNGIKVLKLYAWEESFKQKVLDIRQKELNVLRKTAYLGALSTMAWTSAPFLVALTSFAVFVSVDENNVLDAKRAFVSLSLFNILRFPLNMLPQVISSIAQASVSLKRIQNFLSHDELDPDSVDRKNTPGDFSVTVVNGTFTWAKEDP-PVLHSVSVMVPRGSLLAVVGPVGCGKSSLISALLGEMEKLEGEVSIQGSVAYVPQQAWIQNATLRDNILFGNAYNEQKYCSVLDACALTQDLEVLPGGDQTEIGEKGINLSGGQRQRVSLARALYSDADVYLLDDPLSAVDAHVAKHIFDRLIGPDGLLKEKTRILVTHGISFLPQVDNIMVLGAGRVSEMGSHQELLKQNGAFAEFLRNYALEDILEEDELEDELLDEMEFFPE--------EELGNHHCDMMENEPVMNEARKAFMRQMSVLSADGE----NPRRRSVRRHGCSQRKRGEPPEKKKELEKLIQAETAETGRVKTKVYLEYVKAVGVLLSVLILLLYGCQSAAAIGSNIWLSQWTNDA--------------AGNHTQENV-----------QMRVSVYAALGIAQGILVMISSYTLAMGNISAARRLHANLLTNKLHTPQSFFDTTPIGRIINRFSKDVYVIDEALPSTVLMFLGTFCASLSTMIVIVCSTPYFALIIPVLALIYVFVQRFYVASSRQLKRLESVSRSPIYSHFSETVTGSSVIRAYGRLDAFVLMSDAKVDENQRSYYPGIVSNRWLGVRIEFIGNCIVLFAALFAVIWKET---LNPGLVGLSVSYALQVTMSLNWMVRMTSDLENNIVAVERVKEYSETKPEAPWEVEDKKPPPEWPTDGKVEFHGYSVRYRDGLDLVLKNITLDVKGGEKIGIVGRTGAGKSSMTLCLFRLLEAAAGEITIDGVKIAEIGLHDLRSRLTIIPQEPVLFSGTLRMNLDPFDKYSDEDVWKALEHSHLHGFVRNQ-PAQLQMECAEGGENLSVGQRQLVCLARALLRKTRILILDEATAAIDLETDDLIQSTIRTQFENSTVFTIAHRLNTIMDYTRVLVLDKGKIAEFDTPTNLISK-RGIFYGMAKDAGLV 1542          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Medaka
Match: abcc1 (multidrug resistance-associated protein 1 [Source:NCBI gene;Acc:101173789])

HSP 1 Score: 1213.75 bits (3139), Expect = 0.000e+0
Identity = 709/1641 (43.21%), Postives = 1002/1641 (61.06%), Query Frame = 2
Query:  140 DWASEWNSPSPDIPTCFQFFDAPIYLLGYLILCFPYIIHLIRKKVNERPFF---KLTIIKLALIVCLMVLQILEIIYNAAKKN---NIPYAYTISNCSFLVCMSILAIMVGLERRCNAVNSGFYFNYWLLHFILCAVRARASGLSLKLKITNRDYSRECFIFINLTFVTLSLVLSCFSEKVSQSEIERLNKKRKFQNVLHVNADDNHVSDRMEMSPNAVDSYKTTEKDILINKTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNK--RSIPQNAXXXXXXXXXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSHDDTPG--IAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSMEN---LKMDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWPV-GCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSG-NEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNLI 5017
            DW   WN+ +PD+  CFQ          YL LC P+  +L+  + + R +     L   K A+   L ++  L++ Y+  +++   N+   + +S     + M +  ++V  ER     +SG    +WLL  +  +V  R+  L  + +       R    ++    + L+LVLSC                               +SD+M +   AV                   D   CPE  +SFLSRI F+W + +++ GYK PL+ +DLW LN E+R   +VP LLR +       KR +   +KML + K                    P   NK  R++ ++        K+  +P L+ AL  +  P+ L+S LYK+I DIL F+GP +L+LL+ FV+D +    W+GYF AAL+ +   V++ IL +YFH+ F  GMR+R+++I A+YRK+L +S+A+R+ STVGEIVNLMS+DAQ+F++L++YI+MIWS P Q++ AL  LW  LGPSVLAG+ +M+LM+P+NAVI   T+  Q  Q+K  DSRIK+MNE+LNGIKVLKLYAWE +F   V++IR  ELK +K+AAY  A  +FT+ CAPFLV+L+TF ++VLI   NVLDAEKAFVS+ LFNILRFPL MLPMVIS+++QASVSLKRL  FL  EE+ +D+V      G   + +I++G+F W S +  P LK +N+  PE  LVA+VG VG GKSS+LSALLGE+DK+EG V++KGS+AYVPQQAWI+NAT+++NI+FG       Y R+++AC L +D EIL   D TEIGEKG+NLSGGQKQRVSLARA Y D +VYLLDDPLSAVD+HVGK + D+VI   G+L   TRILVTH L+ L +   ++VM +G ++E G+Y  L    GAFA F+  + A+E                            SE  +   N  +          K MEN         +  +N++K   +++  E+     K        K  + + +  G VK++V+ +YL++IG  L+   +L F++    SL +N WL  W+D   +              N +Q             R + LG+YG  G  Q +     SL  +   I ++  LH+ +L  VLR PMS FE  P G ++NRF+ +++ + +++P  +  F+ +    +   I++ +  P + + +  +   Y  +QR YV++SRQLKRLESV +SPIY+HF ETL G S IRA+   ++FI  +D +VD N  +YY   V+NRWLA+ LE VGN IV  AALFAV++ ++   ++ G++GLS+SYAL +T +L WLVRMSS+VE+NIV+VER++EYS    EA W         +WP  GCI+  N+  +YR  LD  ++NIN  I+  EKVGIVGRTG+GKSSL L LFRI+E ++G I IDG+ I +LGLH++R R+TIIPQDPVLFSGTLR NLDPF+ + DE+IWK LE S+LK+FV  SG  ++L    SEGGENLS+GQRQL+CLARALLR+T +LVLDEATAA+D++TD LIQ TIR +F+ CT+LTIAHRLNT++DY ++LVL+ G++ E D+P+NL+   +  FY MAK S LI
Sbjct:   17 DWNRSWNTSNPDLTPCFQSTVLVWVPCLYLWLCAPF--YLMYMRSHNRGYICMSHLNKAKTAVGFLLWIICWLDVFYSFWERSHSRNVAAVHLVSPTLLGLTMLLATLLVQYERMKGVQSSGIMLIFWLLALLCASVTFRSKILQAQDQPEAVSGWRYTTFYVYYALLLLALVLSC-------------------------------LSDQMPLFSQAVK------------------DPNPCPEPGASFLSRITFWWISGMMLSGYKRPLEEKDLWSLNPEDRSHCVVPQLLRRWTAECHKVKRTE---EKMLYSPKQ------------------PPHGENKEVRAVEESEILIVKSPKKSREPSLLWALCLTFAPHFLVSCLYKLIQDILMFVGPEILRLLILFVNDPDAPS-WQGYFYAALLFVCTCVQSLILQRYFHVCFVSGMRLRTAVIGAIYRKALVISSAARRSSTVGEIVNLMSVDAQRFMDLVTYINMIWSAPLQVVLALYFLWENLGPSVLAGVAVMILMVPINAVIAMKTKTYQVAQMKNKDSRIKLMNEMLNGIKVLKLYAWEMAFKEKVSQIRENELKVLKKAAYLGAVSTFTWVCAPFLVALSTFSVYVLIDDQNVLDAEKAFVSLALFNILRFPLNMLPMVISSMVQASVSLKRLRVFLSHEELQEDSVERPAAGGSPYSISIEDGVFSW-SRSESPTLKRLNVRIPEGSLVAVVGHVGSGKSSLLSALLGEMDKMEGSVSVKGSVAYVPQQAWILNATLKNNIVFGQKRKEAWYHRVVEACALHQDLEILPAGDETEIGEKGVNLSGGQKQRVSLARAVYCDRSVYLLDDPLSAVDAHVGKHIFDHVIGPQGLLKDKTRILVTHGLSYLPQAHLVLVMVDGEITEVGSYQQLKEKEGAFAEFLRMYAANE---------------------------QSEETEPVPNSPT----------KPMENGVGPGFTGSQSASNVSKGSVSEQNVEQ-----KNSKNAEAGKTTDADKALTGRVKLSVFFSYLKAIGVLLSIISLLFFLSHNLLSLFANYWLSLWTDDPVV--------------NGTQP-----------NRLMRLGVYGALGVSQGVAVCGYSLSVSIGGILASRFLHQSMLFDVLRSPMSFFERTPSGNLVNRFAKEMDTIDSVIPMILKMFMGSLFNVVGSCIIILVATPMVALIIPFLGVLYFFVQRFYVASSRQLKRLESVSRSPIYTHFSETLLGTSVIRAFGEQERFIHESDQRVDHNQKAYYPGIVANRWLAVRLEFVGNCIVSFAALFAVLARES---LSPGIMGLSISYALQLTASLTWLVRMSSDVETNIVAVERVKEYSDTEKEAEWRHEPPTVPPDWPTEGCIRITNFGLRYRSDLDLAIRNINVDISGGEKVGIVGRTGAGKSSLTLGLFRIIEPAEGNIFIDGVDIAKLGLHELRSRITIIPQDPVLFSGTLRMNLDPFDSYSDEDIWKALEFSHLKSFV--SGLPDKLGHECSEGGENLSLGQRQLLCLARALLRKTKVLVLDEATAAIDMETDDLIQTTIRSQFEGCTVLTIAHRLNTIMDYTRVLVLDKGQMAEFDSPSNLIAQ-KGAFYRMAKDSGLI 1510          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Medaka
Match: abcc3 (ATP binding cassette subfamily C member 3 [Source:NCBI gene;Acc:101175305])

HSP 1 Score: 1210.67 bits (3131), Expect = 0.000e+0
Identity = 683/1618 (42.21%), Postives = 990/1618 (61.19%), Query Frame = 2
Query:  227 LILCFPYI-------IHLIRKKVNERPFFKLTIIK--------LALIVCLMVLQILEIIYNAAKKNNIPYAYTISNCSFLVCMSILAIMVGLERRCNAVNSGFYFNYWLLHFILCAVRARASGLSLKLKITNRDYSRECFIFINLTFVTLSLVLSCFSEKVSQSEIERLNKKRKFQNVLHVNADDNHVSDRMEMSPNAVDSYKTTEKDILINKTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXXXXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSHDDTPG-IAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISS---LSKSREKIYKSMENLKMDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQ-XXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWPV-GCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNLI 5017
            ++ C P I       ++L   K N R +  ++I+         L  IVC     +    +   +    P  + I+       M +  +++  ER     +SG  F +W L  +   V  R+  L    +    D  R    ++  + V   L+L CF+                                               E+  L   +D   D   CPE  + FLS + F+WFT L +KGYK+PL+ +DLW L   +   ++VP       + LA  ++ ++K+     + +N SG+       P K    S  D  + + P+  +     +K +  P  + A++K+  PY L+   YK++ D++ F+ P LL LL+ F +  E+   W GY +A LM  +A ++T ILH++F   F  GM VR++LI A+YRK+L ++ A+++ STVGEIVNLMS+DAQ+F++L ++++M+WS P QI+ AL  LW  LGPSVLAG+ +M+++IP+NA I   TR  Q +Q++  D+R+K+MNEILNGIKVLKLYAWE SF   V +IR KEL  +++ AY  A  +  +  APFLV+LT+F +FV +  +NVLDA++AFVS++LFNILRFPL MLP VIS++ QASVSLKR+  FL  +E++ D+V   +TPG  + T+ NG F W    P PVL ++++  P   L+A+VGPVGCGKSS++SALLGE++KLEG V+++GS+AYVPQQAWI NAT+RDNI+FG  Y+  KY  ++ AC L +D E+L   D TEIGEKGINLSGGQ+QRVSLARA YSD++VYLLDDPLSAVD+HV K + D +I   G+L   TRILVTH ++ L + D I+V+  G VSE G++ +L++  GAFA F+  +  +++   +       +  E             E+   + +M+ +   ++++R+   + M  L  D E    N  +    +    +  +   P  +K   KLI+ ET++ G VK  VY+ Y++++G  L+  I+LL+      ++GSN+WL +W++ +              A N +Q+ +            + + +Y   G  Q  L+ +   L   ++ + +A  +H  LL GVLR P + F++ P GR++NRF +D++AV  ++P  ++ ++ T    + V ++ +   P  +I ++ +  FY  +QR YV++SRQLKRLESV +SPIYSHF ET+ G S IRAY   D F+  +D KVD+N  SYY   VSNRWL + +E +GN IV  AALFAVI  +    +N GLVGLSVSYAL +T +LNW+VRM+S++E+NIV+VER++EYS+  PEAPW++ +KKP   WP  G ++F  YS +YR+GLD VLKNI   +   EK+GIVGRTG+GKSS+ L LFR+LE + GEI IDG+ I E+GLHD+R RLTIIPQ+PVLFSGTLR NLDPF+K+ DE++WK LE S+L  FV N    QL+M  +EGGENLSVGQRQLVCLARALLR+T IL+LDEATAA+DL+TD LIQ TIR +F+  T+ TIAHRLNT++DY ++LVL+ G+I E D P NL+      FY MAK + L+
Sbjct:   33 VLACLPCIYLWVVSPVYLFYLKRNNRGYIMVSILNRFKTVFGLLLWIVCWT--DLFYSFHEMQQGQTPPPIFFITPLVLGTTMLLATVLIQYERLHGVQSSGVLFIFWFLSVLCAIVPFRSKILKASGESEVPDKLRFTTFYVYFSLVVCELILCCFN-----------------------------------------------ERPPLF--SDTVTDPNPCPETTAGFLSSMTFWWFTSLALKGYKMPLEAKDLWSLKKRDSSETMVP-------RLLAEWRKEEAKA----RSQQNLSGQAQYAKLPPSKANHLSG-DEAEDNGPKEGDVLLSNQKAQKQPSFLRAILKAFGPYFLIGSAYKLLQDVITFINPQLLSLLISF-TKQEDVPLWWGYTLAFLMFFTAFLQTLILHRHFQYCFVTGMNVRTALIGAIYRKALVITNAAKRSSTVGEIVNLMSVDAQRFMDLTAFLNMLWSAPLQIMLALYFLWENLGPSVLAGVAVMVMLIPLNAFIAMKTRAYQVEQMQHKDARLKLMNEILNGIKVLKLYAWEESFKQKVLDIRQKELNVLRKTAYLGALSTMAWTSAPFLVALTSFAVFVSVDENNVLDAKRAFVSLSLFNILRFPLNMLPQVISSIAQASVSLKRIQNFLSHDELDPDSVDRKNTPGDFSVTVVNGTFTWAKEDP-PVLHSVSVMVPRGSLLAVVGPVGCGKSSLISALLGEMEKLEGEVSIQGSVAYVPQQAWIQNATLRDNILFGNAYNEQKYCSVLDACALTQDLEVLPGGDQTEIGEKGINLSGGQRQRVSLARALYSDADVYLLDDPLSAVDAHVAKHIFDRLIGPDGLLKEKTRILVTHGISFLPQVDNIMVLGAGRVSEMGSHQELLKQNGAFAEFLRNYALEDILEEDELEDELLDEMEFFPE--------EELGNHHCDMMENEPVMNEARKAFMRQMSVLSADGE----NPRRRSVRRHGCSQRKRGEPPEKKKELEKLIQAETAETGRVKTKVYLEYVKAVGVLLSVLILLLYGCQSAAAIGSNIWLSQWTNDA--------------AGNHTQENV-----------QMRVSVYAALGIAQGLLVLVTCLLCRVYSTLHAAQLMHGRLLQGVLRAPQAFFQSTPSGRLLNRFGTDMDAVDFLIPDNMDIWMRTFWYTLNVLLICSALTPVFLIVVAPLTLFYWWVQRFYVASSRQLKRLESVSRSPIYSHFSETVTGSSVIRAYGRLDAFVLMSDAKVDENQRSYYPGIVSNRWLGVRIEFIGNCIVLFAALFAVIWKET---LNPGLVGLSVSYALQVTMSLNWMVRMTSDLENNIVAVERVKEYSETKPEAPWEVEDKKPPPEWPTDGKVEFHGYSVRYRDGLDLVLKNITLDVKGGEKIGIVGRTGAGKSSMTLCLFRLLEAAAGEITIDGVKIAEIGLHDLRSRLTIIPQEPVLFSGTLRMNLDPFDKYSDEDVWKALEHSHLHGFVRNQ-PAQLQMECAEGGENLSVGQRQLVCLARALLRKTRILILDEATAAIDLETDDLIQSTIRTQFENSTVFTIAHRLNTIMDYTRVLVLDKGKIAEFDTPTNLISK-RGIFYGMAKDAGLV 1543          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Medaka
Match: abcc1 (multidrug resistance-associated protein 1 [Source:NCBI gene;Acc:101173789])

HSP 1 Score: 1181.39 bits (3055), Expect = 0.000e+0
Identity = 692/1605 (43.12%), Postives = 977/1605 (60.87%), Query Frame = 2
Query:  140 DWASEWNSPSPDIPTCFQFFDAPIYLLGYLILCFPYIIHLIRKKVNERPFF---KLTIIKLALIVCLMVLQILEIIYNAAKKN---NIPYAYTISNCSFLVCMSILAIMVGLERRCNAVNSGFYFNYWLLHFILCAVRARASGLSLKLKITNRDYSRECFIFINLTFVTLSLVLSCFSEKVSQSEIERLNKKRKFQNVLHVNADDNHVSDRMEMSPNAVDSYKTTEKDILINKTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNK--RSIPQNAXXXXXXXXXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSHDDTPG--IAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSMEN---LKMDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWPV-GCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSG-NEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQ 4909
            DW   WN+ +PD+  CFQ          YL LC P+  +L+  + + R +     L   K A+   L ++  L++ Y+  +++   N+   + +S     + M +  ++V  ER     +SG    +WLL  +  +V  R+  L  + +       R    ++    + L+LVLSC                               +SD+M +   AV                   D   CPE  +SFLSRI F+W + +++ GYK PL+ +DLW LN E+R   +VP LLR +       KR +   +KML + K                    P   NK  R++ ++        K+  +P L+ AL  +  P+ L+S LYK+I DIL F+GP +L+LL+ FV+D +    W+GYF AAL+ +   V++ IL +YFH+ F  GMR+R+++I A+YRK+L +S+A+R+ STVGEIVNLMS+DAQ+F++L++YI+MIWS P Q++ AL  LW  LGPSVLAG+ +M+LM+P+NAVI   T+  Q  Q+K  DSRIK+MNE+LNGIKVLKLYAWE +F   V++IR  ELK +K+AAY  A  +FT+ CAPFLV+L+TF ++VLI   NVLDAEKAFVS+ LFNILRFPL MLPMVIS+++QASVSLKRL  FL  EE+ +D+V      G   + +I++G+F W S +  P LK +N+  PE  LVA+VG VG GKSS+LSALLGE+DK+EG V++KGS+AYVPQQAWI+NAT+++NI+FG       Y R+++AC L +D EIL   D TEIGEKG+NLSGGQKQRVSLARA Y D +VYLLDDPLSAVD+HVGK + D+VI   G+L   TRILVTH L+ L +   ++VM +G ++E G+Y  L    GAFA F+  + A+E                            SE  +   N  +          K MEN         +  +N++K   +++  E+     K        K  + + +  G VK++V+ +YL++IG  L+   +L F++    SL +N WL  W+D   +              N +Q             R + LG+YG  G  Q +     SL  +   I ++  LH+ +L  VLR PMS FE  P G ++NRF+ +++ + +++P  +  F+ +    +   I++ +  P + + +  +   Y  +QR YV++SRQLKRLESV +SPIY+HF ETL G S IRA+   ++FI  +D +VD N  +YY   V+NRWLA+ LE VGN IV  AALFAV++ ++   ++ G++GLS+SYAL +T +L WLVRMSS+VE+NIV+VER++EYS    EA W         +WP  GCI+  N+  +YR  LD  ++NIN  I+  EKVGIVGRTG+GKSSL L LFRI+E ++G I IDG+ I +LGLH++R R+TIIPQDPVLFSGTLR NLDPF+ + DE+IWK LE S+LK+FV  SG  ++L    SEGGENLS+GQRQL+CLARALLR+T +LVLDEATAA+D++TD LIQ TIR +F+ CT+LTIAHRLNT++DY +
Sbjct:   17 DWNRSWNTSNPDLTPCFQSTVLVWVPCLYLWLCAPF--YLMYMRSHNRGYICMSHLNKAKTAVGFLLWIICWLDVFYSFWERSHSRNVAAVHLVSPTLLGLTMLLATLLVQYERMKGVQSSGIMLIFWLLALLCASVTFRSKILQAQDQPEAVSGWRYTTFYVYYALLLLALVLSC-------------------------------LSDQMPLFSQAVK------------------DPNPCPEPGASFLSRITFWWISGMMLSGYKRPLEEKDLWSLNPEDRSHCVVPQLLRRWTAECHKVKRTE---EKMLYSPKQ------------------PPHGENKEVRAVEESEILIVKSPKKSREPSLLWALCLTFAPHFLVSCLYKLIQDILMFVGPEILRLLILFVNDPDAPS-WQGYFYAALLFVCTCVQSLILQRYFHVCFVSGMRLRTAVIGAIYRKALVISSAARRSSTVGEIVNLMSVDAQRFMDLVTYINMIWSAPLQVVLALYFLWENLGPSVLAGVAVMILMVPINAVIAMKTKTYQVAQMKNKDSRIKLMNEMLNGIKVLKLYAWEMAFKEKVSQIRENELKVLKKAAYLGAVSTFTWVCAPFLVALSTFSVYVLIDDQNVLDAEKAFVSLALFNILRFPLNMLPMVISSMVQASVSLKRLRVFLSHEELQEDSVERPAAGGSPYSISIEDGVFSW-SRSESPTLKRLNVRIPEGSLVAVVGHVGSGKSSLLSALLGEMDKMEGSVSVKGSVAYVPQQAWILNATLKNNIVFGQKRKEAWYHRVVEACALHQDLEILPAGDETEIGEKGVNLSGGQKQRVSLARAVYCDRSVYLLDDPLSAVDAHVGKHIFDHVIGPQGLLKDKTRILVTHGLSYLPQAHLVLVMVDGEITEVGSYQQLKEKEGAFAEFLRMYAANE---------------------------QSEETEPVPNSPT----------KPMENGVGPGFTGSQSASNVSKGSVSEQNVEQ-----KNSKNAEAGKTTDADKALTGRVKLSVFFSYLKAIGVLLSIISLLFFLSHNLLSLFANYWLSLWTDDPVV--------------NGTQP-----------NRLMRLGVYGALGVSQGVAVCGYSLSVSIGGILASRFLHQSMLFDVLRSPMSFFERTPSGNLVNRFAKEMDTIDSVIPMILKMFMGSLFNVVGSCIIILVATPMVALIIPFLGVLYFFVQRFYVASSRQLKRLESVSRSPIYTHFSETLLGTSVIRAFGEQERFIHESDQRVDHNQKAYYPGIVANRWLAVRLEFVGNCIVSFAALFAVLARES---LSPGIMGLSISYALQLTASLTWLVRMSSDVETNIVAVERVKEYSDTEKEAEWRHEPPTVPPDWPTEGCIRITNFGLRYRSDLDLAIRNINVDISGGEKVGIVGRTGAGKSSLTLGLFRIIEPAEGNIFIDGVDIAKLGLHELRSRITIIPQDPVLFSGTLRMNLDPFDSYSDEDIWKALEFSHLKSFV--SGLPDKLGHECSEGGENLSLGQRQLLCLARALLRKTKVLVLDEATAAIDMETDDLIQTTIRSQFEGCTVLTIAHRLNTIMDYTR 1475          

HSP 2 Score: 77.7962 bits (190), Expect = 1.062e-13
Identity = 65/219 (29.68%), Postives = 106/219 (48.40%), Query Frame = 2
Query: 4346 LKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKT--FVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETI---RREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQF 4987
            LK +N  I     V +VG  GSGKSSL+ AL   ++K +G +              V+G +  +PQ   + + TL+ N+    K  +    +V+E   L     ++ +G+E     I E G NLS GQ+Q V LARA+    ++ +LD+  +AVD      I + +   +   K+ T + + H L+ +     +LV+ +GEI E+ +    LK  E  F
Sbjct:  658 LKRLNVRIPEGSLVAVVGHVGSGKSSLLSALLGEMDKMEGSV-------------SVKGSVAYVPQQAWILNATLKNNIVFGQKRKEAWYHRVVEACALHQDLEILPAGDET---EIGEKGVNLSGGQKQRVSLARAVYCDRSVYLLDDPLSAVDAHVGKHIFDHVIGPQGLLKDKTRILVTHGLSYLPQAHLVLVMVDGEITEVGSYQQ-LKEKEGAF 859          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Medaka
Match: abcc1 (multidrug resistance-associated protein 1 [Source:NCBI gene;Acc:101173789])

HSP 1 Score: 1180.62 bits (3053), Expect = 0.000e+0
Identity = 692/1605 (43.12%), Postives = 976/1605 (60.81%), Query Frame = 2
Query:  140 DWASEWNSPSPDIPTCFQFFDAPIYLLGYLILCFPYIIHLIRKKVNERPFF---KLTIIKLALIVCLMVLQILEIIYNAAKKN---NIPYAYTISNCSFLVCMSILAIMVGLERRCNAVNSGFYFNYWLLHFILCAVRARASGLSLKLKITNRDYSRECFIFINLTFVTLSLVLSCFSEKVSQSEIERLNKKRKFQNVLHVNADDNHVSDRMEMSPNAVDSYKTTEKDILINKTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNK--RSIPQNAXXXXXXXXXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSHDDTPG--IAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSMEN---LKMDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWPV-GCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSG-NEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQ 4909
            DW   WN+ +PD+  CFQ          YL LC P+ +  +R   + R +     L   K A+   L ++  L++ Y+  +++   N+   + +S     + M +  ++V  ER     +SG    +WLL  +  +V  R+  L  + +       R    ++    + L+LVLSC                               +SD+M +   AV                   D   CPE  +SFLSRI F+W + +++ GYK PL+ +DLW LN E+R   +VP LLR +       KR +   +KML + K                    P   NK  R++ ++        K+  +P L+ AL  +  P+ L+S LYK+I DIL F+GP +L+LL+ FV+D +    W+GYF AAL+ +   V++ IL +YFH+ F  GMR+R+++I A+YRK+L +S+A+R+ STVGEIVNLMS+DAQ+F++L++YI+MIWS P Q++ AL  LW  LGPSVLAG+ +M+LM+P+NAVI   T+  Q  Q+K  DSRIK+MNE+LNGIKVLKLYAWE +F   V++IR  ELK +K+AAY  A  +FT+ CAPFLV+L+TF ++VLI   NVLDAEKAFVS+ LFNILRFPL MLPMVIS+++QASVSLKRL  FL  EE+ +D+V      G   + +I++G+F W S +  P LK +N+  PE  LVA+VG VG GKSS+LSALLGE+DK+EG V++KGS+AYVPQQAWI+NAT+++NI+FG       Y R+++AC L +D EIL   D TEIGEKG+NLSGGQKQRVSLARA Y D +VYLLDDPLSAVD+HVGK + D+VI   G+L   TRILVTH L+ L +   ++VM +G ++E G+Y  L    GAFA F+  + A+E                            SE  +   N  +          K MEN         +  +N++K   +++  E+     K        K  + + +  G VK++V+ +YL++IG  L+   +L F++    SL +N WL  W+D   +              N +Q             R + LG+YG  G  Q +     SL  +   I ++  LH+ +L  VLR PMS FE  P G ++NRF+ +++ + +++P  +  F+ +    +   I++ +  P + + +  +   Y  +QR YV++SRQLKRLESV +SPIY+HF ETL G S IRA+   ++FI  +D +VD N  +YY   V+NRWLA+ LE VGN IV  AALFAV++ ++   ++ G++GLS+SYAL +T +L WLVRMSS+VE+NIV+VER++EYS    EA W         +WP  GCI+  N+  +YR  LD  ++NIN  I+  EKVGIVGRTG+GKSSL L LFRI+E ++G I IDG+ I +LGLH++R R+TIIPQDPVLFSGTLR NLDPF+ + DE+IWK LE S+LK+FV  SG  ++L    SEGGENLS+GQRQL+CLARALLR+T +LVLDEATAA+D++TD LIQ TIR +F+ CT+LTIAHRLNT++DY +
Sbjct:   55 DWNRSWNTSNPDLTPCFQSTVLVWVPCLYLWLCAPFYLMYMRS--HNRGYICMSHLNKAKTAVGFLLWIICWLDVFYSFWERSHSRNVAAVHLVSPTLLGLTMLLATLLVQYERMKGVQSSGIMLIFWLLALLCASVTFRSKILQAQDQPEAVSGWRYTTFYVYYALLLLALVLSC-------------------------------LSDQMPLFSQAVK------------------DPNPCPEPGASFLSRITFWWISGMMLSGYKRPLEEKDLWSLNPEDRSHCVVPQLLRRWTAECHKVKRTE---EKMLYSPKQ------------------PPHGENKEVRAVEESEILIVKSPKKSREPSLLWALCLTFAPHFLVSCLYKLIQDILMFVGPEILRLLILFVNDPDAPS-WQGYFYAALLFVCTCVQSLILQRYFHVCFVSGMRLRTAVIGAIYRKALVISSAARRSSTVGEIVNLMSVDAQRFMDLVTYINMIWSAPLQVVLALYFLWENLGPSVLAGVAVMILMVPINAVIAMKTKTYQVAQMKNKDSRIKLMNEMLNGIKVLKLYAWEMAFKEKVSQIRENELKVLKKAAYLGAVSTFTWVCAPFLVALSTFSVYVLIDDQNVLDAEKAFVSLALFNILRFPLNMLPMVISSMVQASVSLKRLRVFLSHEELQEDSVERPAAGGSPYSISIEDGVFSW-SRSESPTLKRLNVRIPEGSLVAVVGHVGSGKSSLLSALLGEMDKMEGSVSVKGSVAYVPQQAWILNATLKNNIVFGQKRKEAWYHRVVEACALHQDLEILPAGDETEIGEKGVNLSGGQKQRVSLARAVYCDRSVYLLDDPLSAVDAHVGKHIFDHVIGPQGLLKDKTRILVTHGLSYLPQAHLVLVMVDGEITEVGSYQQLKEKEGAFAEFLRMYAANE---------------------------QSEETEPVPNSPT----------KPMENGVGPGFTGSQSASNVSKGSVSEQNVEQ-----KNSKNAEAGKTTDADKALTGRVKLSVFFSYLKAIGVLLSIISLLFFLSHNLLSLFANYWLSLWTDDPVV--------------NGTQP-----------NRLMRLGVYGALGVSQGVAVCGYSLSVSIGGILASRFLHQSMLFDVLRSPMSFFERTPSGNLVNRFAKEMDTIDSVIPMILKMFMGSLFNVVGSCIIILVATPMVALIIPFLGVLYFFVQRFYVASSRQLKRLESVSRSPIYTHFSETLLGTSVIRAFGEQERFIHESDQRVDHNQKAYYPGIVANRWLAVRLEFVGNCIVSFAALFAVLARES---LSPGIMGLSISYALQLTASLTWLVRMSSDVETNIVAVERVKEYSDTEKEAEWRHEPPTVPPDWPTEGCIRITNFGLRYRSDLDLAIRNINVDISGGEKVGIVGRTGAGKSSLTLGLFRIIEPAEGNIFIDGVDIAKLGLHELRSRITIIPQDPVLFSGTLRMNLDPFDSYSDEDIWKALEFSHLKSFV--SGLPDKLGHECSEGGENLSLGQRQLLCLARALLRKTKVLVLDEATAAIDMETDDLIQTTIRSQFEGCTVLTIAHRLNTIMDYTR 1513          

HSP 2 Score: 77.7962 bits (190), Expect = 1.105e-13
Identity = 65/219 (29.68%), Postives = 106/219 (48.40%), Query Frame = 2
Query: 4346 LKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKT--FVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETI---RREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQF 4987
            LK +N  I     V +VG  GSGKSSL+ AL   ++K +G +              V+G +  +PQ   + + TL+ N+    K  +    +V+E   L     ++ +G+E     I E G NLS GQ+Q V LARA+    ++ +LD+  +AVD      I + +   +   K+ T + + H L+ +     +LV+ +GEI E+ +    LK  E  F
Sbjct:  696 LKRLNVRIPEGSLVAVVGHVGSGKSSLLSALLGEMDKMEGSV-------------SVKGSVAYVPQQAWILNATLKNNIVFGQKRKEAWYHRVVEACALHQDLEILPAGDET---EIGEKGVNLSGGQKQRVSLARAVYCDRSVYLLDDPLSAVDAHVGKHIFDHVIGPQGLLKDKTRILVTHGLSYLPQAHLVLVMVDGEITEVGSYQQ-LKEKEGAF 897          
BLAST of Multidrug resistance-associated protein 1 vs. Planmine SMEST
Match: SMESG000014785.1 (SMESG000014785.1)

HSP 1 Score: 3154.77 bits (8178), Expect = 0.000e+0
Identity = 1628/1629 (99.94%), Postives = 1629/1629 (100.00%), Query Frame = 2
Query:  131 MSTDWASEWNSPSPDIPTCFQFFDAPIYLLGYLILCFPYIIHLIRKKVNERPFFKLTIIKLALIVCLMVLQILEIIYNAAKKNNIPYAYTISNCSFLVCMSILAIMVGLERRCNAVNSGFYFNYWLLHFILCAVRARASGLSLKLKITNRDYSRECFIFINLTFVTLSLVLSCFSEKVSQSEIERLNKKRKFQNVLHVNADDNHVSDRMEMSPNAVDSYKTTEKDILINKTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXXXXXFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSHDDTPGIAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSMENLKMDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWPVGCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNLI 5017
            MSTDWASEWNSPSPDIPTCFQFFDAPIYLLGYLILCFPYIIHLIRKKVNERPFFKLTIIKLALIVCLMVLQILEIIYNAAKKNNIPYAYTISNCSFLVCMSILAIMVGLERRCNAVNSGFYFNYWLLHFILCAVRARASGLSLKLKITNRDYSRECFIFINLTFVTLSLVLSCFSEKVSQSEIERLNKKRKFQNVLHVNADDNHVSDRMEMSPNAVDSYKTTEKDILINKTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGKKYKEIEEPEKEKLTSPPDNNKRSIPQNAETDTDKKKEKFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGP+QIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSHDDTPGIAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFDELEEKDLLLQDLQRTYSEINQSNANMISSLSKSREKIYKSMENLKMDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQALIQLFSSLFFAFAIIKSAASLHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMSSEVESNIVSVERIEEYSQMPPEAPWDISEKKPDENWPVGCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNLI
Sbjct:    1 MSTDWASEWNSPSPDIPTCFQFFDAPIYLLGYLILCFPYIIHLIRKKVNERPFFKLTIIKLALIVCLMVLQILEIIYNAAKKNNIPYAYTISNCSFLVCMSILAIMVGLERRCNAVNSGFYFNYWLLHFILCAVRARASGLSLKLKITNRDYSRECFIFINLTFVTLSLVLSCFSEKVSQSEIERLNKKRKFQNVLHVNADDNHVSDRMEMSPNAVDSYKTTEKDILINKTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGKKYKEIEEPEKEKLTSPPDNNKRSIPQNAETDTDKKKEKFDPCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPYQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSHDDTPGIAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFDELEEKDLLLQDLQRTYSEINQSNANMISSLSKSREKIYKSMENLKMDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQALIQLFSSLFFAFAIIKSAASLHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMSSEVESNIVSVERIEEYSQMPPEAPWDISEKKPDENWPVGCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNLI 1629          
BLAST of Multidrug resistance-associated protein 1 vs. Planmine SMEST
Match: SMESG000057252.1 (SMESG000057252.1)

HSP 1 Score: 1178.31 bits (3047), Expect = 0.000e+0
Identity = 691/1656 (41.73%), Postives = 1011/1656 (61.05%), Query Frame = 2
Query:  122 CYNMSTDWA-----SEWNSPSPDIPTCFQFFDAP-IYLLGYLILCFPYI---------IHLIRKKVNERPFFKLTIIKLALIVCLMVLQILEIIYNAAKKNNIPYAYTISNCSFLVCMSILAIMVGLERRCNAVNSGFYFNYWLLHFI--LCAVRARASGLSLKLKITNRDYSRECFIFINLTFVTLSLVLSCFSEKVSQSEIERLNKKRKFQNVLHVNADDNHVSDRMEMSPNAVDSYKTTEKDILINKTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKR-RDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXXXXXFDPCLMNALIKS-HFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSHDDTPGIAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEIN-----QSNANMISSLSKSREKIYKSMENLKMDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWP-VGCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNL 5014
            C + S DW        WN+  PDI  CFQ+     I LL   I C  YI         I+  R K N    FK T+I  A I+   +L     I  +      P A  +      +   +L  +  L  +    +SG  F YWLL  +  +  + +R      +LK  +RD  R          V +S +L+CF++    ++ E++N    FQ       D +     + + P+        +K I IN+         CPE   SFLS++ F W T L++KGY+ PL  +DL+ L   + C +IV  +   +++    N+R + +K  K L  +K N             + L S  +  +    QN   + ++KK+   P  + AL  +  +PY+L +G++K+ +D+L F  P +L L + F+ D+   + W G+ +A  + + +M+R+ I  QY+H  +  GMR R+++I  +YRK+L+LS+ SRKE+TVGEIVNLMS+D+QK  ++ S++H++W+ P  I+ A+  LW ELGPSVLAG+ +M+ +IP+N +IG+  +K+QA+Q+K+ D+RIK+MNEIL+GIK+LKLYAWE SF   +  IRN E + ++ A Y NA  + T+ CAPFLV+L TF  F L S  +VL A KAFVS++LFNIL FP+ MLP VI   IQA VSLKR+  FL  +E++ + V           I +G F W   T  PVL NIN+  PE  LVA+VG VG GK+S++SAL+GE+ K+ G V  +GSI Y+PQQAW  NA+++DNI+F  P    KY R+I+AC L  D ++L   D TEIGEKGINLSGGQKQR+SLARA Y D +VYLLDDPLSAVDSHVGK + D VI  +G+L+  TRILVTH L  L K D+I VM +G VSE GT+++L+++ G+FA FI T+L  E +    ++   +  E K  L   + R  S I+     Q +++  + L+ SR   +K   ++++   + V       +                +    +LIEEE ++ G VK +V+++Y+RS  +  +  ++  +      S+G+N++L  W++                + N +Q           D +   LGIYG  G  QAL  L  +   A+    ++ SLH LLL  +LR P S F+T P+GRI+NR   D++ V   +P  I  +L+T    I    +++I +P+ ++ L  + A Y + QR Y+ TSRQLKR++S+ +SPIYSHF E++ G SSIRAY + D FI+  D   D+N  ++Y N VS RWL   LET+GN ++ ++ + AV++    + I +G  GLS+SYAL IT  LN++VRM+S++ES+ V+VERI+EY+++  EAPW+I E +   +WP  G ++FVNYS +YR GLD VL+N+N +++  EK+GIVGRTG+GKSSL LALFR++E ++G I+ID   I +LGLHD+R ++TIIPQDP+LFSGT+R NLDPFN+H D E+W VLEMS LK+F+  + +E L+ ++SEGGENLSVGQ+QLVCLARALL+++ +LVLDEATAAVDL+TD LIQ +IRR+FK+CT+LTIAHRLNT++DYD+++VLE G + E+D+P NLL N +S F+SMA  + L
Sbjct:   10 CSDKSNDWLLWYDLIGWNTQDPDITLCFQYTILNWIPLLFLWISCMIYIPILWNKASFIYRNRGKFN---IFKSTLI--AFILFFHLLNFCATISESISNLYPPPALYLQPILSAISSILLIYLNRLIYKKGIHSSGVLFFYWLLQLLASITVIYSRYR----RLKFHDRDLFRTVTATFEFLLVFVSFILNCFADLAVFTDSEQINN---FQQ------DFDETQPLLSLIPD--------DKTIPINRI-------PCPENRVSFLSKLTFTWLTGLVIKGYRQPLTFKDLFALRENDTCDTIVTNMEFQWNR---ENQRVKQTKFHKKL--EKQNG-------FTSNYKPLKSEEEETEIDFVQNTNNNKEQKKK--SPSFLRALFHTIGYPYML-AGVFKVAYDLLTFAQPQILGLFITFI-DNPNDYVWHGFLLAICLFLISMIRSVIFQQYYHGCYVTGMRSRTAVIGIIYRKALKLSSTSRKETTVGEIVNLMSVDSQKLQDVPSFLHVLWTAPITIVIAIYFLWQELGPSVLAGVALMICLIPINGIIGSKVKKLQAKQMKMKDNRIKLMNEILSGIKILKLYAWENSFEENIQNIRNDECRILRSATYLNAVSAVTWFCAPFLVALCTFTAFTLSSSSHVLTANKAFVSLSLFNILSFPMSMLPGVIVYGIQAYVSLKRINKFLVGDELDTENVEVSPPDEKPVKIVDGTFSW-GKTEAPVLININMEVPEGSLVAVVGTVGSGKTSLISALIGELYKVSGRVMCRGSIGYIPQQAWCRNASLQDNILFSKPLINHKYNRVIEACALTEDLKVLPAGDQTEIGEKGINLSGGQKQRISLARAVYQDCSVYLLDDPLSAVDSHVGKHIFDQVIGPSGLLSSKTRILVTHGLTYLPKVDKIFVMKDGNVSESGTFTELLKNNGSFAEFIRTYLEQEEEENVEEDSEDESKELKKELKHTISRLSSNIDSESEYQKSSHSSNPLTDSRRS-HKRQSSVRLSKSRSVLAEEAEAEL--------------KKAKKKRLIEEEVAEIGGVKFSVFLSYIRSSTYLFSFTVVFSYALYMCCSVGANMFLSYWTETG--------------STNGTQNP---------DSQGFYLGIYGSLGAGQALFILIENFALAYGTFLASKSLHNLLLKNILRAPSSFFDTTPLGRILNRIGKDIDTVDVSIPTTIRIWLMTASGVIGSIFVISISSPYFLLALVPLTAMYYMAQRFYIYTSRQLKRIDSIKRSPIYSHFQESIVGASSIRAYKVSDDFIKKCDIMTDENQMAWYPNIVSYRWLQFYLETIGNLVILLSGVLAVVT---RSTIGSGYAGLSISYALQITGGLNYMVRMTSDLESHTVAVERIKEYAEIESEAPWNIEESQAHSDWPDSGRVEFVNYSVRYRPGLDLVLRNLNIVVDAGEKLGIVGRTGAGKSSLALALFRLIEPAEGTIIIDNRDITKLGLHDLRSKITIIPQDPILFSGTIRMNLDPFNQHSDGELWSVLEMSYLKSFIAKT-SEGLQYLVSEGGENLSVGQKQLVCLARALLKKSKVLVLDEATAAVDLETDDLIQSSIRRQFKKCTVLTIAHRLNTIMDYDRVMVLEQGRVKEIDSPQNLLANEKSIFHSMAVDAGL 1573          
BLAST of Multidrug resistance-associated protein 1 vs. Planmine SMEST
Match: SMESG000039911.1 (SMESG000039911.1)

HSP 1 Score: 1121.69 bits (2900), Expect = 0.000e+0
Identity = 662/1635 (40.49%), Postives = 969/1635 (59.27%), Query Frame = 2
Query:   95 MNRLVPNKTCYNMSTDWA-----SEWNSPSPDIPTCFQFFDAPIYLLGYLILCFPYIIHLI-------RKKVNERPFFKLTIIKLALIVCLMVLQILEII--YNAAKKNNIPYAYTISNCSFLVCMSILAIMVG-LERRCNAVNSGFYFNYWLLHFILCA----VRARASGLSLKLKITNRDYSRECFIFINLTFVTLSLVLSCFSEKVSQSEIERLNKKRKFQNVLHVNADDNHVSDRMEMSPN-AVDSYKTTEKDILINKTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPIL----LRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIPQNAXXXXXXXXXXFDPCLMNALIKS-HFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSHDDTPGIAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFXXXXXXXXXXXXXXRTYSEINQSNANMISSLSK----SREKIYKSMENLKMDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWP-VGCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQ 4909
            M+++     C + S DW        W++P+PDI  CFQ+      +L ++ L F +I  +I       R   + R   KL I K  LI  L+ + IL      N + KN  P +            SIL I +  +  +    +SG  F YWL+   LCA    V +R S    +L+ +N D        +    V +S   +CFS+    S           Q +L    D       + +S N  V+ +K                +K CPE  +SFLS++ F WFT +I+KGY+ PL   DL+ L  E+ C +IVP +     R  D+  A N  RD K  +      +++     +        L    D  K+   +              P  + +L+ +   PY+L +G++K+ +D+L F  P+LL   + F+ + ++ + W G+  AA + +  M+R+ IL QY+H  +  GMR R+++I  +YRK+L+LS+ SRK +TVGEIVNLMS+D+QK  ++  Y+H++WS P  I+ A+ LLW ELG +VLAG+ +M+ +IPVN +IG+  +K+Q +Q+K+ D+RIK+M+EIL+GIK+LKLYAWE SF   + +IRN E   ++ A Y NA  +  + CAPFLV++ +F  FVL S +NVL   KAFVS++LFNIL  P+ MLP  I   IQA VSL R+  FL  +E+++D V           + +G F W    P P L  IN+   E  LVA+VG VG GK+S++SAL+GE+ ++ G V  +GSIAYVPQQAW  NA+++DNIIF  P    KY  +I+AC L  D ++L   D TEIGEKG+NLSGGQKQR+SLARA Y D++VY+ DDPLSAVDSHVGK + + VI   G+L+G TRILVTH L  L K D I VM +G +SE GT+ +L+++ G FA F+ T+L  E +    ++   +  E K+ L + + +  S+++  N    S++S       +K ++   ++++   K V         +  +E++ K  K       NKLIE+E ++ G VK +V+++YLRS  +  +   ++ ++     S+G+NL+L  WS+                + N+S+ Q            +  LGIYG  G  Q +  L  +   A+    ++ SLH LLL  +LR P S F+T P+GRI+NR   D++ V   +P  I  +L T        I+++I +P+ +I L  +   Y + QR Y+ TSRQLKR++S+ +SPIYSHF ET+ G +SIRAY + + FI   D   D+N  ++Y N +S RWL + LET+GN ++ +A +  V++      I +G  GLS+SYAL IT +LN++VRM+ ++ES  V+VERI+EY+ +  EAPWD  E KP   WP  G ++F+NYS +YR GL+ VL+N+N  ++  EK+GIVGRTG+GKSSL LALFR++E ++G I ID + +  LGLHD+R ++TIIPQDPVLFSGTLR NLDPFN++ D E+W  LE S LK+FV  +  E L+ ++SE GEN+SVGQRQLVCLARALL+RT +LVLDEATAA+DL+TD LIQ +IR++FK CT+LTIAHRLNT+LDYD+
Sbjct:    1 MSKIYFTGLCSSKSDDWTLWYDKIGWDTPNPDITLCFQY-----TILNWIPLSFLWISSMIYIPILLNRISYSYRTLGKLNIFKTILIALLIFIHILNFFRTVNESVKNRSPPSVLYLQPILSGLSSILLIYLNRIIYKKGIHSSGVLFFYWLIQ--LCASVIVVYSRYS----RLQTSNPDIFSTVTATLEFILVLISFCANCFSDPAVLSN----------QEILDSEDDIEESQPLLNLSSNETVNRHK----------------IKACPEKKASFLSKLTFIWFTGMIIKGYRRPLIFSDLFALLNEDTCRNIVPKMEKEWSRELDRTSALN--RDRKKPQ-----GHDNFTASYQRLSQYISNLQDESDERKKHTIKT-------------PSFLRSLVYTIGLPYML-AGIHKLAYDLLTFTQPLLLGFFISFIENKKD-YVWHGFIYAACLFVIGMIRSVILQQYYHGCYVTGMRTRTAIIGIIYRKALKLSSTSRKNTTVGEIVNLMSVDSQKLQDVPVYLHLLWSSPIIIVIAMYLLWQELGAAVLAGIALMICLIPVNGIIGSRIKKLQNKQMKMKDNRIKLMSEILSGIKILKLYAWENSFCENIEKIRNDECVVLRSATYLNAFSAVIWFCAPFLVAVCSFAAFVLSSTENVLTPNKAFVSLSLFNILNVPMSMLPGTIVFGIQAYVSLVRVNKFLLGDELDQDNVEISPPNESPVKVIDGTFSWGKCDP-PTLTEINMDVSEGSLVAVVGTVGSGKTSLISALIGELYRVAGRVLCRGSIAYVPQQAWCQNASLQDNIIFRKPMVRHKYNSVIEACALTEDLKVLPGGDQTEIGEKGVNLSGGQKQRISLARAVYQDASVYIFDDPLSAVDSHVGKHIFNKVIGPDGLLSGKTRILVTHGLTFLPKVDNIFVMKDGKISENGTFKELVKNNGPFAEFVRTYLEQEEEEGEVEDSEDEAKELKNELKRTISKLSSQLDNQNELQKSTISNKFLFESKKSHRRQSSVRLSKSKSVL-------AEEAEEQMRKAKK-------NKLIEDEVAETGGVKFSVFLSYLRSSTYLFSIITVVSYLLYLVCSVGANLFLSYWSE----------------SGNTSKSQ------------NFYLGIYGAIGAGQGVFILIENFALAYGTFMASKSLHTLLLKSILRAPNSFFDTTPLGRILNRIGKDIDTVDVNIPTTIRMWLATAAGVFASVIVISISSPYFLIALIPLALMYYMAQRFYICTSRQLKRIDSIKRSPIYSHFQETIVGATSIRAYKVTEDFINKCDTMNDENQMAWYPNILSYRWLQLNLETIGNIVILLAGILGVLTRDT---IGSGYAGLSLSYALQITGSLNFMVRMTCDLESYTVAVERIKEYADIESEAPWDNEEVKPPAEWPSSGKVEFINYSVRYRPGLELVLRNLNLCVSAGEKLGIVGRTGAGKSSLALALFRLIEPAEGTIEIDNINVSRLGLHDLRSKITIIPQDPVLFSGTLRMNLDPFNQYSDGELWSSLESSYLKSFVSKTP-EGLDFIVSESGENMSVGQRQLVCLARALLKRTKVLVLDEATAAIDLETDDLIQNSIRKQFKSCTVLTIAHRLNTILDYDR 1529          
BLAST of Multidrug resistance-associated protein 1 vs. Planmine SMEST
Match: SMESG000064939.1 (SMESG000064939.1)

HSP 1 Score: 1089.72 bits (2817), Expect = 0.000e+0
Identity = 677/1651 (41.01%), Postives = 967/1651 (58.57%), Query Frame = 2
Query:  122 CYNMSTDWA-----SEWNSPSPDIPTCFQFFDAPIYLLGYLIL-CFPYIIHLIRKK-VNERPFFKLTIIKLALIVCLMVLQILEIIYNAAKK--NNIPYAYTISNCSFLVCMSILAIMVGLERRCNAVNS-GFYFNYWLLHFILCAVRARASGLSLKLKITNRDYSRECFIFINLTFVTLSLVLSCFSEKVSQSEIERLNKKRKFQNVLHVNADDNHVSDRMEMSPNAVDSYKTTEKDILINKTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIP-QNAXXXXXXXXXXFD---PCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSHDDTPGIAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSF-----XXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSMENLKMDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGFLVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWPV-GCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNL 5014
            C N S DW      + W++P+PD+  CFQ+       L +LI+ C   I  L+RKK +      K  IIK  L+  L  +  L++  + + +     P              S+L I V        V+S G  F YW L  I+ A+   +   S+++K    D  R     I    V +S + +CF++    S + +    +   N    + D+ H+     + PN ++  KT E  +             CPE  +SFLS+I F W T LI +G++ PL  +DL++L  E+ C  IVPI+ R +++ L    R+  K   +                     KL S   +  +S+P +N E++T K     D   P  +  L+ +       SGL K+I+D   F+ P +L   + F+ +  E + W G+F    + + +M RTFI  Q+  +    G+R ++++IS +Y+K+L+LS ASRKE TVGEIVNLMS+DA KF +   + H++W  P  II  +  LW ELGP+ +AGLV+++ M+P+NAVIG+  +K+Q QQ+++ D RIK+++EIL+GIK+LKL+AWE S    V  IR KE   +++A + NA  S  + C P LV+L +FG +VL   +N+L  +KAFVSI+LFNIL FP+ MLP  I   IQ  VS KR+  FL  EE++ D V    +     +I NG F W      P+L++IN+   E  LV IVG VG GKSS++SA+LGE+ K+ G V  K  +AYVPQQAW  N +++DNI+FG      KY ++++AC L  D +IL   D TEIGEKGINLSGGQKQR+SLAR+ Y +S+VYL DDPLSAVD+HVGK + + V SS G+L+  TRILVTH LA L+K D+I VM +G VSE GTY +L+++ G FA+FI T+L  +   ++            EL +K  + +   R   E      + IS LSKS     KSM+      E+   N+ K                        KL++EE +K G VK+ V++ Y++   +  A   IL + +     +  N+ L  WS+   I              N+SQ    DL       RD  LGIYG   F QA+  L  SL  A+ +  ++ +LH ++L  ++R P S F+T P GRI+NR   D++ V   +P+ +  +L +  + I   I++ I +P+ I+ L  +  FY  IQ+ Y+ TSRQL+R++S+ KSPIYSHF E++ G SSIRAY + DKF    +   DK+   ++     NRW+   LE +GN ++ ++ +FAV        I +GL GLSVSYAL IT +L  +VR S ++ESN+V++ERI+EY+++  EAPWDI E KP   WP  G I+F N+S +YR GLD  L+N+NF +   EK+GIVGRTG+GKSSL LALFR++E ++G I ID + I  LGLHD+R +LTIIPQDPVLFSG LR NLDPFN + D EIW  LE++NLK+F   + +  LE  ISE GENLSVGQRQLVCLARALL++TNILVLDEATAAVD++TD LIQ +IR  FK CT+LTIAHRLNT++DYD+++VL+ G+I E++ P  LL + +S F+SMAK + L
Sbjct:   10 CSNKSPDWLLWSSNAIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTRGKFNIIKSILVCGLFFIYCLDLFKSTSDQIAGLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYSR--SIRVKTPANDKFRFITSIIEFVIVFISFIANCFAD----SNVIKQTLTKSSSN----DMDETHL-----LLPNNLNDDKTVEYPV-------------CPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYL---------------------KLESTSSHRYQSLPSENMESNTRKTNISKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNE-YIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTAIISIIYKKALKLSLASRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVSTSNDKPISIVNGNFSWGENEA-PILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSESGTYKELLKNDGPFADFIRTYLEQDDDESSEDCDEESKLIKQELRKKLSITESFGREKGETKSRRNSSISGLSKS-----KSMKT----TEEKTNNVNK------------------------KLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTI--------------NNSQ----DLA-----ARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRIGKDIDTVDVTIPNTVRIWLTSGSRVISSIIIICIASPYFILALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDT---IGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTIKIDDIDITLLGLHDLRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQT-DLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGL 1549          
BLAST of Multidrug resistance-associated protein 1 vs. Planmine SMEST
Match: SMESG000064939.1 (SMESG000064939.1)

HSP 1 Score: 1072.77 bits (2773), Expect = 0.000e+0
Identity = 682/1691 (40.33%), Postives = 967/1691 (57.19%), Query Frame = 2
Query:  122 CYNMSTDWA-----SEWNSPSPDIPTCFQFFDAPIYLLGYLIL-CFPYIIHLIRKK-VNERPFFKLTIIKLALIVCLMVLQILEIIYNAAKK--NNIPYAYTISNCSFLVCMSILAIMVGLERRCNAVNS-GFYFNYWLLHFILCAVRARASGLSLKLKITNRDYSRECFIFINLTFVTLSLVLSCFSEKVSQSEIERLNKKRKFQNVLHVNADDNHVSDRMEMSPNAVDSYKTTEKDILINKTDGNVDLKECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPILLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGXXXXXXXXXXXXXLTSPPDNNKRSIP-QNAXXXXXXXXXXFD---PCLMNALIKSHFPYLLLSGLYKIIHDILAFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHIVFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLELISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNITRKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELKFMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSITLFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSHDDTPGIAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSALLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRIIKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYLLDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIVMNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSF-----XXXXXXXXXXXXXXRTYSEINQSNANMISSLSKSREKIYKSMENLKMDLEKDVANITKLEDNKRCQEELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRSIGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAHNSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQXXXXXXXXXXXXXXXXXXXXXXHKLLLNGVLRCPMSMFETVPVGRIINRFS--------SDLNAVGTMLPHFIN---------GFLVTTLQAIVVFIMVTIPN-----------------------PWIIIPLSLMIAFYILIQRVYVSTSRQLKRLESVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTVSNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSITQTLNWLVRMXXXXXXXXXXXXXXXXYSQMPPEAPWDISEKKPDENWPV-GCIKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFRILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFNKHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLARALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTVLDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNL 5014
            C N S DW      + W++P+PD+  CFQ+       L +LI+ C   I  L+RKK +      K  IIK  L+  L  +  L++  + + +     P              S+L I V        V+S G  F YW L  I+ A+   +   S+++K    D  R     I    V +S + +CF++    S + +    +   N    + D+ H+     + PN ++  KT E  +             CPE  +SFLS+I F W T LI +G++ PL  +DL++L  E+ C  IVPI+ R +++ L    R+  K   +                     KL S   +  +S+P +N E++T K     D   P  +  L+ +       SGL K+I+D   F+ P +L   + F+ +  E + W G+F    + + +M RTFI  Q+  +    G+R ++++IS +Y+K+L+LS ASRKE TVGEIVNLMS+DA KF +   + H++W  P  II  +  LW ELGP+ +AGLV+++ M+P+NAVIG+  +K+Q QQ+++ D RIK+++EIL+GIK+LKL+AWE S    V  IR KE   +++A + NA  S  + C P LV+L +FG +VL   +N+L  +KAFVSI+LFNIL FP+ MLP  I   IQ  VS KR+  FL  EE++ D V    +     +I NG F W      P+L++IN+   E  LV IVG VG GKSS++SA+LGE+ K+ G V  K  +AYVPQQAW  N +++DNI+FG      KY ++++AC L  D +IL   D TEIGEKGINLSGGQKQR+SLAR+ Y +S+VYL DDPLSAVD+HVGK + + V SS G+L+  TRILVTH LA L+K D+I VM +G VSE GTY +L+++ G FA+FI T+L  +   ++            EL +K  + +   R   E      + IS LSKS     KSM+      E+   N+ K                        KL++EE +K G VK+ V++ Y++   +  A   IL + +     +  N+ L  WS+   I              N+SQ    DL       RD  LGIYG   F QA+  L  SL  A+ +  ++ +LH ++L  ++R P S F+T P GRI+NR           DL+   T L  F++         G  V  +   +  + VTIPN                       P+ I+ L  +  FY  IQ+ Y+ TSRQL+R++S+ KSPIYSHF E++ G SSIRAY + DKF    +   DK+   ++     NRW+   LE +GN ++ ++ +FAV        I +GL GLSVSYAL IT +L  +VR S ++ESN+V++ERI+EY+++  EAPWDI E KP   WP  G I+F N+S +YR GLD  L+N+NF +   EK+GIVGRTG+GKSSL LALFR++E ++G I ID + I  LGLHD+R +LTIIPQDPVLFSG LR NLDPFN + D EIW  LE++NLK+F   + +  LE  ISE GENLSVGQRQLVCLARALL++TNILVLDEATAAVD++TD LIQ +IR  FK CT+LTIAHRLNT++DYD+++VL+ G+I E++ P  LL + +S F+SMAK + L
Sbjct:   10 CSNKSPDWLLWSSNAIWDTPNPDLTLCFQYTILNWIPLMFLIIGCAINIPILLRKKSIYYSTRGKFNIIKSILVCGLFFIYCLDLFKSTSDQIAGLQPPVAQFLQPILSAVFSLLVIYVNRLTYIKGVHSSGILFIYWSLQLIVNAIILYSR--SIRVKTPANDKFRFITSIIEFVIVFISFIANCFAD----SNVIKQTLTKSSSN----DMDETHL-----LLPNNLNDDKTVEYPV-------------CPELKASFLSKITFSWPTRLIYRGFRKPLTIDDLYMLKEEDSCKEIVPIIDREWNRELDRVHRKIIKQQYL---------------------KLESTSSHRYQSLPSENMESNTRKTNISKDTPKPWFLRVLLHTISYKFFFSGLLKVIYDQSNFIQPAILGYYINFIGNHNE-YIWHGFFYMFCIFLVSMARTFINQQFMFMCAVTGIRAKTAIISIIYKKALKLSLASRKERTVGEIVNLMSVDASKFQDFPFFFHLLWVSPITIIVTMYFLWQELGPATIAGLVLLICMLPINAVIGSKIKKLQTQQMRMKDGRIKLISEILSGIKILKLFAWELSLEEKVKTIREKECLVLRKAMFLNAFTSVAWFCTPPLVALFSFGAYVLADPNNILTPQKAFVSISLFNILNFPMSMLPGAIVFTIQGLVSAKRINHFLNGEELDPDNVEVSTSNDKPISIVNGNFSWGENEA-PILRDINLEIEEGSLVMIVGTVGSGKSSLISAILGEMFKISGTVKRKEPVAYVPQQAWCQNRSLQDNILFGKSMVYSKYHKVLEACALIEDLKILPAGDQTEIGEKGINLSGGQKQRISLARSVYQNSSVYLFDDPLSAVDAHVGKHIFEKVFSSDGLLSKTTRILVTHGLAYLAKADKIFVMKDGNVSESGTYKELLKNDGPFADFIRTYLEQDDDESSEDCDEESKLIKQELRKKLSITESFGREKGETKSRRNSSISGLSKS-----KSMKT----TEEKTNNVNK------------------------KLVDEEVAKIGGVKLEVFIYYIQCGSYLFAMLAILCYCSYLAALVSGNIVLSSWSEAGTI--------------NNSQ----DLA-----ARDYFLGIYGGLAFTQAIFILIQSLSLAYGMFLASKTLHNVMLRSIIRAPNSFFDTTPSGRILNRLEMFIVTFKRKDLHETITFL-RFLSLSSHSFHEKGEEVVEIGKDIDTVDVTIPNTVRIWLTSGSRVISSIIIICIASPYFILALIPLSFFYFFIQKFYICTSRQLQRIDSIRKSPIYSHFQESIIGTSSIRAYKVTDKFTTKCEELTDKSQMVWFLIISCNRWMQFYLELIGNIVILLSGVFAVFIRDT---IGSGLAGLSVSYALMITTSLAVMVRNSCDIESNVVAIERIKEYTEIESEAPWDIPEVKPPSEWPQNGKIEFSNFSVRYRPGLDLALRNLNFTVQRGEKLGIVGRTGAGKSSLALALFRLIEPAEGTIKIDDIDITLLGLHDLRSKLTIIPQDPVLFSGNLRINLDPFNLYSDGEIWIALEIANLKSFFAQT-DLGLEFTISENGENLSVGQRQLVCLARALLKKTNILVLDEATAAVDMETDELIQNSIRTAFKSCTVLTIAHRLNTIMDYDRVMVLQQGQIKEINTPKKLLADEKSLFHSMAKDAGL 1588          
The following BLAST results are available for this feature:
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABCC10.000e+044.17ATP binding cassette subfamily C member 1 [Source:... [more]
ABCC10.000e+044.17ATP binding cassette subfamily C member 1 [Source:... [more]
ABCC10.000e+045.50ATP binding cassette subfamily C member 1 [Source:... [more]
ABCC10.000e+045.50ATP binding cassette subfamily C member 1 [Source:... [more]
ABCC10.000e+050.00ATP binding cassette subfamily C member 1 [Source:... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mrp-10.000e+045.28pep chromosome:WBcel235:X:576318:587483:-1 gene:WB... [more]
mrp-10.000e+045.07pep chromosome:WBcel235:X:576318:587483:-1 gene:WB... [more]
mrp-10.000e+045.21pep chromosome:WBcel235:X:576318:587483:-1 gene:WB... [more]
mrp-20.000e+044.62pep chromosome:WBcel235:X:563719:572701:-1 gene:WB... [more]
mrp-10.000e+045.21pep chromosome:WBcel235:X:576318:587483:-1 gene:WB... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MRP0.000e+044.11gene:FBgn0032456 transcript:FBtr0090025[more]
MRP0.000e+043.80gene:FBgn0032456 transcript:FBtr0090026[more]
MRP0.000e+043.93gene:FBgn0032456 transcript:FBtr0090022[more]
MRP0.000e+043.80gene:FBgn0032456 transcript:FBtr0090023[more]
MRP0.000e+043.56gene:FBgn0032456 transcript:FBtr0090024[more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abcc30.000e+043.96ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
abcc10.000e+042.38ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
abcc10.000e+043.19ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
abcc20.000e+043.30ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
abcc20.000e+043.30ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
septin90.000e+043.70septin 9 [Source:Xenbase;Acc:XB-GENE-1012202][more]
ABCC10.000e+048.29ATP binding cassette subfamily C member 1 [Source:... [more]
ABCC10.000e+048.17ATP binding cassette subfamily C member 1 [Source:... [more]
ABCC10.000e+048.00ATP binding cassette subfamily C member 1 [Source:... [more]
ABCC10.000e+048.51ATP binding cassette subfamily C member 1 [Source:... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Abcc10.000e+043.88ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
Abcc30.000e+043.01ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
Abcc30.000e+043.01ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
Abcc20.000e+040.77ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
Abcc60.000e+035.26ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q864R9|MRP1_MACFA0.000e+044.32Multidrug resistance-associated protein 1 OS=Macac... [more]
sp|Q5F364|MRP1_CHICK0.000e+044.68Multidrug resistance-associated protein 1 OS=Gallu... [more]
sp|Q6UR05|MRP1_CANLF0.000e+044.38Multidrug resistance-associated protein 1 OS=Canis... [more]
sp|O35379|MRP1_MOUSE0.000e+043.88Multidrug resistance-associated protein 1 OS=Mus m... [more]
sp|P33527|MRP1_HUMAN0.000e+044.17Multidrug resistance-associated protein 1 OS=Homo ... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I2CX200.000e+044.32Multidrug resistance-associated protein 1 isoform ... [more]
A0A0D9R6N70.000e+044.16ATP binding cassette subfamily C member 1 OS=Chlor... [more]
A0A096NLW50.000e+044.34ATP binding cassette subfamily C member 1 OS=Papio... [more]
A0A2K5NES60.000e+044.27ATP binding cassette subfamily C member 1 OS=Cerco... [more]
F6WW020.000e+044.26ATP binding cassette subfamily C member 1 OS=Macac... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abcc30.000e+043.35ATP binding cassette subfamily C member 3 [Source:... [more]
abcc30.000e+042.97ATP binding cassette subfamily C member 3 [Source:... [more]
abcc10.000e+047.64ATP binding cassette subfamily C member 1 [Source:... [more]
abcc10.000e+047.57ATP binding cassette subfamily C member 1 [Source:... [more]
abcc30.000e+047.00ATP binding cassette subfamily C member 3 [Source:... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abcc30.000e+042.01ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
ENSPMAT00000006454.11.047e-11944.47pep scaffold:Pmarinus_7.0:GL483531:32:7621:1 gene:... [more]
ENSPMAT00000007076.11.536e-11744.38pep scaffold:Pmarinus_7.0:GL480539:10051:22495:1 g... [more]
ENSPMAT00000001536.18.838e-10237.65pep scaffold:Pmarinus_7.0:GL479104:2125:31869:1 ge... [more]
ENSPMAT00000005186.11.687e-9537.94pep scaffold:Pmarinus_7.0:GL480017:11317:29304:1 g... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
BPT10.000e+038.60ABC type transmembrane transporter of MRP/CFTR fam... [more]
YBT10.000e+034.87Transporter of the ATP-binding cassette (ABC) fami... [more]
VMR10.000e+034.19Vacuolar membrane protein; involved in multiple dr... [more]
YOR19.496e-17628.11Plasma membrane ATP-binding cassette (ABC) transpo... [more]
YCF12.489e-15046.13Vacuolar glutathione S-conjugate transporter; ABC-... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO364740.000e+048.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO350711.588e-1545.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412570.000e+035.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO316476.062e-3538.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO467440.000e+034.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abcc30.000e+042.49ATP binding cassette subfamily C member 3 [Source:... [more]
abcc10.000e+043.21multidrug resistance-associated protein 1 [Source:... [more]
abcc30.000e+042.21ATP binding cassette subfamily C member 3 [Source:... [more]
abcc11.062e-1343.12multidrug resistance-associated protein 1 [Source:... [more]
abcc11.105e-1343.12multidrug resistance-associated protein 1 [Source:... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014785.10.000e+099.94SMESG000014785.1[more]
SMESG000057252.10.000e+041.73SMESG000057252.1[more]
SMESG000039911.10.000e+040.49SMESG000039911.1[more]
SMESG000064939.10.000e+041.01SMESG000064939.1[more]
SMESG000064939.10.000e+040.33SMESG000064939.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30029026 ID=SMED30029026|Name=Multidrug resistance-associated protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=5261bp
TTTAATTATTAGCTAAAATTTCTTTTTTAAATAGAATTATAGTGAAACTT
GTTTTTGATAAATTAATTGTTTTTCACTCACCCAGTAAAAGAATATGAAT
AGATTAGTACCAAATAAGACATGTTATAACATGTCAACTGATTGGGCTTC
AGAATGGAATTCACCGTCACCTGATATACCAACTTGTTTTCAGTTTTTCG
ATGCTCCTATTTATTTATTAGGATATCTAATATTGTGTTTTCCGTATATA
ATCCATTTAATCAGAAAGAAAGTTAACGAGAGGCCCTTTTTTAAATTGAC
AATAATCAAATTAGCTCTAATAGTTTGCCTAATGGTCCTGCAGATTCTCG
AGATCATATATAACGCCGCTAAGAAGAATAATATTCCTTACGCATATACC
ATTTCTAATTGTTCCTTTCTGGTCTGTATGTCAATCTTGGCAATAATGGT
AGGCCTCGAACGCAGATGTAATGCTGTGAATTCTGGATTTTATTTCAATT
ATTGGCTGTTGCACTTCATATTATGCGCCGTTAGGGCCCGTGCTTCCGGT
CTCAGTCTGAAGCTAAAAATAACAAATAGAGATTATTCTAGAGAATGTTT
TATTTTTATTAACTTAACTTTCGTTACTTTGTCCTTGGTTTTGAGTTGCT
TCTCCGAGAAAGTATCTCAGAGTGAAATTGAAAGGCTCAACAAAAAGCGA
AAATTTCAAAATGTCCTCCACGTCAATGCGGATGACAATCATGTTTCAGA
TAGGATGGAAATGTCTCCGAATGCCGTGGACAGTTATAAGACAACCGAGA
AAGATATTTTGATAAATAAAACTGATGGAAACGTTGATCTGAAAGAATGT
CCAGAATATTATTCATCATTTCTCTCAAGAATAATATTTTTTTGGTTTAC
TCCCTTAATAGTGAAAGGCTACAAAATTCCTTTGAAAAATGAGGATTTAT
GGGTTTTGAATACAGAAGAGCGCTGTTCGAGTATCGTGCCGATATTGTTG
AGAAATTTCGACAAATGTCTTGCGCCAAATAAACGTCGTGACAGCAAATC
CGATAAAATGTTGACCAATGATAAAAATAACTCCGGTAAAAAGTACAAAG
AAATCGAAGAACCAGAAAAAGAGAAGCTTACTAGTCCACCTGATAACAAC
AAAAGGAGCATCCCTCAAAATGCAGAAACTGATACTGACAAGAAAAAAGA
AAAATTCGATCCTTGCTTGATGAACGCCCTTATCAAATCTCATTTTCCAT
ATCTTTTACTCTCAGGGTTATATAAGATTATTCACGATATTCTTGCATTT
CTAGGGCCTATTTTGCTCAAATTGCTTTTGCAATTTGTATCTGATTCCGA
AGAACGCCATTATTGGAAGGGATATTTTATAGCCGCATTAATGATGATAT
CAGCTATGGTGAGGACATTTATCCTTCATCAGTATTTCCATATCGTTTTC
AAAATTGGAATGAGAGTTAGATCTTCGTTGATTTCCGCCGTCTACAGAAA
GTCGTTACGGCTCAGTACTGCGTCTCGGAAAGAATCAACAGTTGGTGAAA
TTGTTAACCTAATGTCAATTGATGCTCAAAAGTTCCTTGAGCTAATCAGT
TATATCCACATGATCTGGAGTGGCCCATTTCAGATTATAGCCGCTCTAAT
TCTATTATGGTACGAATTGGGGCCGTCAGTTTTGGCTGGTTTGGTGATTA
TGTTACTAATGATACCGGTAAATGCCGTCATTGGCAATATCACTAGGAAA
ATTCAGGCCCAACAAATCAAAGTAACAGATTCTCGGATAAAAATGATGAA
TGAAATTCTCAATGGGATTAAAGTTCTGAAATTATACGCATGGGAACCTT
CGTTTATCAACTTCGTTACAGAAATAAGAAACAAGGAATTGAAGTTCATG
AAACGGGCAGCTTACTATAATGCCGCGATTTCATTTACTTTCAATTGTGC
ACCGTTCCTCGTCTCTTTGACGACTTTTGGAATGTTCGTTCTGATATCGC
GCGACAACGTCCTGGATGCTGAAAAGGCATTCGTATCGATAACCCTATTC
AACATTCTCAGATTCCCCTTAATGATGTTACCAATGGTCATATCAAATTT
GATTCAAGCATCTGTCTCTCTCAAACGACTTACTACATTTCTCAGGCGCG
AGGAAATAAATAAAGATGCCGTTTCTCACGACGATACTCCTGGAATCGCT
GCAACCATCAAAAATGGGATTTTTAAATGGGACTCAACAACCCCAGAACC
GGTTTTGAAAAACATTAACATTACGTTTCCTGAACGGCACTTGGTCGCAA
TCGTTGGTCCGGTTGGCTGTGGAAAGTCCAGCATCCTCAGTGCATTGTTA
GGGGAAATAGATAAACTGGAAGGATATGTAAATATGAAGGGTTCAATTGC
GTACGTACCTCAGCAGGCGTGGATCATAAATGCTACCATTAGAGATAATA
TCATATTTGGCCTACCATATGATGCGTGTAAATATCAAAGAATAATCAAA
GCTTGTTGTTTGGAAAGGGATTTCGAAATTCTAAATGACGCAGATTTCAC
GGAAATCGGTGAAAAAGGAATCAACTTATCCGGTGGTCAAAAACAAAGAG
TCAGCTTAGCCCGAGCATGTTATAGTGATTCAAATGTTTATCTTCTGGAT
GATCCTTTGAGTGCTGTTGATAGTCATGTTGGGAAGGATCTTATAGATAA
TGTGATCAGTTCCACCGGAATTCTAAATGGCAACACACGAATTCTGGTCA
CTCATAATTTGGCCATACTGTCGAAATGTGACAGGATCATTGTCATGAAT
AATGGAATGGTATCAGAAGAAGGGACATATTCTGATTTGATTAGGCATGC
TGGGGCATTTGCAAATTTTATCGCCACTCATTTAGCCGATGAACTCCAAG
CAACAAATAATCAAAATTTCAGTTTCGATGAACTTGAAGAAAAGGATCTA
CTTCTTCAAGATCTCCAACGAACATATTCTGAAATAAATCAAAGCAACGC
AAATATGATATCTTCTTTGTCCAAAAGCAGAGAAAAAATCTACAAATCAA
TGGAAAACTTAAAAATGGACCTAGAGAAAGATGTAGCCAACATTACGAAA
TTGGAGGATAACAAACGATGCCAAGAAGAATTGGATAAATTTTTGAAACC
TGGAGCACAAAAGAATGGCAATAAGCTCATTGAAGAGGAGACATCTAAGG
AAGGAAATGTTAAAATGGCTGTGTATATGGCTTATTTACGGTCAATAGGA
TTTTGGCTGGCAGCAGGAATAATACTGTTGTTTGTTACCACTCAAGGGTT
TAGTTTGGGTTCGAATTTATGGCTTGTTAGGTGGTCGGATCAATCGAAAA
TTGCGGCAAACCTTTCAAAGGAACTGAAAGAATTAATTGCTCATAATTCT
AGCCAAAAACAAATTGATGATCTGAGAAAGATTATCCGAGACCAAAGAGA
CCTAAATCTTGGAATCTATGGAGTGTTTGGTTTTTGTCAAGCTTTGATCC
AGTTATTTTCATCATTATTCTTTGCTTTTGCTATTATCAAGTCGGCAGCG
AGTCTTCATAAGCTGTTGTTAAATGGCGTATTGCGCTGTCCGATGAGCAT
GTTTGAAACTGTCCCCGTCGGCAGGATCATCAATAGATTTTCCAGTGATC
TAAATGCTGTGGGAACGATGCTCCCGCATTTTATCAATGGATTTTTAGTG
ACAACCTTACAGGCCATCGTAGTGTTCATCATGGTCACTATTCCAAATCC
TTGGATTATTATTCCTCTCTCTTTAATGATTGCTTTTTATATATTAATTC
AGAGAGTTTACGTTTCGACTTCTCGGCAATTGAAACGGTTGGAATCAGTA
GTAAAATCTCCGATTTATTCTCATTTCGGTGAGACTCTCCAAGGCGTGTC
GAGCATCAGAGCATATTCTTTATGTGATAAATTCATCGAATCCAATGATA
ACAAAGTGGACAAAAATCTCTATTCTTATTATGCCAATACCGTTTCTAAC
AGGTGGCTTGCTATAATATTGGAAACAGTTGGCAATAGTATCGTGTTTAT
GGCAGCATTATTTGCTGTGATAAGCTTACAAAACGGTACTGGGATAAATG
CCGGTTTAGTTGGCCTATCTGTCAGTTACGCGCTGAGTATTACTCAGACC
TTAAATTGGTTGGTACGAATGAGTTCGGAAGTTGAATCGAATATCGTCTC
TGTTGAACGTATTGAAGAGTATTCGCAAATGCCTCCTGAAGCTCCATGGG
ATATCTCAGAGAAGAAACCCGACGAAAACTGGCCAGTAGGATGCATCAAA
TTTGTAAACTATTCCACAAAGTACCGAGAAGGATTGGATAATGTTCTGAA
AAATATCAATTTTATTATTAACCCCCGGGAAAAGGTTGGTATAGTTGGTC
GAACAGGATCCGGAAAATCGTCCTTAGTTTTGGCTTTGTTTCGGATTTTG
GAAAAGTCTGATGGTGAAATTTTAATTGACGGGTTGCCTATTCACGAGCT
TGGACTGCATGATGTTCGTGGCCGTTTGACAATAATCCCTCAAGATCCGG
TTTTATTTTCCGGAACTCTGCGTCGAAATCTCGATCCATTCAACAAGCAT
GGGGATGAAGAAATATGGAAAGTTTTAGAAATGTCCAACCTGAAGACGTT
TGTTGTCAATTCTGGAAACGAGCAGTTAGAAATGGTGATATCTGAGGGAG
GGGAAAATCTGAGTGTTGGACAAAGGCAATTGGTTTGTTTGGCTCGAGCT
CTTTTGAGAAGGACTAATATTCTCGTTCTTGATGAAGCCACTGCAGCGGT
TGATTTAGATACCGACGTGTTAATACAGGAAACGATTAGAAGGGAATTCA
AGGAATGCACAATTCTTACTATTGCACATCGACTCAACACTGTGCTCGAT
TATGATCAGATCCTAGTGCTAGAAAACGGCGAGATTATCGAGATGGATGC
ACCAAATAACCTCCTGAAGAATCCCGAGTCCCAGTTCTATTCAATGGCGA
AAAGCTCGAATCTCATCTAGATATTGTTTGATAGATTACTGTGCATTTGC
GGCCTCTAGGAAATGTTCCAATGATGACTGTTTGCACGTGTGTGTGTATT
GATTGATATTGATAAATATTGTTTGATTGGGCAATGCGATCTATTTGATC
CGATCTTGTTGTCCAGCTCTGATTGGATGTTTTCACGTTGTAATGCGCGT
TTGATGATTTAATTTGTCCTACATAATCAACAAATTTTTCAATAAAATTT
CAACTTCTTAA
back to top

protein sequence of SMED30029026-orf-1

>SMED30029026-orf-1 ID=SMED30029026-orf-1|Name=SMED30029026-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1642bp
MNRLVPNKTCYNMSTDWASEWNSPSPDIPTCFQFFDAPIYLLGYLILCFP
YIIHLIRKKVNERPFFKLTIIKLALIVCLMVLQILEIIYNAAKKNNIPYA
YTISNCSFLVCMSILAIMVGLERRCNAVNSGFYFNYWLLHFILCAVRARA
SGLSLKLKITNRDYSRECFIFINLTFVTLSLVLSCFSEKVSQSEIERLNK
KRKFQNVLHVNADDNHVSDRMEMSPNAVDSYKTTEKDILINKTDGNVDLK
ECPEYYSSFLSRIIFFWFTPLIVKGYKIPLKNEDLWVLNTEERCSSIVPI
LLRNFDKCLAPNKRRDSKSDKMLTNDKNNSGKKYKEIEEPEKEKLTSPPD
NNKRSIPQNAETDTDKKKEKFDPCLMNALIKSHFPYLLLSGLYKIIHDIL
AFLGPILLKLLLQFVSDSEERHYWKGYFIAALMMISAMVRTFILHQYFHI
VFKIGMRVRSSLISAVYRKSLRLSTASRKESTVGEIVNLMSIDAQKFLEL
ISYIHMIWSGPFQIIAALILLWYELGPSVLAGLVIMLLMIPVNAVIGNIT
RKIQAQQIKVTDSRIKMMNEILNGIKVLKLYAWEPSFINFVTEIRNKELK
FMKRAAYYNAAISFTFNCAPFLVSLTTFGMFVLISRDNVLDAEKAFVSIT
LFNILRFPLMMLPMVISNLIQASVSLKRLTTFLRREEINKDAVSHDDTPG
IAATIKNGIFKWDSTTPEPVLKNINITFPERHLVAIVGPVGCGKSSILSA
LLGEIDKLEGYVNMKGSIAYVPQQAWIINATIRDNIIFGLPYDACKYQRI
IKACCLERDFEILNDADFTEIGEKGINLSGGQKQRVSLARACYSDSNVYL
LDDPLSAVDSHVGKDLIDNVISSTGILNGNTRILVTHNLAILSKCDRIIV
MNNGMVSEEGTYSDLIRHAGAFANFIATHLADELQATNNQNFSFDELEEK
DLLLQDLQRTYSEINQSNANMISSLSKSREKIYKSMENLKMDLEKDVANI
TKLEDNKRCQEELDKFLKPGAQKNGNKLIEEETSKEGNVKMAVYMAYLRS
IGFWLAAGIILLFVTTQGFSLGSNLWLVRWSDQSKIAANLSKELKELIAH
NSSQKQIDDLRKIIRDQRDLNLGIYGVFGFCQALIQLFSSLFFAFAIIKS
AASLHKLLLNGVLRCPMSMFETVPVGRIINRFSSDLNAVGTMLPHFINGF
LVTTLQAIVVFIMVTIPNPWIIIPLSLMIAFYILIQRVYVSTSRQLKRLE
SVVKSPIYSHFGETLQGVSSIRAYSLCDKFIESNDNKVDKNLYSYYANTV
SNRWLAIILETVGNSIVFMAALFAVISLQNGTGINAGLVGLSVSYALSIT
QTLNWLVRMSSEVESNIVSVERIEEYSQMPPEAPWDISEKKPDENWPVGC
IKFVNYSTKYREGLDNVLKNINFIINPREKVGIVGRTGSGKSSLVLALFR
ILEKSDGEILIDGLPIHELGLHDVRGRLTIIPQDPVLFSGTLRRNLDPFN
KHGDEEIWKVLEMSNLKTFVVNSGNEQLEMVISEGGENLSVGQRQLVCLA
RALLRRTNILVLDEATAAVDLDTDVLIQETIRREFKECTILTIAHRLNTV
LDYDQILVLENGEIIEMDAPNNLLKNPESQFYSMAKSSNLI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0008559xenobiotic-transporting ATPase activity
GO:0015431glutathione S-conjugate-exporting ATPase activity
GO:0022857transmembrane transporter activity
GO:0042910xenobiotic transporter activity
GO:0005524ATP binding
GO:0042626ATPase activity, coupled to transmembrane movement of substances
GO:0016887ATPase activity
GO:0000166nucleotide binding
GO:0005215transporter activity
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0042493response to drug
GO:0042908xenobiotic transport
GO:0050729positive regulation of inflammatory response
GO:0071716leukotriene transport
GO:0006810transport
GO:0055085transmembrane transport
Vocabulary: INTERPRO
TermDefinition
IPR036640ABC1_TM_sf
IPR005292Multidrug-R_assoc
IPR003593AAA+_ATPase
IPR027417P-loop_NTPase
IPR011527ABC1_TM_dom
IPR003439ABC_transporter-like
IPR017871ABC_transporter_CS
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005886plasma membrane
GO:0005887integral component of plasma membrane
GO:0016020membrane
GO:0016323basolateral plasma membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 983..1006
NoneNo IPR availableCOILSCoilCoilcoord: 947..967
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1386..1637
e-value: 4.0E-81
score: 274.1
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 703..935
e-value: 1.5E-69
score: 236.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 316..349
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 316..368
NoneNo IPR availablePANTHERPTHR24223FAMILY NOT NAMEDcoord: 100..1640
NoneNo IPR availablePANTHERPTHR24223:SF350CANALICULAR MULTISPECIFIC ORGANIC ANION TRANSPORTER 2coord: 100..1640
NoneNo IPR availableCDDcd03250ABCC_MRP_domain1coord: 705..904
e-value: 1.04149E-107
score: 339.06
NoneNo IPR availableCDDcd03244ABCC_MRP_domain2coord: 1399..1620
e-value: 3.21047E-125
score: 388.39
NoneNo IPR availableCDDcd18595ABC_6TM_MRP1_2_3_6_D1_likecoord: 389..679
e-value: 6.15076E-155
score: 471.569
NoneNo IPR availableCDDcd18603ABC_6TM_MRP1_2_3_6_D2_likecoord: 1059..1377
e-value: 1.1961E-131
score: 409.176
NoneNo IPR availableTMHMMTMhelixcoord: 612..634
NoneNo IPR availableTMHMMTMhelixcoord: 68..87
NoneNo IPR availableTMHMMTMhelixcoord: 1304..1326
NoneNo IPR availableTMHMMTMhelixcoord: 500..522
NoneNo IPR availableTMHMMTMhelixcoord: 386..408
NoneNo IPR availableTMHMMTMhelixcoord: 34..56
NoneNo IPR availableTMHMMTMhelixcoord: 1124..1146
NoneNo IPR availableTMHMMTMhelixcoord: 654..676
NoneNo IPR availableTMHMMTMhelixcoord: 131..153
NoneNo IPR availableTMHMMTMhelixcoord: 1050..1072
NoneNo IPR availableTMHMMTMhelixcoord: 1221..1240
NoneNo IPR availableTMHMMTMhelixcoord: 428..450
NoneNo IPR availableTMHMMTMhelixcoord: 527..549
NoneNo IPR availableTMHMMTMhelixcoord: 168..187
NoneNo IPR availableTMHMMTMhelixcoord: 97..119
NoneNo IPR availableTMHMMTMhelixcoord: 1195..1217
IPR003593AAA+ ATPase domainSMARTSM00382AAA_5coord: 730..904
e-value: 7.5E-9
score: 45.4
coord: 1427..1613
e-value: 1.4E-14
score: 64.4
IPR036640ABC transporter type 1, transmembrane domain superfamilyGENE3DG3DSA:1.20.1560.10coord: 1020..1384
e-value: 1.6E-43
score: 151.1
coord: 354..691
e-value: 3.0E-27
score: 97.6
IPR036640ABC transporter type 1, transmembrane domain superfamilySUPERFAMILYSSF90123ABC transporter transmembrane regioncoord: 376..679
IPR036640ABC transporter type 1, transmembrane domain superfamilySUPERFAMILYSSF90123ABC transporter transmembrane regioncoord: 1054..1384
IPR005292Multi drug resistance-associated proteinTIGRFAMTIGR00957TIGR00957coord: 245..1639
e-value: 0.0
score: 1581.5
IPR003439ABC transporter-likePFAMPF00005ABC_trancoord: 721..855
e-value: 1.5E-20
score: 74.1
IPR003439ABC transporter-likePFAMPF00005ABC_trancoord: 1418..1567
e-value: 6.5E-29
score: 101.2
IPR003439ABC transporter-likePROSITEPS50893ABC_TRANSPORTER_2coord: 1401..1636
score: 19.234
IPR003439ABC transporter-likePROSITEPS50893ABC_TRANSPORTER_2coord: 683..928
score: 22.142
IPR011527ABC transporter type 1, transmembrane domainPFAMPF00664ABC_membranecoord: 1060..1351
e-value: 2.3E-31
score: 109.5
coord: 387..659
e-value: 2.3E-41
score: 142.3
IPR011527ABC transporter type 1, transmembrane domainPROSITEPS50929ABC_TM1Fcoord: 1057..1365
score: 37.433
IPR011527ABC transporter type 1, transmembrane domainPROSITEPS50929ABC_TM1Fcoord: 388..671
score: 39.747
IPR017871ABC transporter, conserved sitePROSITEPS00211ABC_TRANSPORTER_1coord: 1539..1553
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 703..927
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 1397..1634